2KWLA

Solution structure of acyl carrier protein from borrelia burgdorferi
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
GPGSMDNDEIFSKVRSIISEQLDKKEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENEANEFETVGDVVNFIKKRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Acyl carrier protein
publication title NMR structure of an acyl-carrier protein from Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kwlA00
2JQ4A 1L0IA 2FQ2A 2FVFA 2FHSC 2CQ8A 2KR5A 2MVVA 3EJBA 2KG8A 4IZ6A 2KGEA 2EHSA 1DV5A 2MR7A 2L0QA 2X2BA 4DG9A 2FVEA 2MD9A 2KOQA 3RG2A 2KORA 2GDXA 2FAEA 2VSQA 2L9FA 3CE7A 3GZMA 5KP8B 2KWLA 2KOSA 2L4BA 2KG6A 1AF8A 4BPGA 1X3OA 2N5HA 3EJEA 1ACPA 2KGDA 2JU2A 1DNYA 2DNWA 2KG9A 4H2YC 4HKGA 1F80D 3NY7B 5CZDB 2GDYA 4BPHA 4PXHB 2N6ZA 2K94A 4PWVB 2K0XA 2M5RA 2FQ1A 1T8KA 2AVAA 2AF8A 2LTEA 1NQ4A 2LOLA 4H2XC 2CNRA 2CG5B 2K2QA 2N5IA 2XZ1C 2FVAA 2GDWA 1L0HA 2N6YA 3GZLA 5KP7B 1HQBA 2QNWA 2EHTA 2KOOA 2KW2A 4CA3A 2K0YA 2LIWA 2FQ0A 2PNGA 5HV8A 2LPKA 2FADA 2XZ0D 2JU1A 1OR5A 2JGPA 2MF4A 5KP6B 4MRTC 2AFEA 1VKUA 2AFDA 2KOPA 1KLPA 1HY8A 5EJDA 2K92A 4R0MA 2LKIA 3EJDA 2N98A 3LMOA 2N50A 2CGQA 2MY5A 5HVCA 4BPFA 4H2WC 2MR8A 2KGCA 2FACA 2KGAA 2MVUA 2LIUA 2LMLA 2LL8A 2ROQA 4NEOA 2K93A 2L22A
chains in the Genus database with same CATH superfamily
1Z6MA 2CQ8A 3EJBA 4COPA 3CD6P 3P05A 4DG9A 2FVEA 3G4SP 1Q81Q 2JYLA 1K30A 1M1KQ 2FAEA 3GZMA 1KC8Q 2KWLA 1VQ4P 1RO0A 2GZEA 2M8LA 5HGMA 2XXMA 2N5HA 3CPWO 2GZFA 3RG6C 2KGDA 3G71P 1VQ9P 2JU2A 7CEIA 1A43A 1VHNA 4U0FA 1F80D 3NY7B 3CC4P 1VQ5P 1VQNP 2FQ1A 3OW2O 1IMQA 1T8KA 2VLQA 2LTEA 2LOLA 1VQLP 2BUOA 2N5IA 4PH1A 4XFXA 2FVAA 1D1DA 2M8PA 2GZJA 3CCSP 1HQBA 2QNWA 2ONTA 3DTJA 2KOOA 2KW2A 3WBHA 1QRJA 3B5IA 2FQ0A 2K5XA 3G6EP 1YJWP 2MF4A 5KP6B 2Z45A 3DS5A 4IPYA 2GYKA 3CCRP 2KOPA 1KLPA 4GR6A 5DCKA 3CXCO 2N98A 1NJIQ 2JYGA 2N50A 2OARA 4XRQA 5HVCA 3G21A 4H2WC 2KGCA 2VLPA 5I4TG 2MVUA 2LF4A 2LIUA 4XFYA 4QNBA 4XROA 2QA4P 4NEOA 2JO0A 1L0IA 1UJZA 2EG5A 5HGNA 2FHSC 1YI2P 1N8RQ 2L0QA 2X2BA 2GZIA 2E1MA 2GDXA 1K9MQ 2L9FA 3DS4A 2KOSA 3GJNA 3H0DA 1VQ7P 2OTJP 4BPGA 3EJEA 1ACPA 2PEKA 3H47A 1W2BO 3LRYA 2KG9A 3HZQA 4H2YC 1YJ9P 4HKGA 2KODA 4U0EA 5CZDB 2GDYA 1VQPP 4PH0A 1AUMA 1VQ6P 2CNRA 2P9XA 2CG5B 2PY8A 2XZ1C 1L0HA 5BS1A 2N6YA 5F2KA 1VQMP 3CC7P 3CC2P 2PEJA 3I56P 2EHTA 1VQOP 3G0VA 2PNGA 2LPKA 2FADA 1M90Q 2CWOA 3U43A 2Z46A 4MRTC 1VKUA 3NTEA 1Q82Q 2AFDA 4M0IA 1K8AQ 3EJDA 3DS2A 3G1IA 2ERHA 4F37A 4BPFA 1AYIA 3CCUP 2JBGA 2FACA 2LMLA 3CCJP 2PEQA 2K93A 2JQ4A 2QEXP 2KR5A 2MVVA 4IZ6A 1GXHA 1BAJA 1EMVA 1K73Q 2MD9A 2KOQA 5HGLA 2KORA 1BXIA 2VSQA 5KP8B 2L4BA 2KG6A 2DGYA 1CEIA 1DNYA 2DNWA 1EOQA 1GXGA 3CCQP 1ZMBA 5EW5E 4BPHA 2N6ZA 2K94A 4PWVB 3CMEP 2M5RA 4XFZA 2AVAA 1NQ4A 2K0DX 4QKOA 2JAZA 1M6EX 1GPJA 3GZLA 3DS3A 5KP7B 1EIAA 4U0CA 4CA3A 1Q86Q 4U0BA 1M6NA 1E6JP 1YJNP 2K0YA 3G29A 1A8OA 2LIWA 3B4QA 5HV8A 4COCA 3MGEA 1IMPA 2XZ0D 2JU1A 2BHVA 2JGPA 3H4EA 3Q20A 1YITP 2JB0A 2AFEA 5EJDA 2OTLP 4R0MA 2VLOA 3CCMP 2LKIA 3G26A 3LMOA 2Z44A 1YHQP 2MY5A 2KGAA 5F2NA 2LL8A 1M74A 2ROQA 2GZGA 3GKLC 2L22A 2FQ2A 2FVFA 2KG8A 3DS1A 2KGEA 2EHSA 1DV5A 2MR7A 1ZNVA 4U0DA 1S72P 1JJ2O 3DPHA 3RG2A 2VLNA 3CE7A 1RNIA 5F2OA 1FR2A 1AF8A 3CCEP 1X3OA 3E2DA 2PEMA 1Q7YQ 1IUQA 2PEIA 3HYBA 2XV6A 3VRLC 2EIAA 1UNKA 3G28A 4PXHB 2WPTA 2K0XA 5JPAA 3CMAP 3CCVP 2AF8A 4H2XC 1YIJP 5HGOA 1QVFO 2K2QA 3CCLP 2NO8A 1KQSO 2GDWA 1KD1Q 3DS0A 4U0AA 3M1MA 1E0HA 1VQ8P 1MZ8A 2EFJA 1OR5A 5BS2A 2XT1A 4WYMA 3I55P 1HY8A 2M8NA 2K92A 2L6EA 2PENA 1QVGO 2CGQA 4UHPB 3G1GA 1RO2A 2MR8A 1VQKP 2PEOA 4GR2A
chains in the Genus database with same CATH topology
2JQ4A 1L0IA 2FQ2A 2FVFA 2FHSC 2CQ8A 2KR5A 2MVVA 3EJBA 2KG8A 4IZ6A 2KGEA 2EHSA 1DV5A 2MR7A 2L0QA 2X2BA 4DG9A 2FVEA 2MD9A 2KOQA 3RG2A 2KORA 2GDXA 2FAEA 2VSQA 2L9FA 3CE7A 3GZMA 5KP8B 2KWLA 2KOSA 2L4BA 2KG6A 1AF8A 4BPGA 1X3OA 2N5HA 3EJEA 1ACPA 2KGDA 2JU2A 1DNYA 2DNWA 2KG9A 4H2YC 4HKGA 1F80D 3NY7B 5CZDB 2GDYA 4BPHA 4PXHB 2N6ZA 2K94A 4PWVB 2K0XA 2M5RA 2FQ1A 1T8KA 2AVAA 2AF8A 2LTEA 1NQ4A 2LOLA 4H2XC 2CNRA 2CG5B 2K2QA 2N5IA 2XZ1C 2FVAA 2GDWA 1L0HA 2N6YA 3GZLA 5KP7B 1HQBA 2QNWA 2EHTA 2KOOA 2KW2A 4CA3A 2K0YA 2LIWA 2FQ0A 2PNGA 5HV8A 2LPKA 2FADA 2XZ0D 2JU1A 1OR5A 2JGPA 2MF4A 5KP6B 4MRTC 2AFEA 1VKUA 2AFDA 2KOPA 1KLPA 1HY8A 5EJDA 2K92A 4R0MA 2LKIA 3EJDA 2N98A 3LMOA 2N50A 2CGQA 2MY5A 5HVCA 4BPFA 4H2WC 2MR8A 2KGCA 2FACA 2KGAA 2MVUA 2LIUA 2LMLA 2LL8A 2ROQA 4NEOA 2K93A 2L22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQ4 A;  1L0I A;  2FQ2 A;  2FVF A;  2FHS C;  2CQ8 A;  2KR5 A;  2MVV A;  3EJB A;  2KG8 A;  4IZ6 A;  2KGE A;  2EHS A;  1DV5 A;  2MR7 A;  2L0Q A;  2X2B A;  4DG9 A;  2FVE A;  2MD9 A;  2KOQ A;  3RG2 A;  2KOR A;  2GDX A;  2FAE A;  2VSQ A;  2L9F A;  3CE7 A;  3GZM A;  5KP8 B;  2KWL A;  2KOS A;  2L4B A;  2KG6 A;  1AF8 A;  4BPG A;  1X3O A;  2N5H A;  3EJE A;  1ACP A;  2KGD A;  2JU2 A;  1DNY A;  2DNW A;  2KG9 A;  4H2Y C;  4HKG A;  1F80 D;  3NY7 B;  5CZD B;  2GDY A;  4BPH A;  4PXH B;  2N6Z A;  2K94 A;  4PWV B;  2K0X A;  2M5R A;  2FQ1 A;  1T8K A;  2AVA A;  2AF8 A;  2LTE A;  1NQ4 A;  2LOL A;  4H2X C;  2CNR A;  2CG5 B;  2K2Q A;  2N5I A;  2XZ1 C;  2FVA A;  2GDW A;  1L0H A;  2N6Y A;  3GZL A;  5KP7 B;  1HQB A;  2QNW A;  2EHT A;  2KOO A;  2KW2 A;  4CA3 A;  2K0Y A;  2LIW A;  2FQ0 A;  2PNG A;  5HV8 A;  2LPK A;  2FAD A;  2XZ0 D;  2JU1 A;  1OR5 A;  2JGP A;  2MF4 A;  5KP6 B;  4MRT C;  2AFE A;  1VKU A;  2AFD A;  2KOP A;  1KLP A;  1HY8 A;  5EJD A;  2K92 A;  4R0M A;  2LKI A;  3EJD A;  2N98 A;  3LMO A;  2N50 A;  2CGQ A;  2MY5 A;  5HVC A;  4BPF A;  4H2W C;  2MR8 A;  2KGC A;  2FAC A;  2KGA A;  2MVU A;  2LIU A;  2LML A;  2LL8 A;  2ROQ A;  4NEO A;  2K93 A;  2L22 A; 
#chains in the Genus database with same CATH topology
 1Z6M A;  2CQ8 A;  3EJB A;  4COP A;  3CD6 P;  3P05 A;  4DG9 A;  2FVE A;  3G4S P;  1Q81 Q;  2JYL A;  1K30 A;  1M1K Q;  2FAE A;  3GZM A;  1KC8 Q;  2KWL A;  1VQ4 P;  1RO0 A;  2GZE A;  2M8L A;  5HGM A;  2XXM A;  2N5H A;  3CPW O;  2GZF A;  3RG6 C;  2KGD A;  3G71 P;  1VQ9 P;  2JU2 A;  7CEI A;  1A43 A;  1VHN A;  4U0F A;  1F80 D;  3NY7 B;  3CC4 P;  1VQ5 P;  1VQN P;  2FQ1 A;  3OW2 O;  1IMQ A;  1T8K A;  2VLQ A;  2LTE A;  2LOL A;  1VQL P;  2BUO A;  2N5I A;  4PH1 A;  4XFX A;  2FVA A;  1D1D A;  2M8P A;  2GZJ A;  3CCS P;  1HQB A;  2QNW A;  2ONT A;  3DTJ A;  2KOO A;  2KW2 A;  3WBH A;  1QRJ A;  3B5I A;  2FQ0 A;  2K5X A;  3G6E P;  1YJW P;  2MF4 A;  5KP6 B;  2Z45 A;  3DS5 A;  4IPY A;  2GYK A;  3CCR P;  2KOP A;  1KLP A;  4GR6 A;  5DCK A;  3CXC O;  2N98 A;  1NJI Q;  2JYG A;  2N50 A;  2OAR A;  4XRQ A;  5HVC A;  3G21 A;  4H2W C;  2KGC A;  2VLP A;  5I4T G;  2MVU A;  2LF4 A;  2LIU A;  4XFY A;  4QNB A;  4XRO A;  2QA4 P;  4NEO A;  2JO0 A;  1L0I A;  1UJZ A;  2EG5 A;  5HGN A;  2FHS C;  1YI2 P;  1N8R Q;  2L0Q A;  2X2B A;  2GZI A;  2E1M A;  2GDX A;  1K9M Q;  2L9F A;  3DS4 A;  2KOS A;  3GJN A;  3H0D A;  1VQ7 P;  2OTJ P;  4BPG A;  3EJE A;  1ACP A;  2PEK A;  3H47 A;  1W2B O;  3LRY A;  2KG9 A;  3HZQ A;  4H2Y C;  1YJ9 P;  4HKG A;  2KOD A;  4U0E A;  5CZD B;  2GDY A;  1VQP P;  4PH0 A;  1AUM A;  1VQ6 P;  2CNR A;  2P9X A;  2CG5 B;  2PY8 A;  2XZ1 C;  1L0H A;  5BS1 A;  2N6Y A;  5F2K A;  1VQM P;  3CC7 P;  3CC2 P;  2PEJ A;  3I56 P;  2EHT A;  1VQO P;  3G0V A;  2PNG A;  2LPK A;  2FAD A;  1M90 Q;  2CWO A;  3U43 A;  2Z46 A;  4MRT C;  1VKU A;  3NTE A;  1Q82 Q;  2AFD A;  4M0I A;  1K8A Q;  3EJD A;  3DS2 A;  3G1I A;  2ERH A;  4F37 A;  4BPF A;  1AYI A;  3CCU P;  2JBG A;  2FAC A;  2LML A;  3CCJ P;  2PEQ A;  2K93 A;  2JQ4 A;  2QEX P;  2KR5 A;  2MVV A;  4IZ6 A;  1GXH A;  1BAJ A;  1EMV A;  1K73 Q;  2MD9 A;  2KOQ A;  5HGL A;  2KOR A;  1BXI A;  2VSQ A;  5KP8 B;  2L4B A;  2KG6 A;  2DGY A;  1CEI A;  1DNY A;  2DNW A;  1EOQ A;  1GXG A;  3CCQ P;  1ZMB A;  5EW5 E;  4BPH A;  2N6Z A;  2K94 A;  4PWV B;  3CME P;  2M5R A;  4XFZ A;  2AVA A;  1NQ4 A;  2K0D X;  4QKO A;  2JAZ A;  1M6E X;  1GPJ A;  3GZL A;  3DS3 A;  5KP7 B;  1EIA A;  4U0C A;  4CA3 A;  1Q86 Q;  4U0B A;  1M6N A;  1E6J P;  1YJN P;  2K0Y A;  3G29 A;  1A8O A;  2LIW A;  3B4Q A;  5HV8 A;  4COC A;  3MGE A;  1IMP A;  2XZ0 D;  2JU1 A;  2BHV A;  2JGP A;  3H4E A;  3Q20 A;  1YIT P;  2JB0 A;  2AFE A;  5EJD A;  2OTL P;  4R0M A;  2VLO A;  3CCM P;  2LKI A;  3G26 A;  3LMO A;  2Z44 A;  1YHQ P;  2MY5 A;  2KGA A;  5F2N A;  2LL8 A;  1M74 A;  2ROQ A;  2GZG A;  3GKL C;  2L22 A;  2FQ2 A;  2FVF A;  2KG8 A;  3DS1 A;  2KGE A;  2EHS A;  1DV5 A;  2MR7 A;  1ZNV A;  4U0D A;  1S72 P;  1JJ2 O;  3DPH A;  3RG2 A;  2VLN A;  3CE7 A;  1RNI A;  5F2O A;  1FR2 A;  1AF8 A;  3CCE P;  1X3O A;  3E2D A;  2PEM A;  1Q7Y Q;  1IUQ A;  2PEI A;  3HYB A;  2XV6 A;  3VRL C;  2EIA A;  1UNK A;  3G28 A;  4PXH B;  2WPT A;  2K0X A;  5JPA A;  3CMA P;  3CCV P;  2AF8 A;  4H2X C;  1YIJ P;  5HGO A;  1QVF O;  2K2Q A;  3CCL P;  2NO8 A;  1KQS O;  2GDW A;  1KD1 Q;  3DS0 A;  4U0A A;  3M1M A;  1E0H A;  1VQ8 P;  1MZ8 A;  2EFJ A;  1OR5 A;  5BS2 A;  2XT1 A;  4WYM A;  3I55 P;  1HY8 A;  2M8N A;  2K92 A;  2L6E A;  2PEN A;  1QVG O;  2CGQ A;  4UHP B;  3G1G A;  1RO2 A;  2MR8 A;  1VQK P;  2PEO A;  4GR2 A; 
#chains in the Genus database with same CATH homology
 2JQ4 A;  1L0I A;  2FQ2 A;  2FVF A;  2FHS C;  2CQ8 A;  2KR5 A;  2MVV A;  3EJB A;  2KG8 A;  4IZ6 A;  2KGE A;  2EHS A;  1DV5 A;  2MR7 A;  2L0Q A;  2X2B A;  4DG9 A;  2FVE A;  2MD9 A;  2KOQ A;  3RG2 A;  2KOR A;  2GDX A;  2FAE A;  2VSQ A;  2L9F A;  3CE7 A;  3GZM A;  5KP8 B;  2KWL A;  2KOS A;  2L4B A;  2KG6 A;  1AF8 A;  4BPG A;  1X3O A;  2N5H A;  3EJE A;  1ACP A;  2KGD A;  2JU2 A;  1DNY A;  2DNW A;  2KG9 A;  4H2Y C;  4HKG A;  1F80 D;  3NY7 B;  5CZD B;  2GDY A;  4BPH A;  4PXH B;  2N6Z A;  2K94 A;  4PWV B;  2K0X A;  2M5R A;  2FQ1 A;  1T8K A;  2AVA A;  2AF8 A;  2LTE A;  1NQ4 A;  2LOL A;  4H2X C;  2CNR A;  2CG5 B;  2K2Q A;  2N5I A;  2XZ1 C;  2FVA A;  2GDW A;  1L0H A;  2N6Y A;  3GZL A;  5KP7 B;  1HQB A;  2QNW A;  2EHT A;  2KOO A;  2KW2 A;  4CA3 A;  2K0Y A;  2LIW A;  2FQ0 A;  2PNG A;  5HV8 A;  2LPK A;  2FAD A;  2XZ0 D;  2JU1 A;  1OR5 A;  2JGP A;  2MF4 A;  5KP6 B;  4MRT C;  2AFE A;  1VKU A;  2AFD A;  2KOP A;  1KLP A;  1HY8 A;  5EJD A;  2K92 A;  4R0M A;  2LKI A;  3EJD A;  2N98 A;  3LMO A;  2N50 A;  2CGQ A;  2MY5 A;  5HVC A;  4BPF A;  4H2W C;  2MR8 A;  2KGC A;  2FAC A;  2KGA A;  2MVU A;  2LIU A;  2LML A;  2LL8 A;  2ROQ A;  4NEO A;  2K93 A;  2L22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...