2NO8A

Nmr structure analysis of the colicin immuntiy protein im2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
ELKHSISDYTEAEFLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E2 immunity protein
publication title Structural Models for non Cognate Complexes of the DNase Domain of Colicin E9 and Colicin Immunity Proteins
rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2no8A00
5EW5E 2JB0A 1AYIA 1GXHA 2GZIA 2K0DX 2GZFA 1EMVA 2GYKA 2GZEA 2NO8A 2GZJA 1MZ8A 2VLOA 2JAZA 2VLPA 3U43A 4F37A 2K5XA 1E0HA 1FR2A 2VLQA 3GJNA 1BXIA 4QKOA 1GXGA 1IMPA 1CEIA 1UJZA 1IMQA 7CEIA 1UNKA 2ERHA 1ZNVA 2WPTA 2GZGA 3GKLC 2JBGA 4UHPB 2VLNA
chains in the Genus database with same CATH superfamily
2FVEA 2XZ1C 2K0XA 3WBHA 2KR5A 2MVUA 1HQBA 2FVFA 2EG5A 3U43A 2PEQA 3RG6C 2AVAA 1AF8A 5KP8B 2KORA 2WPTA 5CZDB 3EJBA 1EMVA 3CXCO 3HZQA 1YHQP 3G21A 2KGCA 1KC8Q 2VLPA 2GDWA 1CEIA 2LTEA 2N5IA 1KLPA 2Z46A 1ZNVA 1VHNA 2JBGA 5EW5E 1GXHA 2FADA 2M8PA 1YJWP 1VQMP 2XXMA 2FQ1A 2Z44A 4XFYA 2K5XA 5F2OA 3CMEP 3B4QA 3H0DA 2K93A 2VLNA 1M90Q 2GDYA 2CNRA 1RO2A 1Q86Q 4PXHB 4U0FA 3G29A 3G4SP 2JO0A 1BAJA 4PH0A 1Q81Q 4F37A 2ROQA 2DGYA 3DS1A 2KWLA 2QEXP 2KOQA 4XFXA 2JB0A 2K2QA 2K94A 3EJDA 4BPFA 5BS2A 2K92A 2VLOA 2N5HA 3CCRP 2N98A 1S72P 1FR2A 1JJ2O 2KGAA 2FACA 4IZ6A 3DS0A 2QA4P 4IPYA 2FQ0A 1KQSO 2M8LA 2PEJA 1QVGO 2KG9A 4U0EA 1VQ6P 1K8AQ 3B5IA 2N6ZA 3G1IA 3LMOA 3H4EA 5JPAA 2MD9A 1RNIA 1IMPA 1ACPA 1IMQA 4GR2A 7CEIA 1EIAA 2P9XA 2MY5A 4CA3A 2JYGA 2KW2A 2LPKA 2L9FA 1L0IA 1NJIQ 1N8RQ 2GZJA 1VQPP 1VQ8P 2N50A 1A43A 3CC7P 1VQ9P 2LOLA 2XT1A 3CC4P 3E2DA 1OR5A 3DS3A 2DNWA 5EJDA 1YJNP 2N6YA 1YIJP 2AFDA 2NO8A 3H47A 1YI2P 1X3OA 4QNBA 1QVFO 1K30A 1Z6MA 2PNGA 1E0HA 3CCMP 4PWVB 2CGQA 2PENA 1RO0A 3CC2P 3I55P 1UNKA 2MR7A 2L0QA 1W2BO 2EHTA 1QRJA 4BPHA 3CCLP 3G0VA 2Z45A 2M5RA 3G71P 2LMLA 3CPWO 1YJ9P 2MR8A 5HVCA 4DG9A 2FAEA 4XFZA 2MVVA 3DS5A 4U0CA 1M6NA 5KP6B 2JU2A 2KGDA 1Q82Q 3CCEP 3P05A 4UHPB 2KG8A 5I4TG 5HGNA 5KP7B 2KODA 3CMAP 5F2NA 2JGPA 1VQ5P 1VQOP 1NQ4A 4M0IA 1D1DA 3G26A 4U0AA 1VQ7P 1HY8A 2L4BA 2PEMA 1M1KQ 2KG6A 2JQ4A 1IUQA 2L22A 3M1MA 3DS4A 3Q20A 3RG2A 1A8OA 2L6EA 1BXIA 4QKOA 3G1GA 4GR6A 2QNWA 5HV8A 3NTEA 2GZIA 4R0MA 1KD1Q 1K9MQ 4U0DA 2KGEA 2E1MA 2GZEA 1MZ8A 2FHSC 2PEKA 2JU1A 1GPJA 3HYBA 2LIUA 2XV6A 1T8KA 4XROA 1YITP 2GZGA 2CWOA 4BPGA 2PEOA 2EIAA 3EJEA 2OARA 3DTJA 1ZMBA 3OW2O 3GJNA 2GDXA 1M74A 2FVAA 5F2KA 5BS1A 2M8NA 1AYIA 2JYLA 4H2WC 1Q7YQ 1AUMA 5DCKA 2PY8A 2LIWA 4NEOA 3VRLC 4H2YC 2JAZA 3DS2A 4MRTC 1DV5A 2PEIA 2VLQA 5HGOA 3CCSP 1L0HA 3I56P 4PH1A 2KOPA 2OTLP 3GKLC 4COCA 1EOQA 3G6EP 3G28A 2GZFA 2K0YA 5HGMA 3CD6P 2AFEA 4H2XC 2LF4A 4HKGA 2EFJA 2OTJP 3NY7B 2KOOA 1GXGA 3MGEA 2X2BA 1UJZA 2CG5B 2EHSA 1VQNP 4XRQA 3CCJP 4COPA 2ONTA 3CCUP 4WYMA 3DPHA 3CCQP 5HGLA 1F80D 1VQKP 2AF8A 3CE7A 2FQ2A 2K0DX 2VSQA 2GYKA 2LKIA 3GZMA 3CCVP 3LRYA 1VKUA 2LL8A 1K73Q 1DNYA 2XZ0D 2MF4A 2CQ8A 4U0BA 1VQLP 2BHVA 1M6EX 1VQ4P 2ERHA 1E6JP 2BUOA 3GZLA 2KOSA
chains in the Genus database with same CATH topology
5EW5E 2JB0A 1AYIA 1GXHA 2GZIA 2K0DX 2GZFA 1EMVA 2GYKA 2GZEA 2NO8A 2GZJA 1MZ8A 2VLOA 2JAZA 2VLPA 3U43A 4F37A 2K5XA 1E0HA 1FR2A 2VLQA 3GJNA 1BXIA 4QKOA 1GXGA 1IMPA 1CEIA 1UJZA 1IMQA 7CEIA 1UNKA 2ERHA 1ZNVA 2WPTA 2GZGA 3GKLC 2JBGA 4UHPB 2VLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EW5 E;  2JB0 A;  1AYI A;  1GXH A;  2GZI A;  2K0D X;  2GZF A;  1EMV A;  2GYK A;  2GZE A;  2NO8 A;  2GZJ A;  1MZ8 A;  2VLO A;  2JAZ A;  2VLP A;  3U43 A;  4F37 A;  2K5X A;  1E0H A;  1FR2 A;  2VLQ A;  3GJN A;  1BXI A;  4QKO A;  1GXG A;  1IMP A;  1CEI A;  1UJZ A;  1IMQ A;  7CEI A;  1UNK A;  2ERH A;  1ZNV A;  2WPT A;  2GZG A;  3GKL C;  2JBG A;  4UHP B;  2VLN A; 
#chains in the Genus database with same CATH topology
 2FVE A;  2XZ1 C;  2K0X A;  3WBH A;  2KR5 A;  2MVU A;  1HQB A;  2FVF A;  2EG5 A;  3U43 A;  2PEQ A;  3RG6 C;  2AVA A;  1AF8 A;  5KP8 B;  2KOR A;  2WPT A;  5CZD B;  3EJB A;  1EMV A;  3CXC O;  3HZQ A;  1YHQ P;  3G21 A;  2KGC A;  1KC8 Q;  2VLP A;  2GDW A;  1CEI A;  2LTE A;  2N5I A;  1KLP A;  2Z46 A;  1ZNV A;  1VHN A;  2JBG A;  5EW5 E;  1GXH A;  2FAD A;  2M8P A;  1YJW P;  1VQM P;  2XXM A;  2FQ1 A;  2Z44 A;  4XFY A;  2K5X A;  5F2O A;  3CME P;  3B4Q A;  3H0D A;  2K93 A;  2VLN A;  1M90 Q;  2GDY A;  2CNR A;  1RO2 A;  1Q86 Q;  4PXH B;  4U0F A;  3G29 A;  3G4S P;  2JO0 A;  1BAJ A;  4PH0 A;  1Q81 Q;  4F37 A;  2ROQ A;  2DGY A;  3DS1 A;  2KWL A;  2QEX P;  2KOQ A;  4XFX A;  2JB0 A;  2K2Q A;  2K94 A;  3EJD A;  4BPF A;  5BS2 A;  2K92 A;  2VLO A;  2N5H A;  3CCR P;  2N98 A;  1S72 P;  1FR2 A;  1JJ2 O;  2KGA A;  2FAC A;  4IZ6 A;  3DS0 A;  2QA4 P;  4IPY A;  2FQ0 A;  1KQS O;  2M8L A;  2PEJ A;  1QVG O;  2KG9 A;  4U0E A;  1VQ6 P;  1K8A Q;  3B5I A;  2N6Z A;  3G1I A;  3LMO A;  3H4E A;  5JPA A;  2MD9 A;  1RNI A;  1IMP A;  1ACP A;  1IMQ A;  4GR2 A;  7CEI A;  1EIA A;  2P9X A;  2MY5 A;  4CA3 A;  2JYG A;  2KW2 A;  2LPK A;  2L9F A;  1L0I A;  1NJI Q;  1N8R Q;  2GZJ A;  1VQP P;  1VQ8 P;  2N50 A;  1A43 A;  3CC7 P;  1VQ9 P;  2LOL A;  2XT1 A;  3CC4 P;  3E2D A;  1OR5 A;  3DS3 A;  2DNW A;  5EJD A;  1YJN P;  2N6Y A;  1YIJ P;  2AFD A;  2NO8 A;  3H47 A;  1YI2 P;  1X3O A;  4QNB A;  1QVF O;  1K30 A;  1Z6M A;  2PNG A;  1E0H A;  3CCM P;  4PWV B;  2CGQ A;  2PEN A;  1RO0 A;  3CC2 P;  3I55 P;  1UNK A;  2MR7 A;  2L0Q A;  1W2B O;  2EHT A;  1QRJ A;  4BPH A;  3CCL P;  3G0V A;  2Z45 A;  2M5R A;  3G71 P;  2LML A;  3CPW O;  1YJ9 P;  2MR8 A;  5HVC A;  4DG9 A;  2FAE A;  4XFZ A;  2MVV A;  3DS5 A;  4U0C A;  1M6N A;  5KP6 B;  2JU2 A;  2KGD A;  1Q82 Q;  3CCE P;  3P05 A;  4UHP B;  2KG8 A;  5I4T G;  5HGN A;  5KP7 B;  2KOD A;  3CMA P;  5F2N A;  2JGP A;  1VQ5 P;  1VQO P;  1NQ4 A;  4M0I A;  1D1D A;  3G26 A;  4U0A A;  1VQ7 P;  1HY8 A;  2L4B A;  2PEM A;  1M1K Q;  2KG6 A;  2JQ4 A;  1IUQ A;  2L22 A;  3M1M A;  3DS4 A;  3Q20 A;  3RG2 A;  1A8O A;  2L6E A;  1BXI A;  4QKO A;  3G1G A;  4GR6 A;  2QNW A;  5HV8 A;  3NTE A;  2GZI A;  4R0M A;  1KD1 Q;  1K9M Q;  4U0D A;  2KGE A;  2E1M A;  2GZE A;  1MZ8 A;  2FHS C;  2PEK A;  2JU1 A;  1GPJ A;  3HYB A;  2LIU A;  2XV6 A;  1T8K A;  4XRO A;  1YIT P;  2GZG A;  2CWO A;  4BPG A;  2PEO A;  2EIA A;  3EJE A;  2OAR A;  3DTJ A;  1ZMB A;  3OW2 O;  3GJN A;  2GDX A;  1M74 A;  2FVA A;  5F2K A;  5BS1 A;  2M8N A;  1AYI A;  2JYL A;  4H2W C;  1Q7Y Q;  1AUM A;  5DCK A;  2PY8 A;  2LIW A;  4NEO A;  3VRL C;  4H2Y C;  2JAZ A;  3DS2 A;  4MRT C;  1DV5 A;  2PEI A;  2VLQ A;  5HGO A;  3CCS P;  1L0H A;  3I56 P;  4PH1 A;  2KOP A;  2OTL P;  3GKL C;  4COC A;  1EOQ A;  3G6E P;  3G28 A;  2GZF A;  2K0Y A;  5HGM A;  3CD6 P;  2AFE A;  4H2X C;  2LF4 A;  4HKG A;  2EFJ A;  2OTJ P;  3NY7 B;  2KOO A;  1GXG A;  3MGE A;  2X2B A;  1UJZ A;  2CG5 B;  2EHS A;  1VQN P;  4XRQ A;  3CCJ P;  4COP A;  2ONT A;  3CCU P;  4WYM A;  3DPH A;  3CCQ P;  5HGL A;  1F80 D;  1VQK P;  2AF8 A;  3CE7 A;  2FQ2 A;  2K0D X;  2VSQ A;  2GYK A;  2LKI A;  3GZM A;  3CCV P;  3LRY A;  1VKU A;  2LL8 A;  1K73 Q;  1DNY A;  2XZ0 D;  2MF4 A;  2CQ8 A;  4U0B A;  1VQL P;  2BHV A;  1M6E X;  1VQ4 P;  2ERH A;  1E6J P;  2BUO A;  3GZL A;  2KOS A; 
#chains in the Genus database with same CATH homology
 5EW5 E;  2JB0 A;  1AYI A;  1GXH A;  2GZI A;  2K0D X;  2GZF A;  1EMV A;  2GYK A;  2GZE A;  2NO8 A;  2GZJ A;  1MZ8 A;  2VLO A;  2JAZ A;  2VLP A;  3U43 A;  4F37 A;  2K5X A;  1E0H A;  1FR2 A;  2VLQ A;  3GJN A;  1BXI A;  4QKO A;  1GXG A;  1IMP A;  1CEI A;  1UJZ A;  1IMQ A;  7CEI A;  1UNK A;  2ERH A;  1ZNV A;  2WPT A;  2GZG A;  3GKL C;  2JBG A;  4UHP B;  2VLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...