2KWLA

Solution structure of acyl carrier protein from borrelia burgdorferi
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
GPGSMDNDEIFSKVRSIISEQLDKKEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENEANEFETVGDVVNFIKKRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title NMR structure of an acyl-carrier protein from Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Lipid binding protein
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kwlA00
4H2XC 2FADA 2N6ZA 3GZLA 2KG9A 4HKGA 2AVAA 3EJDA 4BPHA 2AFDA 2N98A 2KGAA 2LL8A 2VSQA 1VKUA 2FVAA 2CQ8A 1L0IA 5CZDB 2MD9A 2KOQA 2KOSA 2GDWA 2KOOA 4PXHB 4DG9A 1ACPA 5KP6B 4IZ6A 2KWLA 2N50A 2N6YA 2M5RA 2KGCA 1F80D 2LIWA 2KW2A 2XZ0D 3GZMA 2N5HA 2L0QA 5HVCA 2N5IA 2LMLA 3LMOA 1HQBA 2CGQA 3CE7A 2EHSA 2FACA 3RG2A 2FQ1A 2ROQA 2FQ2A 2KOPA 2JQ4A 2MF4A 2QNWA 2KGDA 3EJBA 2KG8A 4NEOA 1OR5A 4CA3A 2LTEA 1DNYA 2FAEA 2MVVA 2LOLA 2L4BA 2DNWA 2FVFA 2K0YA 2AFEA 4H2WC 2XZ1C 3EJEA 5KP7B 2JGPA 2K93A 2KGEA 1L0HA 2FQ0A 2CNRA 1NQ4A 2LPKA 1AF8A 2LKIA 2CG5B 2MR8A 2K92A 4BPFA 4MRTC 5KP8B 4PWVB 1HY8A 4H2YC 1T8KA 2JU2A 2KR5A 2JU1A 2K0XA 2AF8A 2LIUA 2L9FA 2L22A 2X2BA 5EJDA 1KLPA 2PNGA 2MR7A 2MVUA 2GDYA 2GDXA 4BPGA 1DV5A 2K2QA 2MY5A 4R0MA 2FHSC 1X3OA 2KORA 2K94A 3NY7B 2EHTA 2FVEA 5HV8A 2KG6A
chains in the Genus database with same CATH superfamily
3G21A 2KG9A 1QVGO 2AVAA 2XV6A 3G28A 3CD6P 2KODA 1S72P 2PEOA 2GZGA 2M8PA 3E2DA 1M6NA 2CQ8A 2M8NA 2KOQA 1NJIQ 3CCMP 1QRJA 3B5IA 1VQNP 1ACPA 4U0EA 3G29A 1YI2P 3DS1A 3H0DA 2XZ0D 2L0QA 1YHQP 3G6EP 2N5IA 2CWOA 1K73Q 3I55P 1W2BO 1JJ2O 1VQ6P 1E6JP 4QNBA 1VQKP 2OTLP 4GR2A 4QKOA 3MGEA 5HGLA 1OR5A 1GPJA 1IUQA 3G26A 1Q86Q 2FAEA 2VLNA 2MVVA 2LOLA 5BS1A 2L4BA 2BHVA 2K0YA 4H2WC 2K93A 2KGEA 1L0HA 5EW5E 2VLPA 2CNRA 2Z44A 4U0FA 3CCSP 1D1DA 1AF8A 5HGOA 2MR8A 4MRTC 1RNIA 4PWVB 3CMAP 3NTEA 2BUOA 1M6EX 2WPTA 1KLPA 2PNGA 1GXHA 2MR7A 1Q82Q 2GDXA 4BPGA 4COPA 5I4TG 2P9XA 3G0VA 3DPHA 2PEJA 1X3OA 3H47A 2NO8A 2FADA 3CCLP 3GZLA 4HKGA 3GKLC 2L6EA 3M1MA 4U0BA 4BPHA 2KGAA 1YJ9P 4XFYA 1L0IA 5JPAA 2ONTA 1BXIA 2GDWA 1IMQA 4PXHB 1VQOP 2XXMA 1A8OA 1VQMP 2JYLA 1RO0A 2KGCA 2QEXP 3G1IA 1F80D 1VQ5P 5F2NA 3GZMA 3DS5A 4XFZA 1YITP 1HQBA 2CGQA 1A43A 4IPYA 5BS2A 2ROQA 2KOPA 1EMVA 1FR2A 2EFJA 2MF4A 1M74A 4NEOA 3U43A 3G1GA 4CA3A 2LTEA 2PEKA 1N8RQ 1K9MQ 3G71P 2DNWA 5HGNA 5KP7B 3CCQP 2PY8A 2FQ0A 4U0DA 1VQLP 2LKIA 2E1MA 2K92A 4BPFA 2JYGA 4H2YC 1T8KA 1Z6MA 1YJNP 2AF8A 3CC4P 2L9FA 2L22A 2X2BA 5EJDA 3CCRP 2MVUA 1RO2A 1GXGA 4U0AA 4GR6A 2GZFA 2GZEA 1DV5A 2MY5A 4R0MA 2FHSC 2KORA 3NY7B 2FVEA 2GZJA 5HGMA 2KG6A 4WYMA 4H2XC 2N6ZA 2PEMA 1KQSO 1KD1Q 1AUMA 3CCUP 2AFDA 1CEIA 2LL8A 3DTJA 2VLOA 2MD9A 1KC8Q 2GYKA 4DG9A 3HYBA 4IZ6A 2N50A 3Q20A 3OW2O 4XFXA 1ZNVA 2LIWA 1E0HA 2PEQA 1VQ9P 2LMLA 3CE7A 3WBHA 2ERHA 2Z45A 2FQ2A 3H4EA 2QNWA 1M1KQ 2KGDA 3B4QA 3I56P 4XROA 2VLQA 5KP8B 1HY8A 1Q81Q 1MZ8A 2JU2A 3CC7P 2KR5A 2DGYA 3VRLC 1AYIA 4M0IA 2GDYA 1K8AQ 1VQ4P 1YJWP 2LF4A 3CMEP 3DS3A 2EG5A 3RG6C 2JB0A 7CEIA 2EHTA 5CZDB 4XRQA 3P05A 2PEIA 3CC2P 1VQ7P 3EJDA 1EOQA 2N98A 1UNKA 2VSQA 1VKUA 4PH0A 2FVAA 4F37A 2KOSA 2KOOA 5F2OA 2K0DX 4COCA 1BAJA 2XT1A 2JO0A 5KP6B 3DS2A 3CCJP 2KWLA 1Q7YQ 2N6YA 2M5RA 4U0CA 3DS4A 2QA4P 3CPWO 1UJZA 2KW2A 3CCEP 2N5HA 5HVCA 3LMOA 4UHPB 2EHSA 2FACA 3RG2A 2FQ1A 3LRYA 2EIAA 2JQ4A 2JBGA 2JAZA 3DS0A 3EJBA 1VQ8P 2KG8A 1IMPA 1DNYA 5F2KA 1QVFO 2PENA 2FVFA 2AFEA 2M8LA 2XZ1C 3EJEA 4PH1A 1ZMBA 2JGPA 1NQ4A 2LPKA 3HZQA 3CXCO 3CCVP 2CG5B 5DCKA 2GZIA 3G4SP 2OTJP 1M90Q 2Z46A 1VQPP 2K5XA 2JU1A 1K30A 2K0XA 1YIJP 2LIUA 1VHNA 2K2QA 3GJNA 2K94A 2OARA 5HV8A 1EIAA
chains in the Genus database with same CATH topology
4H2XC 2FADA 2N6ZA 3GZLA 2KG9A 4HKGA 2AVAA 3EJDA 4BPHA 2AFDA 2N98A 2KGAA 2LL8A 2VSQA 1VKUA 2FVAA 2CQ8A 1L0IA 5CZDB 2MD9A 2KOQA 2KOSA 2GDWA 2KOOA 4PXHB 4DG9A 1ACPA 5KP6B 4IZ6A 2KWLA 2N50A 2N6YA 2M5RA 2KGCA 1F80D 2LIWA 2KW2A 2XZ0D 3GZMA 2N5HA 2L0QA 5HVCA 2N5IA 2LMLA 3LMOA 1HQBA 2CGQA 3CE7A 2EHSA 2FACA 3RG2A 2FQ1A 2ROQA 2FQ2A 2KOPA 2JQ4A 2MF4A 2QNWA 2KGDA 3EJBA 2KG8A 4NEOA 1OR5A 4CA3A 2LTEA 1DNYA 2FAEA 2MVVA 2LOLA 2L4BA 2DNWA 2FVFA 2K0YA 2AFEA 4H2WC 2XZ1C 3EJEA 5KP7B 2JGPA 2K93A 2KGEA 1L0HA 2FQ0A 2CNRA 1NQ4A 2LPKA 1AF8A 2LKIA 2CG5B 2MR8A 2K92A 4BPFA 4MRTC 5KP8B 4PWVB 1HY8A 4H2YC 1T8KA 2JU2A 2KR5A 2JU1A 2K0XA 2AF8A 2LIUA 2L9FA 2L22A 2X2BA 5EJDA 1KLPA 2PNGA 2MR7A 2MVUA 2GDYA 2GDXA 4BPGA 1DV5A 2K2QA 2MY5A 4R0MA 2FHSC 1X3OA 2KORA 2K94A 3NY7B 2EHTA 2FVEA 5HV8A 2KG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2X C;  2FAD A;  2N6Z A;  3GZL A;  2KG9 A;  4HKG A;  2AVA A;  3EJD A;  4BPH A;  2AFD A;  2N98 A;  2KGA A;  2LL8 A;  2VSQ A;  1VKU A;  2FVA A;  2CQ8 A;  1L0I A;  5CZD B;  2MD9 A;  2KOQ A;  2KOS A;  2GDW A;  2KOO A;  4PXH B;  4DG9 A;  1ACP A;  5KP6 B;  4IZ6 A;  2KWL A;  2N50 A;  2N6Y A;  2M5R A;  2KGC A;  1F80 D;  2LIW A;  2KW2 A;  2XZ0 D;  3GZM A;  2N5H A;  2L0Q A;  5HVC A;  2N5I A;  2LML A;  3LMO A;  1HQB A;  2CGQ A;  3CE7 A;  2EHS A;  2FAC A;  3RG2 A;  2FQ1 A;  2ROQ A;  2FQ2 A;  2KOP A;  2JQ4 A;  2MF4 A;  2QNW A;  2KGD A;  3EJB A;  2KG8 A;  4NEO A;  1OR5 A;  4CA3 A;  2LTE A;  1DNY A;  2FAE A;  2MVV A;  2LOL A;  2L4B A;  2DNW A;  2FVF A;  2K0Y A;  2AFE A;  4H2W C;  2XZ1 C;  3EJE A;  5KP7 B;  2JGP A;  2K93 A;  2KGE A;  1L0H A;  2FQ0 A;  2CNR A;  1NQ4 A;  2LPK A;  1AF8 A;  2LKI A;  2CG5 B;  2MR8 A;  2K92 A;  4BPF A;  4MRT C;  5KP8 B;  4PWV B;  1HY8 A;  4H2Y C;  1T8K A;  2JU2 A;  2KR5 A;  2JU1 A;  2K0X A;  2AF8 A;  2LIU A;  2L9F A;  2L22 A;  2X2B A;  5EJD A;  1KLP A;  2PNG A;  2MR7 A;  2MVU A;  2GDY A;  2GDX A;  4BPG A;  1DV5 A;  2K2Q A;  2MY5 A;  4R0M A;  2FHS C;  1X3O A;  2KOR A;  2K94 A;  3NY7 B;  2EHT A;  2FVE A;  5HV8 A;  2KG6 A; 
#chains in the Genus database with same CATH topology
 3G21 A;  2KG9 A;  1QVG O;  2AVA A;  2XV6 A;  3G28 A;  3CD6 P;  2KOD A;  1S72 P;  2PEO A;  2GZG A;  2M8P A;  3E2D A;  1M6N A;  2CQ8 A;  2M8N A;  2KOQ A;  1NJI Q;  3CCM P;  1QRJ A;  3B5I A;  1VQN P;  1ACP A;  4U0E A;  3G29 A;  1YI2 P;  3DS1 A;  3H0D A;  2XZ0 D;  2L0Q A;  1YHQ P;  3G6E P;  2N5I A;  2CWO A;  1K73 Q;  3I55 P;  1W2B O;  1JJ2 O;  1VQ6 P;  1E6J P;  4QNB A;  1VQK P;  2OTL P;  4GR2 A;  4QKO A;  3MGE A;  5HGL A;  1OR5 A;  1GPJ A;  1IUQ A;  3G26 A;  1Q86 Q;  2FAE A;  2VLN A;  2MVV A;  2LOL A;  5BS1 A;  2L4B A;  2BHV A;  2K0Y A;  4H2W C;  2K93 A;  2KGE A;  1L0H A;  5EW5 E;  2VLP A;  2CNR A;  2Z44 A;  4U0F A;  3CCS P;  1D1D A;  1AF8 A;  5HGO A;  2MR8 A;  4MRT C;  1RNI A;  4PWV B;  3CMA P;  3NTE A;  2BUO A;  1M6E X;  2WPT A;  1KLP A;  2PNG A;  1GXH A;  2MR7 A;  1Q82 Q;  2GDX A;  4BPG A;  4COP A;  5I4T G;  2P9X A;  3G0V A;  3DPH A;  2PEJ A;  1X3O A;  3H47 A;  2NO8 A;  2FAD A;  3CCL P;  3GZL A;  4HKG A;  3GKL C;  2L6E A;  3M1M A;  4U0B A;  4BPH A;  2KGA A;  1YJ9 P;  4XFY A;  1L0I A;  5JPA A;  2ONT A;  1BXI A;  2GDW A;  1IMQ A;  4PXH B;  1VQO P;  2XXM A;  1A8O A;  1VQM P;  2JYL A;  1RO0 A;  2KGC A;  2QEX P;  3G1I A;  1F80 D;  1VQ5 P;  5F2N A;  3GZM A;  3DS5 A;  4XFZ A;  1YIT P;  1HQB A;  2CGQ A;  1A43 A;  4IPY A;  5BS2 A;  2ROQ A;  2KOP A;  1EMV A;  1FR2 A;  2EFJ A;  2MF4 A;  1M74 A;  4NEO A;  3U43 A;  3G1G A;  4CA3 A;  2LTE A;  2PEK A;  1N8R Q;  1K9M Q;  3G71 P;  2DNW A;  5HGN A;  5KP7 B;  3CCQ P;  2PY8 A;  2FQ0 A;  4U0D A;  1VQL P;  2LKI A;  2E1M A;  2K92 A;  4BPF A;  2JYG A;  4H2Y C;  1T8K A;  1Z6M A;  1YJN P;  2AF8 A;  3CC4 P;  2L9F A;  2L22 A;  2X2B A;  5EJD A;  3CCR P;  2MVU A;  1RO2 A;  1GXG A;  4U0A A;  4GR6 A;  2GZF A;  2GZE A;  1DV5 A;  2MY5 A;  4R0M A;  2FHS C;  2KOR A;  3NY7 B;  2FVE A;  2GZJ A;  5HGM A;  2KG6 A;  4WYM A;  4H2X C;  2N6Z A;  2PEM A;  1KQS O;  1KD1 Q;  1AUM A;  3CCU P;  2AFD A;  1CEI A;  2LL8 A;  3DTJ A;  2VLO A;  2MD9 A;  1KC8 Q;  2GYK A;  4DG9 A;  3HYB A;  4IZ6 A;  2N50 A;  3Q20 A;  3OW2 O;  4XFX A;  1ZNV A;  2LIW A;  1E0H A;  2PEQ A;  1VQ9 P;  2LML A;  3CE7 A;  3WBH A;  2ERH A;  2Z45 A;  2FQ2 A;  3H4E A;  2QNW A;  1M1K Q;  2KGD A;  3B4Q A;  3I56 P;  4XRO A;  2VLQ A;  5KP8 B;  1HY8 A;  1Q81 Q;  1MZ8 A;  2JU2 A;  3CC7 P;  2KR5 A;  2DGY A;  3VRL C;  1AYI A;  4M0I A;  2GDY A;  1K8A Q;  1VQ4 P;  1YJW P;  2LF4 A;  3CME P;  3DS3 A;  2EG5 A;  3RG6 C;  2JB0 A;  7CEI A;  2EHT A;  5CZD B;  4XRQ A;  3P05 A;  2PEI A;  3CC2 P;  1VQ7 P;  3EJD A;  1EOQ A;  2N98 A;  1UNK A;  2VSQ A;  1VKU A;  4PH0 A;  2FVA A;  4F37 A;  2KOS A;  2KOO A;  5F2O A;  2K0D X;  4COC A;  1BAJ A;  2XT1 A;  2JO0 A;  5KP6 B;  3DS2 A;  3CCJ P;  2KWL A;  1Q7Y Q;  2N6Y A;  2M5R A;  4U0C A;  3DS4 A;  2QA4 P;  3CPW O;  1UJZ A;  2KW2 A;  3CCE P;  2N5H A;  5HVC A;  3LMO A;  4UHP B;  2EHS A;  2FAC A;  3RG2 A;  2FQ1 A;  3LRY A;  2EIA A;  2JQ4 A;  2JBG A;  2JAZ A;  3DS0 A;  3EJB A;  1VQ8 P;  2KG8 A;  1IMP A;  1DNY A;  5F2K A;  1QVF O;  2PEN A;  2FVF A;  2AFE A;  2M8L A;  2XZ1 C;  3EJE A;  4PH1 A;  1ZMB A;  2JGP A;  1NQ4 A;  2LPK A;  3HZQ A;  3CXC O;  3CCV P;  2CG5 B;  5DCK A;  2GZI A;  3G4S P;  2OTJ P;  1M90 Q;  2Z46 A;  1VQP P;  2K5X A;  2JU1 A;  1K30 A;  2K0X A;  1YIJ P;  2LIU A;  1VHN A;  2K2Q A;  3GJN A;  2K94 A;  2OAR A;  5HV8 A;  1EIA A; 
#chains in the Genus database with same CATH homology
 4H2X C;  2FAD A;  2N6Z A;  3GZL A;  2KG9 A;  4HKG A;  2AVA A;  3EJD A;  4BPH A;  2AFD A;  2N98 A;  2KGA A;  2LL8 A;  2VSQ A;  1VKU A;  2FVA A;  2CQ8 A;  1L0I A;  5CZD B;  2MD9 A;  2KOQ A;  2KOS A;  2GDW A;  2KOO A;  4PXH B;  4DG9 A;  1ACP A;  5KP6 B;  4IZ6 A;  2KWL A;  2N50 A;  2N6Y A;  2M5R A;  2KGC A;  1F80 D;  2LIW A;  2KW2 A;  2XZ0 D;  3GZM A;  2N5H A;  2L0Q A;  5HVC A;  2N5I A;  2LML A;  3LMO A;  1HQB A;  2CGQ A;  3CE7 A;  2EHS A;  2FAC A;  3RG2 A;  2FQ1 A;  2ROQ A;  2FQ2 A;  2KOP A;  2JQ4 A;  2MF4 A;  2QNW A;  2KGD A;  3EJB A;  2KG8 A;  4NEO A;  1OR5 A;  4CA3 A;  2LTE A;  1DNY A;  2FAE A;  2MVV A;  2LOL A;  2L4B A;  2DNW A;  2FVF A;  2K0Y A;  2AFE A;  4H2W C;  2XZ1 C;  3EJE A;  5KP7 B;  2JGP A;  2K93 A;  2KGE A;  1L0H A;  2FQ0 A;  2CNR A;  1NQ4 A;  2LPK A;  1AF8 A;  2LKI A;  2CG5 B;  2MR8 A;  2K92 A;  4BPF A;  4MRT C;  5KP8 B;  4PWV B;  1HY8 A;  4H2Y C;  1T8K A;  2JU2 A;  2KR5 A;  2JU1 A;  2K0X A;  2AF8 A;  2LIU A;  2L9F A;  2L22 A;  2X2B A;  5EJD A;  1KLP A;  2PNG A;  2MR7 A;  2MVU A;  2GDY A;  2GDX A;  4BPG A;  1DV5 A;  2K2Q A;  2MY5 A;  4R0M A;  2FHS C;  1X3O A;  2KOR A;  2K94 A;  3NY7 B;  2EHT A;  2FVE A;  5HV8 A;  2KG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...