2KWLA

Solution structure of acyl carrier protein from borrelia burgdorferi
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
b'GPGSMDNDEIFSKVRSIISEQLDKKEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENEANEFETVGDVVNFIKKRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title NMR structure of an acyl-carrier protein from Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Lipid binding protein
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kwlA00
2M5RA 3CE7A 5KP8B 1HY8A 2CG5B 2N5HA 2N98A 3NY7B 2L22A 2JU1A 2EHTA 2MR7A 2N6ZA 2KG6A 4MRTC 1AF8A 2KR5A 2L9FA 1KLPA 4PXHB 2L4BA 2FVFA 2AVAA 2MD9A 1VKUA 2KG8A 2K92A 2LOLA 1L0HA 3GZLA 2GDWA 2EHSA 2FQ2A 2KGCA 2LKIA 2KWLA 2MF4A 2LTEA 2FHSC 2MR8A 2FQ0A 2KOQA 2N50A 3EJEA 2K0XA 3LMOA 2KORA 1ACPA 2N5IA 4PWVB 5EJDA 2LIUA 1X3OA 2DNWA 1NQ4A 2CGQA 2JGPA 2AF8A 2FVEA 2KGEA 2FADA 2FACA 4H2XC 4IZ6A 2KOPA 1F80D 2N6YA 4H2WC 2X2BA 2LIWA 2MY5A 1OR5A 2GDYA 2CQ8A 2QNWA 4H2YC 2MVVA 3EJBA 2AFDA 2FVAA 4BPFA 2GDXA 2VSQA 2MVUA 4BPGA 5HVCA 5KP6B 2FAEA 2KW2A 4DG9A 2CNRA 2KGDA 3GZMA 4HKGA 2ROQA 4NEOA 2FQ1A 2K94A 2LL8A 2KGAA 2JU2A 2LMLA 2KG9A 1HQBA 4BPHA 2K93A 2JQ4A 1DNYA 2XZ1C 2PNGA 3RG2A 4CA3A 1DV5A 2L0QA 2LPKA 2K2QA 5KP7B 5HV8A 1T8KA 5CZDB 2XZ0D 2KOOA 2K0YA 3EJDA 1L0IA 2AFEA 2KOSA 4R0MA
chains in the Genus database with same CATH superfamily
3DS5A 3G71P 2M5RA 4GR2A 5JPAA 2XXMA 3P05A 3NY7B 4GR6A 4U0CA 1AYIA 2KR5A 2L9FA 1KLPA 5I4TG 2PENA 4WYMA 2FVFA 2AVAA 5HGOA 7CEIA 1QRJA 3GZLA 1FR2A 2EHSA 1YJWP 2GZIA 2KWLA 2MF4A 3G28A 1GXHA 2XV6A 4U0EA 1VQMP 2KOQA 1YJNP 2EG5A 2EFJA 3LMOA 1M90Q 1ACPA 4PWVB 1VQ5P 3HYBA 1X3OA 1NQ4A 2JGPA 2AF8A 4XROA 4XFYA 2VLOA 3I56P 2FADA 2PEOA 5BS1A 1D1DA 2PY8A 4U0BA 1F80D 3G6EP 1OR5A 2GDYA 3G29A 3CCLP 4H2YC 1YJ9P 3CCSP 2KW2A 1M1KQ 4DG9A 3GZMA 1RO0A 1VQLP 1ZMBA 1RO2A 3G21A 2KGAA 2QEXP 3CMEP 2JO0A 3DPHA 2BUOA 3M1MA 1YITP 3DS3A 4CA3A 1QVGO 2VLQA 1A8OA 1E0HA 1AUMA 3G1IA 2JBGA 1T8KA 3GJNA 2K0YA 1Q86Q 4QKOA 4R0MA 3DS4A 1IUQA 2NO8A 5KP8B 3CC2P 2XT1A 1HY8A 1VQKP 2CG5B 2N5HA 1Z6MA 2JU1A 2EHTA 2MR7A 2KG6A 3CCQP 3CC7P 5F2NA 4PH1A 1VKUA 3G0VA 1IMPA 4U0FA 2K92A 1EMVA 2GDWA 2FQ2A 2LKIA 1ZNVA 1Q81Q 1UJZA 2JAZA 4F37A 2MR8A 1KQSO 3CMAP 5DCKA 1Q82Q 1S72P 1M74A 1W2BO 2LIUA 4XRQA 3H4EA 1VQOP 2N6YA 3U43A 1BXIA 2QNWA 2MVVA 3DS1A 5HVCA 2FAEA 5F2KA 4HKGA 4M0IA 3GKLC 2JB0A 2JU2A 2K93A 3CCVP 1CEIA 5EW5E 2GZEA 1A43A 2K2QA 5KP7B 2GZGA 3DTJA 5HGLA 1L0IA 1E6JP 3CE7A 2BHVA 1K8AQ 2N98A 2L22A 4COCA 4UHPB 1EOQA 1AF8A 1K9MQ 4PXHB 2GYKA 2L4BA 2MD9A 3H47A 1VQPP 2KG8A 3G1GA 2OARA 3B5IA 1Q7YQ 4XFXA 2KGCA 1VQ6P 2LTEA 3VRLC 2FHSC 2K5XA 1VHNA 1JJ2O 1GXGA 2N50A 1N8RQ 3H0DA 3E2DA 3EJEA 3Q20A 2Z45A 3CCUP 3WBHA 5EJDA 1VQ7P 3CCMP 5F2OA 3CD6P 2CGQA 3MGEA 2WPTA 2EIAA 5BS2A 4IZ6A 4H2WC 2X2BA 1VQ4P 2CQ8A 2FVAA 2PEQA 4BPFA 2P9XA 2GDXA 4BPGA 2OTJP 5KP6B 2Z44A 2CNRA 2KGDA 3RG6C 2ROQA 5HGMA 3CPWO 2PEIA 2K0DX 2FQ1A 2LL8A 1HQBA 2OTLP 2JQ4A 1DNYA 3CCJP 2CWOA 5HGNA 2QA4P 2L6EA 1IMQA 5HV8A 2VLNA 1GPJA 3NTEA 2XZ0D 2KOOA 4COPA 2KOSA 3CC4P 2E1MA 1NJIQ 2M8LA 2N6ZA 3HZQA 3DS0A 4MRTC 1M6NA 2GZJA 2LOLA 1L0HA 3I55P 1EIAA 4XFZA 2PEMA 4QNBA 3CXCO 2FQ0A 2DGYA 2K0XA 4IPYA 2M8PA 2KORA 2N5IA 3G26A 2DNWA 1VQ9P 2JYLA 2FVEA 2KGEA 1YI2P 2FACA 4H2XC 2KOPA 3B4QA 1K30A 2VLPA 2LIWA 2MY5A 3LRYA 3EJBA 2AFDA 2VSQA 2MVUA 3DS2A 1BAJA 1VQ8P 4U0AA 2GZFA 4PH0A 2Z46A 1KC8Q 2ONTA 4NEOA 2K94A 1M6EX 3CCEP 2LMLA 2KG9A 2PEKA 2ERHA 4BPHA 1KD1Q 2M8NA 3G4SP 2XZ1C 2PNGA 3RG2A 3OW2O 4U0DA 1QVFO 2LF4A 2PEJA 1DV5A 2L0QA 2LPKA 1UNKA 1VQNP 1YHQP 1K73Q 2JYGA 1MZ8A 1YIJP 2KODA 1RNIA 5CZDB 3CCRP 3EJDA 2AFEA
chains in the Genus database with same CATH topology
2M5RA 3CE7A 5KP8B 1HY8A 2CG5B 2N5HA 2N98A 3NY7B 2L22A 2JU1A 2EHTA 2MR7A 2N6ZA 2KG6A 4MRTC 1AF8A 2KR5A 2L9FA 1KLPA 4PXHB 2L4BA 2FVFA 2AVAA 2MD9A 1VKUA 2KG8A 2K92A 2LOLA 1L0HA 3GZLA 2GDWA 2EHSA 2FQ2A 2KGCA 2LKIA 2KWLA 2MF4A 2LTEA 2FHSC 2MR8A 2FQ0A 2KOQA 2N50A 3EJEA 2K0XA 3LMOA 2KORA 1ACPA 2N5IA 4PWVB 5EJDA 2LIUA 1X3OA 2DNWA 1NQ4A 2CGQA 2JGPA 2AF8A 2FVEA 2KGEA 2FADA 2FACA 4H2XC 4IZ6A 2KOPA 1F80D 2N6YA 4H2WC 2X2BA 2LIWA 2MY5A 1OR5A 2GDYA 2CQ8A 2QNWA 4H2YC 2MVVA 3EJBA 2AFDA 2FVAA 4BPFA 2GDXA 2VSQA 2MVUA 4BPGA 5HVCA 5KP6B 2FAEA 2KW2A 4DG9A 2CNRA 2KGDA 3GZMA 4HKGA 2ROQA 4NEOA 2FQ1A 2K94A 2LL8A 2KGAA 2JU2A 2LMLA 2KG9A 1HQBA 4BPHA 2K93A 2JQ4A 1DNYA 2XZ1C 2PNGA 3RG2A 4CA3A 1DV5A 2L0QA 2LPKA 2K2QA 5KP7B 5HV8A 1T8KA 5CZDB 2XZ0D 2KOOA 2K0YA 3EJDA 1L0IA 2AFEA 2KOSA 4R0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5R A;  3CE7 A;  5KP8 B;  1HY8 A;  2CG5 B;  2N5H A;  2N98 A;  3NY7 B;  2L22 A;  2JU1 A;  2EHT A;  2MR7 A;  2N6Z A;  2KG6 A;  4MRT C;  1AF8 A;  2KR5 A;  2L9F A;  1KLP A;  4PXH B;  2L4B A;  2FVF A;  2AVA A;  2MD9 A;  1VKU A;  2KG8 A;  2K92 A;  2LOL A;  1L0H A;  3GZL A;  2GDW A;  2EHS A;  2FQ2 A;  2KGC A;  2LKI A;  2KWL A;  2MF4 A;  2LTE A;  2FHS C;  2MR8 A;  2FQ0 A;  2KOQ A;  2N50 A;  3EJE A;  2K0X A;  3LMO A;  2KOR A;  1ACP A;  2N5I A;  4PWV B;  5EJD A;  2LIU A;  1X3O A;  2DNW A;  1NQ4 A;  2CGQ A;  2JGP A;  2AF8 A;  2FVE A;  2KGE A;  2FAD A;  2FAC A;  4H2X C;  4IZ6 A;  2KOP A;  1F80 D;  2N6Y A;  4H2W C;  2X2B A;  2LIW A;  2MY5 A;  1OR5 A;  2GDY A;  2CQ8 A;  2QNW A;  4H2Y C;  2MVV A;  3EJB A;  2AFD A;  2FVA A;  4BPF A;  2GDX A;  2VSQ A;  2MVU A;  4BPG A;  5HVC A;  5KP6 B;  2FAE A;  2KW2 A;  4DG9 A;  2CNR A;  2KGD A;  3GZM A;  4HKG A;  2ROQ A;  4NEO A;  2FQ1 A;  2K94 A;  2LL8 A;  2KGA A;  2JU2 A;  2LML A;  2KG9 A;  1HQB A;  4BPH A;  2K93 A;  2JQ4 A;  1DNY A;  2XZ1 C;  2PNG A;  3RG2 A;  4CA3 A;  1DV5 A;  2L0Q A;  2LPK A;  2K2Q A;  5KP7 B;  5HV8 A;  1T8K A;  5CZD B;  2XZ0 D;  2KOO A;  2K0Y A;  3EJD A;  1L0I A;  2AFE A;  2KOS A;  4R0M A; 
#chains in the Genus database with same CATH topology
 3DS5 A;  3G71 P;  2M5R A;  4GR2 A;  5JPA A;  2XXM A;  3P05 A;  3NY7 B;  4GR6 A;  4U0C A;  1AYI A;  2KR5 A;  2L9F A;  1KLP A;  5I4T G;  2PEN A;  4WYM A;  2FVF A;  2AVA A;  5HGO A;  7CEI A;  1QRJ A;  3GZL A;  1FR2 A;  2EHS A;  1YJW P;  2GZI A;  2KWL A;  2MF4 A;  3G28 A;  1GXH A;  2XV6 A;  4U0E A;  1VQM P;  2KOQ A;  1YJN P;  2EG5 A;  2EFJ A;  3LMO A;  1M90 Q;  1ACP A;  4PWV B;  1VQ5 P;  3HYB A;  1X3O A;  1NQ4 A;  2JGP A;  2AF8 A;  4XRO A;  4XFY A;  2VLO A;  3I56 P;  2FAD A;  2PEO A;  5BS1 A;  1D1D A;  2PY8 A;  4U0B A;  1F80 D;  3G6E P;  1OR5 A;  2GDY A;  3G29 A;  3CCL P;  4H2Y C;  1YJ9 P;  3CCS P;  2KW2 A;  1M1K Q;  4DG9 A;  3GZM A;  1RO0 A;  1VQL P;  1ZMB A;  1RO2 A;  3G21 A;  2KGA A;  2QEX P;  3CME P;  2JO0 A;  3DPH A;  2BUO A;  3M1M A;  1YIT P;  3DS3 A;  4CA3 A;  1QVG O;  2VLQ A;  1A8O A;  1E0H A;  1AUM A;  3G1I A;  2JBG A;  1T8K A;  3GJN A;  2K0Y A;  1Q86 Q;  4QKO A;  4R0M A;  3DS4 A;  1IUQ A;  2NO8 A;  5KP8 B;  3CC2 P;  2XT1 A;  1HY8 A;  1VQK P;  2CG5 B;  2N5H A;  1Z6M A;  2JU1 A;  2EHT A;  2MR7 A;  2KG6 A;  3CCQ P;  3CC7 P;  5F2N A;  4PH1 A;  1VKU A;  3G0V A;  1IMP A;  4U0F A;  2K92 A;  1EMV A;  2GDW A;  2FQ2 A;  2LKI A;  1ZNV A;  1Q81 Q;  1UJZ A;  2JAZ A;  4F37 A;  2MR8 A;  1KQS O;  3CMA P;  5DCK A;  1Q82 Q;  1S72 P;  1M74 A;  1W2B O;  2LIU A;  4XRQ A;  3H4E A;  1VQO P;  2N6Y A;  3U43 A;  1BXI A;  2QNW A;  2MVV A;  3DS1 A;  5HVC A;  2FAE A;  5F2K A;  4HKG A;  4M0I A;  3GKL C;  2JB0 A;  2JU2 A;  2K93 A;  3CCV P;  1CEI A;  5EW5 E;  2GZE A;  1A43 A;  2K2Q A;  5KP7 B;  2GZG A;  3DTJ A;  5HGL A;  1L0I A;  1E6J P;  3CE7 A;  2BHV A;  1K8A Q;  2N98 A;  2L22 A;  4COC A;  4UHP B;  1EOQ A;  1AF8 A;  1K9M Q;  4PXH B;  2GYK A;  2L4B A;  2MD9 A;  3H47 A;  1VQP P;  2KG8 A;  3G1G A;  2OAR A;  3B5I A;  1Q7Y Q;  4XFX A;  2KGC A;  1VQ6 P;  2LTE A;  3VRL C;  2FHS C;  2K5X A;  1VHN A;  1JJ2 O;  1GXG A;  2N50 A;  1N8R Q;  3H0D A;  3E2D A;  3EJE A;  3Q20 A;  2Z45 A;  3CCU P;  3WBH A;  5EJD A;  1VQ7 P;  3CCM P;  5F2O A;  3CD6 P;  2CGQ A;  3MGE A;  2WPT A;  2EIA A;  5BS2 A;  4IZ6 A;  4H2W C;  2X2B A;  1VQ4 P;  2CQ8 A;  2FVA A;  2PEQ A;  4BPF A;  2P9X A;  2GDX A;  4BPG A;  2OTJ P;  5KP6 B;  2Z44 A;  2CNR A;  2KGD A;  3RG6 C;  2ROQ A;  5HGM A;  3CPW O;  2PEI A;  2K0D X;  2FQ1 A;  2LL8 A;  1HQB A;  2OTL P;  2JQ4 A;  1DNY A;  3CCJ P;  2CWO A;  5HGN A;  2QA4 P;  2L6E A;  1IMQ A;  5HV8 A;  2VLN A;  1GPJ A;  3NTE A;  2XZ0 D;  2KOO A;  4COP A;  2KOS A;  3CC4 P;  2E1M A;  1NJI Q;  2M8L A;  2N6Z A;  3HZQ A;  3DS0 A;  4MRT C;  1M6N A;  2GZJ A;  2LOL A;  1L0H A;  3I55 P;  1EIA A;  4XFZ A;  2PEM A;  4QNB A;  3CXC O;  2FQ0 A;  2DGY A;  2K0X A;  4IPY A;  2M8P A;  2KOR A;  2N5I A;  3G26 A;  2DNW A;  1VQ9 P;  2JYL A;  2FVE A;  2KGE A;  1YI2 P;  2FAC A;  4H2X C;  2KOP A;  3B4Q A;  1K30 A;  2VLP A;  2LIW A;  2MY5 A;  3LRY A;  3EJB A;  2AFD A;  2VSQ A;  2MVU A;  3DS2 A;  1BAJ A;  1VQ8 P;  4U0A A;  2GZF A;  4PH0 A;  2Z46 A;  1KC8 Q;  2ONT A;  4NEO A;  2K94 A;  1M6E X;  3CCE P;  2LML A;  2KG9 A;  2PEK A;  2ERH A;  4BPH A;  1KD1 Q;  2M8N A;  3G4S P;  2XZ1 C;  2PNG A;  3RG2 A;  3OW2 O;  4U0D A;  1QVF O;  2LF4 A;  2PEJ A;  1DV5 A;  2L0Q A;  2LPK A;  1UNK A;  1VQN P;  1YHQ P;  1K73 Q;  2JYG A;  1MZ8 A;  1YIJ P;  2KOD A;  1RNI A;  5CZD B;  3CCR P;  3EJD A;  2AFE A; 
#chains in the Genus database with same CATH homology
 2M5R A;  3CE7 A;  5KP8 B;  1HY8 A;  2CG5 B;  2N5H A;  2N98 A;  3NY7 B;  2L22 A;  2JU1 A;  2EHT A;  2MR7 A;  2N6Z A;  2KG6 A;  4MRT C;  1AF8 A;  2KR5 A;  2L9F A;  1KLP A;  4PXH B;  2L4B A;  2FVF A;  2AVA A;  2MD9 A;  1VKU A;  2KG8 A;  2K92 A;  2LOL A;  1L0H A;  3GZL A;  2GDW A;  2EHS A;  2FQ2 A;  2KGC A;  2LKI A;  2KWL A;  2MF4 A;  2LTE A;  2FHS C;  2MR8 A;  2FQ0 A;  2KOQ A;  2N50 A;  3EJE A;  2K0X A;  3LMO A;  2KOR A;  1ACP A;  2N5I A;  4PWV B;  5EJD A;  2LIU A;  1X3O A;  2DNW A;  1NQ4 A;  2CGQ A;  2JGP A;  2AF8 A;  2FVE A;  2KGE A;  2FAD A;  2FAC A;  4H2X C;  4IZ6 A;  2KOP A;  1F80 D;  2N6Y A;  4H2W C;  2X2B A;  2LIW A;  2MY5 A;  1OR5 A;  2GDY A;  2CQ8 A;  2QNW A;  4H2Y C;  2MVV A;  3EJB A;  2AFD A;  2FVA A;  4BPF A;  2GDX A;  2VSQ A;  2MVU A;  4BPG A;  5HVC A;  5KP6 B;  2FAE A;  2KW2 A;  4DG9 A;  2CNR A;  2KGD A;  3GZM A;  4HKG A;  2ROQ A;  4NEO A;  2FQ1 A;  2K94 A;  2LL8 A;  2KGA A;  2JU2 A;  2LML A;  2KG9 A;  1HQB A;  4BPH A;  2K93 A;  2JQ4 A;  1DNY A;  2XZ1 C;  2PNG A;  3RG2 A;  4CA3 A;  1DV5 A;  2L0Q A;  2LPK A;  2K2Q A;  5KP7 B;  5HV8 A;  1T8K A;  5CZD B;  2XZ0 D;  2KOO A;  2K0Y A;  3EJD A;  1L0I A;  2AFE A;  2KOS A;  4R0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...