2KWLA

Solution structure of acyl carrier protein from borrelia burgdorferi
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
GPGSMDNDEIFSKVRSIISEQLDKKEDEITTDSRFVEDLNADSLDIYELLYLLEEAFDDKIPENEANEFETVGDVVNFIKKRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of an acyl-carrier protein from Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Lipid binding protein
molecule keywords Acyl carrier protein
total genus 18
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2kwlA00
2N5HA 2K93A 3CE7A 2FQ1A 2JU1A 2N5IA 2KG9A 2L9FA 2KGDA 2MR7A 2EHTA 2FHSC 2KGCA 2JGPA 4H2YC 2L22A 2FACA 1X3OA 4BPFA 2KG8A 2MVUA 2MVVA 2FQ0A 4BPHA 2K94A 4DG9A 4H2WC 5HV8A 4CA3A 2K0XA 5KP8B 4R0MA 4PXHB 2LPKA 2VSQA 1KLPA 2AF8A 2N6YA 5EJDA 2AFDA 4MRTC 2FVAA 2KG6A 4H2XC 2KORA 2PNGA 2X2BA 1F80D 2CNRA 3EJEA 1DNYA 2JU2A 2MY5A 3NY7B 2K2QA 1T8KA 4HKGA 1VKUA 3EJBA 2KGEA 5KP7B 2N50A 5CZDB 1L0IA 2FAEA 2LL8A 4PWVB 2MD9A 2JQ4A 2MF4A 2LIUA 3GZMA 2FVFA 2CQ8A 1L0HA 2XZ1C 2AVAA 2K0YA 3LMOA 2ROQA 3GZLA 1DV5A 2AFEA 2N98A 1ACPA 1HQBA 2KW2A 2KWLA 2GDXA 4IZ6A 2FADA 2EHSA 4NEOA 2GDYA 1HY8A 2GDWA 2KOSA 2DNWA 3RG2A 2KOOA 2L0QA 1AF8A 2KGAA 2K92A 5KP6B 2LOLA 2QNWA 2XZ0D 2FVEA 2M5RA 2LIWA 2CGQA 2CG5B 5HVCA 1OR5A 2LTEA 2N6ZA 1NQ4A 2FQ2A 2LMLA 2KR5A 2LKIA 2KOQA 2KOPA 3EJDA 4BPGA 2L4BA 2MR8A
chains in the Genus database with same CATH superfamily
1N8RQ 2N5HA 2N5IA 3CC2P 1RNIA 5F2NA 2KGCA 3DTJA 2GZGA 4U0FA 2KODA 1ZMBA 1E0HA 4BPHA 3DS2A 2NO8A 2K94A 4DG9A 5HV8A 1IMPA 3CCVP 1YITP 2VSQA 1M6EX 1GXGA 4MRTC 2KORA 4XRQA 1RO2A 4IPYA 1DNYA 2PENA 2MY5A 3NY7B 4U0EA 3I56P 1VKUA 1QRJA 5CZDB 1L0IA 2LL8A 1VQ5P 3G0VA 1A8OA 4QKOA 1VQOP 2MF4A 3CCSP 2K0YA 2ROQA 2KW2A 2KWLA 3E2DA 2FADA 2EHSA 2M8LA 1M1KQ 3Q20A 4NEOA 4U0CA 3OW2O 3GKLC 2DNWA 3B5IA 1VQMP 5F2KA 3CC4P 3HYBA 2XXMA 3G28A 2PEQA 1EIAA 2FVEA 2M5RA 1M74A 1RO0A 5HVCA 3CPWO 2FQ2A 3VRLC 2KR5A 3CMEP 1UNKA 3G6EP 1VQ9P 2KOQA 2MR8A 2QEXP 2K0DX 5EW5E 3CE7A 3P05A 2PEKA 2ONTA 2KG9A 1ZNVA 2MR7A 2FHSC 4PH0A 2JGPA 2L22A 1NJIQ 1X3OA 3M1MA 4BPFA 2KG8A 3G26A 2VLOA 2P9XA 2PEJA 2FQ0A 1Q81Q 1VQ4P 3CCQP 2JYGA 4CA3A 5KP8B 4R0MA 1VQ7P 4PXHB 2N6YA 2JB0A 2EG5A 4WYMA 4GR6A 2FVAA 1M90Q 2Z46A 4XFXA 1Q7YQ 3G4SP 3RG6C 2CNRA 1K8AQ 1GPJA 2VLNA 4QNBA 5DCKA 1YHQP 3CCLP 1T8KA 1M6NA 5KP7B 1W2BO 2PEMA 1VQ8P 3H47A 2ERHA 2JAZA 3GZMA 3LRYA 3CD6P 2CQ8A 2XZ1C 3CCUP 1KC8Q 3GZLA 2N98A 1ACPA 3CCMP 1KQSO 2GZEA 4U0DA 2GDYA 2E1MA 1HY8A 2KOSA 1VQKP 3G21A 1KD1Q 2L0QA 1VQPP 1JJ2O 2K92A 2LOLA 2XZ0D 2CGQA 2VLQA 4COCA 3H0DA 2LTEA 2N6ZA 1NQ4A 2EFJA 2LKIA 1QVGO 4BPGA 5HGLA 2K93A 1S72P 2JU1A 2L9FA 2EIAA 2KGDA 1UJZA 2GYKA 2LF4A 4H2YC 2XT1A 3NTEA 1BAJA 1AYIA 2MVUA 1CEIA 5JPAA 2PEIA 2K0XA 4GR2A 5HGOA 3CCJP 4F37A 1KLPA 2AFDA 2JO0A 2KG6A 2X2BA 1K30A 1YI2P 3EJEA 2PEOA 7CEIA 3DS1A 2K2QA 3EJBA 2BUOA 4XROA 2KGEA 4M0IA 2N50A 3G1IA 2GZIA 1VQLP 4PWVB 2MD9A 2CWOA 2Z45A 2GZFA 2DGYA 3CCRP 1YJ9P 2OTJP 3LMOA 3G71P 2AFEA 3G1GA 1HQBA 2GDXA 1IMQA 1VQ6P 1D1DA 3DS5A 1E6JP 1Q86Q 2KGAA 5KP6B 2QNWA 2LIWA 5BS1A 2CG5B 4U0AA 3CXCO 1VQNP 1EMVA 4UHPB 2KOPA 3CCEP 1FR2A 5F2OA 1AUMA 2FQ1A 2EHTA 4U0BA 1Z6MA 3MGEA 2FACA 2M8PA 1YIJP 3U43A 2JBGA 3HZQA 2MVVA 2M8NA 2BHVA 1YJWP 4H2WC 3CMAP 3G29A 1GXHA 2LPKA 2AF8A 3WBHA 5EJDA 2L6EA 1EOQA 2QA4P 3DS0A 4H2XC 2PNGA 1BXIA 1F80D 1MZ8A 3H4EA 2Z44A 5I4TG 2JU2A 1YJNP 3B4QA 2WPTA 4HKGA 2GZJA 4XFYA 1A43A 2FAEA 1Q82Q 2JQ4A 2LIUA 2XV6A 2FVFA 2K5XA 2OARA 1L0HA 5HGNA 2AVAA 2PY8A 1K73Q 1QVFO 1DV5A 3CC7P 3DPHA 4IZ6A 3I55P 1VHNA 2GDWA 4COPA 3RG2A 2KOOA 3DS3A 1AF8A 5BS2A 1K9MQ 4PH1A 2VLPA 3DS4A 2OTLP 2JYLA 5HGMA 1OR5A 3GJNA 2LMLA 3EJDA 1IUQA 2L4BA 4XFZA
chains in the Genus database with same CATH topology
2N5HA 2K93A 3CE7A 2FQ1A 2JU1A 2N5IA 2KG9A 2L9FA 2KGDA 2MR7A 2EHTA 2FHSC 2KGCA 2JGPA 4H2YC 2L22A 2FACA 1X3OA 4BPFA 2KG8A 2MVUA 2MVVA 2FQ0A 4BPHA 2K94A 4DG9A 4H2WC 5HV8A 4CA3A 2K0XA 5KP8B 4R0MA 4PXHB 2LPKA 2VSQA 1KLPA 2AF8A 2N6YA 5EJDA 2AFDA 4MRTC 2FVAA 2KG6A 4H2XC 2KORA 2PNGA 2X2BA 1F80D 2CNRA 3EJEA 1DNYA 2JU2A 2MY5A 3NY7B 2K2QA 1T8KA 4HKGA 1VKUA 3EJBA 2KGEA 5KP7B 2N50A 5CZDB 1L0IA 2FAEA 2LL8A 4PWVB 2MD9A 2JQ4A 2MF4A 2LIUA 3GZMA 2FVFA 2CQ8A 1L0HA 2XZ1C 2AVAA 2K0YA 3LMOA 2ROQA 3GZLA 1DV5A 2AFEA 2N98A 1ACPA 1HQBA 2KW2A 2KWLA 2GDXA 4IZ6A 2FADA 2EHSA 4NEOA 2GDYA 1HY8A 2GDWA 2KOSA 2DNWA 3RG2A 2KOOA 2L0QA 1AF8A 2KGAA 2K92A 5KP6B 2LOLA 2QNWA 2XZ0D 2FVEA 2M5RA 2LIWA 2CGQA 2CG5B 5HVCA 1OR5A 2LTEA 2N6ZA 1NQ4A 2FQ2A 2LMLA 2KR5A 2LKIA 2KOQA 2KOPA 3EJDA 4BPGA 2L4BA 2MR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N5H A;  2K93 A;  3CE7 A;  2FQ1 A;  2JU1 A;  2N5I A;  2KG9 A;  2L9F A;  2KGD A;  2MR7 A;  2EHT A;  2FHS C;  2KGC A;  2JGP A;  4H2Y C;  2L22 A;  2FAC A;  1X3O A;  4BPF A;  2KG8 A;  2MVU A;  2MVV A;  2FQ0 A;  4BPH A;  2K94 A;  4DG9 A;  4H2W C;  5HV8 A;  4CA3 A;  2K0X A;  5KP8 B;  4R0M A;  4PXH B;  2LPK A;  2VSQ A;  1KLP A;  2AF8 A;  2N6Y A;  5EJD A;  2AFD A;  4MRT C;  2FVA A;  2KG6 A;  4H2X C;  2KOR A;  2PNG A;  2X2B A;  1F80 D;  2CNR A;  3EJE A;  1DNY A;  2JU2 A;  2MY5 A;  3NY7 B;  2K2Q A;  1T8K A;  4HKG A;  1VKU A;  3EJB A;  2KGE A;  5KP7 B;  2N50 A;  5CZD B;  1L0I A;  2FAE A;  2LL8 A;  4PWV B;  2MD9 A;  2JQ4 A;  2MF4 A;  2LIU A;  3GZM A;  2FVF A;  2CQ8 A;  1L0H A;  2XZ1 C;  2AVA A;  2K0Y A;  3LMO A;  2ROQ A;  3GZL A;  1DV5 A;  2AFE A;  2N98 A;  1ACP A;  1HQB A;  2KW2 A;  2KWL A;  2GDX A;  4IZ6 A;  2FAD A;  2EHS A;  4NEO A;  2GDY A;  1HY8 A;  2GDW A;  2KOS A;  2DNW A;  3RG2 A;  2KOO A;  2L0Q A;  1AF8 A;  2KGA A;  2K92 A;  5KP6 B;  2LOL A;  2QNW A;  2XZ0 D;  2FVE A;  2M5R A;  2LIW A;  2CGQ A;  2CG5 B;  5HVC A;  1OR5 A;  2LTE A;  2N6Z A;  1NQ4 A;  2FQ2 A;  2LML A;  2KR5 A;  2LKI A;  2KOQ A;  2KOP A;  3EJD A;  4BPG A;  2L4B A;  2MR8 A; 
#chains in the Genus database with same CATH topology
 1N8R Q;  2N5H A;  2N5I A;  3CC2 P;  1RNI A;  5F2N A;  2KGC A;  3DTJ A;  2GZG A;  4U0F A;  2KOD A;  1ZMB A;  1E0H A;  4BPH A;  3DS2 A;  2NO8 A;  2K94 A;  4DG9 A;  5HV8 A;  1IMP A;  3CCV P;  1YIT P;  2VSQ A;  1M6E X;  1GXG A;  4MRT C;  2KOR A;  4XRQ A;  1RO2 A;  4IPY A;  1DNY A;  2PEN A;  2MY5 A;  3NY7 B;  4U0E A;  3I56 P;  1VKU A;  1QRJ A;  5CZD B;  1L0I A;  2LL8 A;  1VQ5 P;  3G0V A;  1A8O A;  4QKO A;  1VQO P;  2MF4 A;  3CCS P;  2K0Y A;  2ROQ A;  2KW2 A;  2KWL A;  3E2D A;  2FAD A;  2EHS A;  2M8L A;  1M1K Q;  3Q20 A;  4NEO A;  4U0C A;  3OW2 O;  3GKL C;  2DNW A;  3B5I A;  1VQM P;  5F2K A;  3CC4 P;  3HYB A;  2XXM A;  3G28 A;  2PEQ A;  1EIA A;  2FVE A;  2M5R A;  1M74 A;  1RO0 A;  5HVC A;  3CPW O;  2FQ2 A;  3VRL C;  2KR5 A;  3CME P;  1UNK A;  3G6E P;  1VQ9 P;  2KOQ A;  2MR8 A;  2QEX P;  2K0D X;  5EW5 E;  3CE7 A;  3P05 A;  2PEK A;  2ONT A;  2KG9 A;  1ZNV A;  2MR7 A;  2FHS C;  4PH0 A;  2JGP A;  2L22 A;  1NJI Q;  1X3O A;  3M1M A;  4BPF A;  2KG8 A;  3G26 A;  2VLO A;  2P9X A;  2PEJ A;  2FQ0 A;  1Q81 Q;  1VQ4 P;  3CCQ P;  2JYG A;  4CA3 A;  5KP8 B;  4R0M A;  1VQ7 P;  4PXH B;  2N6Y A;  2JB0 A;  2EG5 A;  4WYM A;  4GR6 A;  2FVA A;  1M90 Q;  2Z46 A;  4XFX A;  1Q7Y Q;  3G4S P;  3RG6 C;  2CNR A;  1K8A Q;  1GPJ A;  2VLN A;  4QNB A;  5DCK A;  1YHQ P;  3CCL P;  1T8K A;  1M6N A;  5KP7 B;  1W2B O;  2PEM A;  1VQ8 P;  3H47 A;  2ERH A;  2JAZ A;  3GZM A;  3LRY A;  3CD6 P;  2CQ8 A;  2XZ1 C;  3CCU P;  1KC8 Q;  3GZL A;  2N98 A;  1ACP A;  3CCM P;  1KQS O;  2GZE A;  4U0D A;  2GDY A;  2E1M A;  1HY8 A;  2KOS A;  1VQK P;  3G21 A;  1KD1 Q;  2L0Q A;  1VQP P;  1JJ2 O;  2K92 A;  2LOL A;  2XZ0 D;  2CGQ A;  2VLQ A;  4COC A;  3H0D A;  2LTE A;  2N6Z A;  1NQ4 A;  2EFJ A;  2LKI A;  1QVG O;  4BPG A;  5HGL A;  2K93 A;  1S72 P;  2JU1 A;  2L9F A;  2EIA A;  2KGD A;  1UJZ A;  2GYK A;  2LF4 A;  4H2Y C;  2XT1 A;  3NTE A;  1BAJ A;  1AYI A;  2MVU A;  1CEI A;  5JPA A;  2PEI A;  2K0X A;  4GR2 A;  5HGO A;  3CCJ P;  4F37 A;  1KLP A;  2AFD A;  2JO0 A;  2KG6 A;  2X2B A;  1K30 A;  1YI2 P;  3EJE A;  2PEO A;  7CEI A;  3DS1 A;  2K2Q A;  3EJB A;  2BUO A;  4XRO A;  2KGE A;  4M0I A;  2N50 A;  3G1I A;  2GZI A;  1VQL P;  4PWV B;  2MD9 A;  2CWO A;  2Z45 A;  2GZF A;  2DGY A;  3CCR P;  1YJ9 P;  2OTJ P;  3LMO A;  3G71 P;  2AFE A;  3G1G A;  1HQB A;  2GDX A;  1IMQ A;  1VQ6 P;  1D1D A;  3DS5 A;  1E6J P;  1Q86 Q;  2KGA A;  5KP6 B;  2QNW A;  2LIW A;  5BS1 A;  2CG5 B;  4U0A A;  3CXC O;  1VQN P;  1EMV A;  4UHP B;  2KOP A;  3CCE P;  1FR2 A;  5F2O A;  1AUM A;  2FQ1 A;  2EHT A;  4U0B A;  1Z6M A;  3MGE A;  2FAC A;  2M8P A;  1YIJ P;  3U43 A;  2JBG A;  3HZQ A;  2MVV A;  2M8N A;  2BHV A;  1YJW P;  4H2W C;  3CMA P;  3G29 A;  1GXH A;  2LPK A;  2AF8 A;  3WBH A;  5EJD A;  2L6E A;  1EOQ A;  2QA4 P;  3DS0 A;  4H2X C;  2PNG A;  1BXI A;  1F80 D;  1MZ8 A;  3H4E A;  2Z44 A;  5I4T G;  2JU2 A;  1YJN P;  3B4Q A;  2WPT A;  4HKG A;  2GZJ A;  4XFY A;  1A43 A;  2FAE A;  1Q82 Q;  2JQ4 A;  2LIU A;  2XV6 A;  2FVF A;  2K5X A;  2OAR A;  1L0H A;  5HGN A;  2AVA A;  2PY8 A;  1K73 Q;  1QVF O;  1DV5 A;  3CC7 P;  3DPH A;  4IZ6 A;  3I55 P;  1VHN A;  2GDW A;  4COP A;  3RG2 A;  2KOO A;  3DS3 A;  1AF8 A;  5BS2 A;  1K9M Q;  4PH1 A;  2VLP A;  3DS4 A;  2OTL P;  2JYL A;  5HGM A;  1OR5 A;  3GJN A;  2LML A;  3EJD A;  1IUQ A;  2L4B A;  4XFZ A; 
#chains in the Genus database with same CATH homology
 2N5H A;  2K93 A;  3CE7 A;  2FQ1 A;  2JU1 A;  2N5I A;  2KG9 A;  2L9F A;  2KGD A;  2MR7 A;  2EHT A;  2FHS C;  2KGC A;  2JGP A;  4H2Y C;  2L22 A;  2FAC A;  1X3O A;  4BPF A;  2KG8 A;  2MVU A;  2MVV A;  2FQ0 A;  4BPH A;  2K94 A;  4DG9 A;  4H2W C;  5HV8 A;  4CA3 A;  2K0X A;  5KP8 B;  4R0M A;  4PXH B;  2LPK A;  2VSQ A;  1KLP A;  2AF8 A;  2N6Y A;  5EJD A;  2AFD A;  4MRT C;  2FVA A;  2KG6 A;  4H2X C;  2KOR A;  2PNG A;  2X2B A;  1F80 D;  2CNR A;  3EJE A;  1DNY A;  2JU2 A;  2MY5 A;  3NY7 B;  2K2Q A;  1T8K A;  4HKG A;  1VKU A;  3EJB A;  2KGE A;  5KP7 B;  2N50 A;  5CZD B;  1L0I A;  2FAE A;  2LL8 A;  4PWV B;  2MD9 A;  2JQ4 A;  2MF4 A;  2LIU A;  3GZM A;  2FVF A;  2CQ8 A;  1L0H A;  2XZ1 C;  2AVA A;  2K0Y A;  3LMO A;  2ROQ A;  3GZL A;  1DV5 A;  2AFE A;  2N98 A;  1ACP A;  1HQB A;  2KW2 A;  2KWL A;  2GDX A;  4IZ6 A;  2FAD A;  2EHS A;  4NEO A;  2GDY A;  1HY8 A;  2GDW A;  2KOS A;  2DNW A;  3RG2 A;  2KOO A;  2L0Q A;  1AF8 A;  2KGA A;  2K92 A;  5KP6 B;  2LOL A;  2QNW A;  2XZ0 D;  2FVE A;  2M5R A;  2LIW A;  2CGQ A;  2CG5 B;  5HVC A;  1OR5 A;  2LTE A;  2N6Z A;  1NQ4 A;  2FQ2 A;  2LML A;  2KR5 A;  2LKI A;  2KOQ A;  2KOP A;  3EJD A;  4BPG A;  2L4B A;  2MR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...