2NO8A

Nmr structure analysis of the colicin immuntiy protein im2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
ELKHSISDYTEAEFLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Models for non Cognate Complexes of the DNase Domain of Colicin E9 and Colicin Immunity Proteins
rcsb
source organism Escherichia coli
molecule tags Immune system
molecule keywords Colicin-E2 immunity protein
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2no8A00
2GZFA 2GYKA 1BXIA 2ERHA 1IMQA 2GZJA 2WPTA 3GKLC 2GZIA 3GJNA 1E0HA 1EMVA 1AYIA 2VLNA 2JBGA 2GZEA 4F37A 2VLQA 7CEIA 1UJZA 1UNKA 2VLPA 1IMPA 2JAZA 3U43A 1MZ8A 1ZNVA 2GZGA 1GXHA 4QKOA 2NO8A 2VLOA 4UHPB 5EW5E 1GXGA 2K5XA 2K0DX 1FR2A 1CEIA 2JB0A
chains in the Genus database with same CATH superfamily
2GZFA 4NEOA 2N6YA 2FACA 2CQ8A 2GZJA 2N5HA 4HKGA 3H4EA 2PNGA 2KORA 3H47A 2QEXP 4QNBA 1AUMA 1VQ6P 3G1GA 2L0QA 5F2NA 3CCQP 3GZMA 1N8RQ 2N50A 2LKIA 1BXIA 3CPWO 2JO0A 3B4QA 4IPYA 2E1MA 3CCRP 4IZ6A 4R0MA 2JBGA 5KP6B 2Z45A 7CEIA 3CE7A 4H2WC 3CC4P 4GR6A 5JPAA 2OTLP 1X3OA 1MZ8A 4PH1A 4QKOA 2KOPA 2XZ0D 2KGAA 1CEIA 2FQ1A 2FADA 1EOQA 2ERHA 2JYLA 1EMVA 1YITP 2GDWA 1YHQP 2MY5A 1E6JP 2N6ZA 1GXHA 2KG9A 5EW5E 5HGOA 4WYMA 2K5XA 2X2BA 3CD6P 2XV6A 2KOSA 1VQOP 3RG6C 2LMLA 5I4TG 2EIAA 2M8LA 3DS5A 1GPJA 2PEKA 3NTEA 2PEOA 2JAZA 1NQ4A 4U0FA 5HGLA 2NO8A 3DS3A 2N5IA 5CZDB 2KGEA 1HQBA 4BPGA 2K94A 2ROQA 2FVAA 2AVAA 1Z6MA 2KWLA 5F2KA 2VLQA 3CCEP 1M90Q 2FQ0A 2FVFA 3CC7P 2VSQA 1HY8A 3CCJP 3CMEP 4MRTC 2WPTA 1M1KQ 2VLNA 4F37A 3HYBA 2JQ4A 2VLPA 4DG9A 5HV8A 2K2QA 3MGEA 4UHPB 1VQMP 2P9XA 3HZQA 2MF4A 1YI2P 1AF8A 1IMQA 2CNRA 3M1MA 2KOQA 1Q86Q 2M8NA 4PH0A 4XFZA 2L9FA 1VQPP 1GXGA 3I56P 1K73Q 1YIJP 2ONTA 1KLPA 2BUOA 4U0AA 2JYGA 3CCSP 3G28A 2AF8A 5EJDA 1DNYA 1ZMBA 2DNWA 3U43A 1A8OA 2OTJP 5KP8B 5HGNA 4CA3A 2N98A 2EHTA 3CMAP 2FAEA 3LRYA 1KC8Q 3WBHA 3H0DA 4U0CA 4XRQA 1AYIA 1VQKP 2K0YA 2MD9A 3DTJA 1VQLP 3P05A 2PY8A 3G6EP 3G71P 1IUQA 2JGPA 3Q20A 2KW2A 2MR8A 1YJNP 2AFEA 2KODA 2QA4P 3LMOA 2LIUA 5DCKA 3OW2O 2KG8A 2MVVA 1K8AQ 2PEQA 1VQNP 1ACPA 3G21A 1YJ9P 2VLOA 4H2XC 2K0DX 1FR2A 3G0VA 4PXHB 1DV5A 1BAJA 1QVGO 2L6EA 1VQ8P 2FHSC 3DS0A 2M8PA 1OR5A 4COPA 1QVFO 1RO2A 2M5RA 2K92A 1A43A 1VQ9P 1M74A 1M6EX 1ZNVA 4U0DA 5BS2A 1L0IA 3E2DA 2KG6A 3RG2A 1L0HA 3B5IA 2LF4A 3G26A 1M6NA 2KOOA 4H2YC 3CCMP 2JU2A 2LL8A 3GKLC 3CCUP 2XT1A 3NY7B 1VHNA 4XROA 1UJZA 2L22A 3GZLA 3CCVP 1YJWP 3DPHA 5HVCA 2Z46A 5HGMA 5BS1A 2K93A 2LIWA 2Z44A 3EJBA 1RNIA 2JU1A 2GZIA 2EFJA 1QRJA 2CWOA 1Q81Q 2GZEA 2GDXA 1Q82Q 3DS1A 4COCA 4U0BA 3DS2A 2EG5A 2GZGA 5F2OA 2BHVA 1KQSO 2JB0A 4M0IA 2DGYA 2OARA 2CGQA 1W2BO 2KGDA 4PWVB 3VRLC 5KP7B 1EIAA 1Q7YQ 3EJEA 2XXMA 3EJDA 3DS4A 3CXCO 2L4BA 2KR5A 2FVEA 4GR2A 2XZ1C 4BPFA 1VKUA 3G4SP 1S72P 1K30A 3CCLP 3G29A 1D1DA 2PEIA 2LPKA 3GJNA 1E0HA 2PENA 1T8KA 1VQ4P 1JJ2O 1UNKA 1VQ5P 4U0EA 2CG5B 1NJIQ 1VQ7P 1F80D 2KGCA 1K9MQ 4XFXA 2EHSA 2GYKA 2MVUA 2LTEA 2QNWA 3CC2P 2PEMA 2AFDA 3G1IA 4BPHA 3I55P 2GDYA 1KD1Q 2FQ2A 2PEJA 2LOLA 1RO0A 1IMPA 2K0XA 4XFYA 2MR7A
chains in the Genus database with same CATH topology
2GZFA 2GYKA 1BXIA 2ERHA 1IMQA 2GZJA 2WPTA 3GKLC 2GZIA 3GJNA 1E0HA 1EMVA 1AYIA 2VLNA 2JBGA 2GZEA 4F37A 2VLQA 7CEIA 1UJZA 1UNKA 2VLPA 1IMPA 2JAZA 3U43A 1MZ8A 1ZNVA 2GZGA 1GXHA 4QKOA 2NO8A 2VLOA 4UHPB 5EW5E 1GXGA 2K5XA 2K0DX 1FR2A 1CEIA 2JB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZF A;  2GYK A;  1BXI A;  2ERH A;  1IMQ A;  2GZJ A;  2WPT A;  3GKL C;  2GZI A;  3GJN A;  1E0H A;  1EMV A;  1AYI A;  2VLN A;  2JBG A;  2GZE A;  4F37 A;  2VLQ A;  7CEI A;  1UJZ A;  1UNK A;  2VLP A;  1IMP A;  2JAZ A;  3U43 A;  1MZ8 A;  1ZNV A;  2GZG A;  1GXH A;  4QKO A;  2NO8 A;  2VLO A;  4UHP B;  5EW5 E;  1GXG A;  2K5X A;  2K0D X;  1FR2 A;  1CEI A;  2JB0 A; 
#chains in the Genus database with same CATH topology
 2GZF A;  4NEO A;  2N6Y A;  2FAC A;  2CQ8 A;  2GZJ A;  2N5H A;  4HKG A;  3H4E A;  2PNG A;  2KOR A;  3H47 A;  2QEX P;  4QNB A;  1AUM A;  1VQ6 P;  3G1G A;  2L0Q A;  5F2N A;  3CCQ P;  3GZM A;  1N8R Q;  2N50 A;  2LKI A;  1BXI A;  3CPW O;  2JO0 A;  3B4Q A;  4IPY A;  2E1M A;  3CCR P;  4IZ6 A;  4R0M A;  2JBG A;  5KP6 B;  2Z45 A;  7CEI A;  3CE7 A;  4H2W C;  3CC4 P;  4GR6 A;  5JPA A;  2OTL P;  1X3O A;  1MZ8 A;  4PH1 A;  4QKO A;  2KOP A;  2XZ0 D;  2KGA A;  1CEI A;  2FQ1 A;  2FAD A;  1EOQ A;  2ERH A;  2JYL A;  1EMV A;  1YIT P;  2GDW A;  1YHQ P;  2MY5 A;  1E6J P;  2N6Z A;  1GXH A;  2KG9 A;  5EW5 E;  5HGO A;  4WYM A;  2K5X A;  2X2B A;  3CD6 P;  2XV6 A;  2KOS A;  1VQO P;  3RG6 C;  2LML A;  5I4T G;  2EIA A;  2M8L A;  3DS5 A;  1GPJ A;  2PEK A;  3NTE A;  2PEO A;  2JAZ A;  1NQ4 A;  4U0F A;  5HGL A;  2NO8 A;  3DS3 A;  2N5I A;  5CZD B;  2KGE A;  1HQB A;  4BPG A;  2K94 A;  2ROQ A;  2FVA A;  2AVA A;  1Z6M A;  2KWL A;  5F2K A;  2VLQ A;  3CCE P;  1M90 Q;  2FQ0 A;  2FVF A;  3CC7 P;  2VSQ A;  1HY8 A;  3CCJ P;  3CME P;  4MRT C;  2WPT A;  1M1K Q;  2VLN A;  4F37 A;  3HYB A;  2JQ4 A;  2VLP A;  4DG9 A;  5HV8 A;  2K2Q A;  3MGE A;  4UHP B;  1VQM P;  2P9X A;  3HZQ A;  2MF4 A;  1YI2 P;  1AF8 A;  1IMQ A;  2CNR A;  3M1M A;  2KOQ A;  1Q86 Q;  2M8N A;  4PH0 A;  4XFZ A;  2L9F A;  1VQP P;  1GXG A;  3I56 P;  1K73 Q;  1YIJ P;  2ONT A;  1KLP A;  2BUO A;  4U0A A;  2JYG A;  3CCS P;  3G28 A;  2AF8 A;  5EJD A;  1DNY A;  1ZMB A;  2DNW A;  3U43 A;  1A8O A;  2OTJ P;  5KP8 B;  5HGN A;  4CA3 A;  2N98 A;  2EHT A;  3CMA P;  2FAE A;  3LRY A;  1KC8 Q;  3WBH A;  3H0D A;  4U0C A;  4XRQ A;  1AYI A;  1VQK P;  2K0Y A;  2MD9 A;  3DTJ A;  1VQL P;  3P05 A;  2PY8 A;  3G6E P;  3G71 P;  1IUQ A;  2JGP A;  3Q20 A;  2KW2 A;  2MR8 A;  1YJN P;  2AFE A;  2KOD A;  2QA4 P;  3LMO A;  2LIU A;  5DCK A;  3OW2 O;  2KG8 A;  2MVV A;  1K8A Q;  2PEQ A;  1VQN P;  1ACP A;  3G21 A;  1YJ9 P;  2VLO A;  4H2X C;  2K0D X;  1FR2 A;  3G0V A;  4PXH B;  1DV5 A;  1BAJ A;  1QVG O;  2L6E A;  1VQ8 P;  2FHS C;  3DS0 A;  2M8P A;  1OR5 A;  4COP A;  1QVF O;  1RO2 A;  2M5R A;  2K92 A;  1A43 A;  1VQ9 P;  1M74 A;  1M6E X;  1ZNV A;  4U0D A;  5BS2 A;  1L0I A;  3E2D A;  2KG6 A;  3RG2 A;  1L0H A;  3B5I A;  2LF4 A;  3G26 A;  1M6N A;  2KOO A;  4H2Y C;  3CCM P;  2JU2 A;  2LL8 A;  3GKL C;  3CCU P;  2XT1 A;  3NY7 B;  1VHN A;  4XRO A;  1UJZ A;  2L22 A;  3GZL A;  3CCV P;  1YJW P;  3DPH A;  5HVC A;  2Z46 A;  5HGM A;  5BS1 A;  2K93 A;  2LIW A;  2Z44 A;  3EJB A;  1RNI A;  2JU1 A;  2GZI A;  2EFJ A;  1QRJ A;  2CWO A;  1Q81 Q;  2GZE A;  2GDX A;  1Q82 Q;  3DS1 A;  4COC A;  4U0B A;  3DS2 A;  2EG5 A;  2GZG A;  5F2O A;  2BHV A;  1KQS O;  2JB0 A;  4M0I A;  2DGY A;  2OAR A;  2CGQ A;  1W2B O;  2KGD A;  4PWV B;  3VRL C;  5KP7 B;  1EIA A;  1Q7Y Q;  3EJE A;  2XXM A;  3EJD A;  3DS4 A;  3CXC O;  2L4B A;  2KR5 A;  2FVE A;  4GR2 A;  2XZ1 C;  4BPF A;  1VKU A;  3G4S P;  1S72 P;  1K30 A;  3CCL P;  3G29 A;  1D1D A;  2PEI A;  2LPK A;  3GJN A;  1E0H A;  2PEN A;  1T8K A;  1VQ4 P;  1JJ2 O;  1UNK A;  1VQ5 P;  4U0E A;  2CG5 B;  1NJI Q;  1VQ7 P;  1F80 D;  2KGC A;  1K9M Q;  4XFX A;  2EHS A;  2GYK A;  2MVU A;  2LTE A;  2QNW A;  3CC2 P;  2PEM A;  2AFD A;  3G1I A;  4BPH A;  3I55 P;  2GDY A;  1KD1 Q;  2FQ2 A;  2PEJ A;  2LOL A;  1RO0 A;  1IMP A;  2K0X A;  4XFY A;  2MR7 A; 
#chains in the Genus database with same CATH homology
 2GZF A;  2GYK A;  1BXI A;  2ERH A;  1IMQ A;  2GZJ A;  2WPT A;  3GKL C;  2GZI A;  3GJN A;  1E0H A;  1EMV A;  1AYI A;  2VLN A;  2JBG A;  2GZE A;  4F37 A;  2VLQ A;  7CEI A;  1UJZ A;  1UNK A;  2VLP A;  1IMP A;  2JAZ A;  3U43 A;  1MZ8 A;  1ZNV A;  2GZG A;  1GXH A;  4QKO A;  2NO8 A;  2VLO A;  4UHP B;  5EW5 E;  1GXG A;  2K5X A;  2K0D X;  1FR2 A;  1CEI A;  2JB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...