2NO8A

Nmr structure analysis of the colicin immuntiy protein im2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
ELKHSISDYTEAEFLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Colicin-E2 immunity protein
publication title Structural Models for non Cognate Complexes of the DNase Domain of Colicin E9 and Colicin Immunity Proteins
rcsb
source organism Escherichia coli
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2no8A00
1IMPA 2JBGA 2GZGA 1E0HA 2GYKA 1UNKA 2VLPA 5EW5E 1BXIA 1GXHA 1FR2A 7CEIA 1IMQA 1UJZA 3GJNA 1GXGA 2VLOA 2JB0A 3GKLC 2GZIA 3U43A 2K5XA 4QKOA 2VLQA 2GZEA 4UHPB 2JAZA 1AYIA 2GZFA 2VLNA 2NO8A 1EMVA 1CEIA 2K0DX 2ERHA 1ZNVA 2GZJA 2WPTA 4F37A 1MZ8A
chains in the Genus database with same CATH superfamily
3CCQP 2QNWA 2GZGA 2EG5A 2VLPA 5F2OA 5EJDA 3CE7A 1X3OA 4U0BA 1M6NA 1VQLP 4U0CA 1QRJA 3H0DA 1HQBA 1KQSO 1BAJA 3DS4A 4XROA 3G26A 2LTEA 3LRYA 5HV8A 5HGOA 1YITP 2DNWA 3GJNA 1L0HA 4XFYA 1QVFO 3DPHA 4GR2A 3B5IA 4BPFA 2VLNA 2MY5A 2XZ0D 3CXCO 2KOSA 5DCKA 2FVEA 2AVAA 1YJ9P 2KG9A 2L0QA 4HKGA 1VQ5P 2LOLA 1UNKA 5EW5E 2DGYA 2LKIA 1GXGA 3CCLP 1M1KQ 3NY7B 2PNGA 3G4SP 4PXHB 3CMAP 2N50A 2FVAA 2M5RA 1JJ2O 4U0DA 4COCA 4R0MA 1GXHA 3CCEP 2FACA 2PENA 2VLOA 3CC7P 2K92A 1T8KA 4H2WC 3DS5A 3Q20A 3G28A 2MR7A 1M74A 2PEJA 1YJWP 2AF8A 1M90Q 1ZMBA 1W2BO 1K30A 3CCUP 1GPJA 2X2BA 2FHSC 3P05A 3GZMA 2LIUA 2EHTA 2N5HA 2PEOA 2LF4A 1F80D 3EJBA 2EHSA 4UHPB 2JAZA 4IZ6A 2KORA 1ZNVA 1ACPA 2L22A 2JU2A 4COPA 3RG2A 1HY8A 4BPHA 1K8AQ 2Z45A 1FR2A 1EIAA 5KP6B 2XT1A 2KGEA 1A43A 2JYLA 2MR8A 1EOQA 2LL8A 2KWLA 2FQ2A 3OW2O 5CZDB 1VQ7P 5KP8B 1RNIA 2M8PA 4PH0A 2CGQA 1BXIA 1DNYA 1QVGO 1IMQA 1VQNP 2M8NA 2KOQA 2L4BA 3M1MA 4BPGA 3CMEP 4CA3A 2KW2A 2ERHA 3RG6C 3HZQA 2BUOA 4H2XC 2CWOA 2KODA 2VSQA 2JGPA 2PY8A 1NJIQ 4U0EA 2JB0A 4MRTC 3U43A 3G0VA 5I4TG 1VKUA 1DV5A 5KP7B 4NEOA 2GZFA 3CCJP 4PH1A 1D1DA 2MVUA 3G1GA 1M6EX 1Q86Q 2FVFA 2ROQA 2OTLP 3DS0A 4GR6A 2N5IA 7CEIA 3CD6P 1RO2A 3GKLC 1VQOP 2PEQA 2KG8A 2K5XA 2FADA 2VLQA 1AF8A 1NQ4A 1AYIA 3EJDA 2KGDA 2NO8A 1VQPP 2QEXP 1VQ9P 2GZJA 2LMLA 4F37A 2KR5A 4M0IA 3CCSP 2K2QA 2PEKA 5F2KA 1K9MQ 1VHNA 2M8LA 3I56P 2K94A 4XRQA 2LPKA 1YHQP 2JYGA 1VQKP 2PEIA 2EIAA 3DS3A 2JBGA 5BS1A 2KG6A 1YI2P 3DTJA 5HGLA 1UJZA 4WYMA 2OTJP 2GZIA 2K93A 2K0XA 2L9FA 2JU1A 2FQ1A 4U0FA 4U0AA 1VQ6P 1EMVA 2CNRA 1KC8Q 3G29A 1IUQA 1A8OA 3H47A 2JO0A 1N8RQ 4XFZA 1VQMP 3EJEA 2Z46A 2KGAA 5JPAA 2KOPA 2ONTA 3G71P 2AFDA 3CCVP 3NTEA 3CC2P 2N6YA 1Q81Q 2K0DX 2Z44A 1K73Q 2N98A 1Z6MA 2WPTA 2K0YA 1MZ8A 4H2YC 1E0HA 4XFXA 2N6ZA 1Q7YQ 3HYBA 2CQ8A 2JQ4A 2P9XA 1YJNP 5HGMA 1YIJP 2MD9A 2QA4P 3GZLA 4QNBA 3G1IA 1AUMA 2BHVA 2XZ1C 1E6JP 3DS1A 1OR5A 1Q82Q 2GYKA 2GDYA 3I55P 3CPWO 3VRLC 3CC4P 4QKOA 2GZEA 1L0IA 3MGEA 1KD1Q 2KGCA 2L6EA 3E2DA 1IMPA 4DG9A 3G21A 2GDWA 2FAEA 2EFJA 3DS2A 1KLPA 3CCMP 4IPYA 1CEIA 2GDXA 3B4QA 2CG5B 3CCRP 1RO0A 1S72P 2OARA 2AFEA 3WBHA 2MF4A 2PEMA 2FQ0A 3LMOA 1VQ4P 4PWVB 2E1MA 2XXMA 5BS2A 3G6EP 1VQ8P 5F2NA 2KOOA 2XV6A 5HGNA 5HVCA 2LIWA 2MVVA 3H4EA
chains in the Genus database with same CATH topology
1IMPA 2JBGA 2GZGA 1E0HA 2GYKA 1UNKA 2VLPA 5EW5E 1BXIA 1GXHA 1FR2A 7CEIA 1IMQA 1UJZA 3GJNA 1GXGA 2VLOA 2JB0A 3GKLC 2GZIA 3U43A 2K5XA 4QKOA 2VLQA 2GZEA 4UHPB 2JAZA 1AYIA 2GZFA 2VLNA 2NO8A 1EMVA 1CEIA 2K0DX 2ERHA 1ZNVA 2GZJA 2WPTA 4F37A 1MZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IMP A;  2JBG A;  2GZG A;  1E0H A;  2GYK A;  1UNK A;  2VLP A;  5EW5 E;  1BXI A;  1GXH A;  1FR2 A;  7CEI A;  1IMQ A;  1UJZ A;  3GJN A;  1GXG A;  2VLO A;  2JB0 A;  3GKL C;  2GZI A;  3U43 A;  2K5X A;  4QKO A;  2VLQ A;  2GZE A;  4UHP B;  2JAZ A;  1AYI A;  2GZF A;  2VLN A;  2NO8 A;  1EMV A;  1CEI A;  2K0D X;  2ERH A;  1ZNV A;  2GZJ A;  2WPT A;  4F37 A;  1MZ8 A; 
#chains in the Genus database with same CATH topology
 3CCQ P;  2QNW A;  2GZG A;  2EG5 A;  2VLP A;  5F2O A;  5EJD A;  3CE7 A;  1X3O A;  4U0B A;  1M6N A;  1VQL P;  4U0C A;  1QRJ A;  3H0D A;  1HQB A;  1KQS O;  1BAJ A;  3DS4 A;  4XRO A;  3G26 A;  2LTE A;  3LRY A;  5HV8 A;  5HGO A;  1YIT P;  2DNW A;  3GJN A;  1L0H A;  4XFY A;  1QVF O;  3DPH A;  4GR2 A;  3B5I A;  4BPF A;  2VLN A;  2MY5 A;  2XZ0 D;  3CXC O;  2KOS A;  5DCK A;  2FVE A;  2AVA A;  1YJ9 P;  2KG9 A;  2L0Q A;  4HKG A;  1VQ5 P;  2LOL A;  1UNK A;  5EW5 E;  2DGY A;  2LKI A;  1GXG A;  3CCL P;  1M1K Q;  3NY7 B;  2PNG A;  3G4S P;  4PXH B;  3CMA P;  2N50 A;  2FVA A;  2M5R A;  1JJ2 O;  4U0D A;  4COC A;  4R0M A;  1GXH A;  3CCE P;  2FAC A;  2PEN A;  2VLO A;  3CC7 P;  2K92 A;  1T8K A;  4H2W C;  3DS5 A;  3Q20 A;  3G28 A;  2MR7 A;  1M74 A;  2PEJ A;  1YJW P;  2AF8 A;  1M90 Q;  1ZMB A;  1W2B O;  1K30 A;  3CCU P;  1GPJ A;  2X2B A;  2FHS C;  3P05 A;  3GZM A;  2LIU A;  2EHT A;  2N5H A;  2PEO A;  2LF4 A;  1F80 D;  3EJB A;  2EHS A;  4UHP B;  2JAZ A;  4IZ6 A;  2KOR A;  1ZNV A;  1ACP A;  2L22 A;  2JU2 A;  4COP A;  3RG2 A;  1HY8 A;  4BPH A;  1K8A Q;  2Z45 A;  1FR2 A;  1EIA A;  5KP6 B;  2XT1 A;  2KGE A;  1A43 A;  2JYL A;  2MR8 A;  1EOQ A;  2LL8 A;  2KWL A;  2FQ2 A;  3OW2 O;  5CZD B;  1VQ7 P;  5KP8 B;  1RNI A;  2M8P A;  4PH0 A;  2CGQ A;  1BXI A;  1DNY A;  1QVG O;  1IMQ A;  1VQN P;  2M8N A;  2KOQ A;  2L4B A;  3M1M A;  4BPG A;  3CME P;  4CA3 A;  2KW2 A;  2ERH A;  3RG6 C;  3HZQ A;  2BUO A;  4H2X C;  2CWO A;  2KOD A;  2VSQ A;  2JGP A;  2PY8 A;  1NJI Q;  4U0E A;  2JB0 A;  4MRT C;  3U43 A;  3G0V A;  5I4T G;  1VKU A;  1DV5 A;  5KP7 B;  4NEO A;  2GZF A;  3CCJ P;  4PH1 A;  1D1D A;  2MVU A;  3G1G A;  1M6E X;  1Q86 Q;  2FVF A;  2ROQ A;  2OTL P;  3DS0 A;  4GR6 A;  2N5I A;  7CEI A;  3CD6 P;  1RO2 A;  3GKL C;  1VQO P;  2PEQ A;  2KG8 A;  2K5X A;  2FAD A;  2VLQ A;  1AF8 A;  1NQ4 A;  1AYI A;  3EJD A;  2KGD A;  2NO8 A;  1VQP P;  2QEX P;  1VQ9 P;  2GZJ A;  2LML A;  4F37 A;  2KR5 A;  4M0I A;  3CCS P;  2K2Q A;  2PEK A;  5F2K A;  1K9M Q;  1VHN A;  2M8L A;  3I56 P;  2K94 A;  4XRQ A;  2LPK A;  1YHQ P;  2JYG A;  1VQK P;  2PEI A;  2EIA A;  3DS3 A;  2JBG A;  5BS1 A;  2KG6 A;  1YI2 P;  3DTJ A;  5HGL A;  1UJZ A;  4WYM A;  2OTJ P;  2GZI A;  2K93 A;  2K0X A;  2L9F A;  2JU1 A;  2FQ1 A;  4U0F A;  4U0A A;  1VQ6 P;  1EMV A;  2CNR A;  1KC8 Q;  3G29 A;  1IUQ A;  1A8O A;  3H47 A;  2JO0 A;  1N8R Q;  4XFZ A;  1VQM P;  3EJE A;  2Z46 A;  2KGA A;  5JPA A;  2KOP A;  2ONT A;  3G71 P;  2AFD A;  3CCV P;  3NTE A;  3CC2 P;  2N6Y A;  1Q81 Q;  2K0D X;  2Z44 A;  1K73 Q;  2N98 A;  1Z6M A;  2WPT A;  2K0Y A;  1MZ8 A;  4H2Y C;  1E0H A;  4XFX A;  2N6Z A;  1Q7Y Q;  3HYB A;  2CQ8 A;  2JQ4 A;  2P9X A;  1YJN P;  5HGM A;  1YIJ P;  2MD9 A;  2QA4 P;  3GZL A;  4QNB A;  3G1I A;  1AUM A;  2BHV A;  2XZ1 C;  1E6J P;  3DS1 A;  1OR5 A;  1Q82 Q;  2GYK A;  2GDY A;  3I55 P;  3CPW O;  3VRL C;  3CC4 P;  4QKO A;  2GZE A;  1L0I A;  3MGE A;  1KD1 Q;  2KGC A;  2L6E A;  3E2D A;  1IMP A;  4DG9 A;  3G21 A;  2GDW A;  2FAE A;  2EFJ A;  3DS2 A;  1KLP A;  3CCM P;  4IPY A;  1CEI A;  2GDX A;  3B4Q A;  2CG5 B;  3CCR P;  1RO0 A;  1S72 P;  2OAR A;  2AFE A;  3WBH A;  2MF4 A;  2PEM A;  2FQ0 A;  3LMO A;  1VQ4 P;  4PWV B;  2E1M A;  2XXM A;  5BS2 A;  3G6E P;  1VQ8 P;  5F2N A;  2KOO A;  2XV6 A;  5HGN A;  5HVC A;  2LIW A;  2MVV A;  3H4E A; 
#chains in the Genus database with same CATH homology
 1IMP A;  2JBG A;  2GZG A;  1E0H A;  2GYK A;  1UNK A;  2VLP A;  5EW5 E;  1BXI A;  1GXH A;  1FR2 A;  7CEI A;  1IMQ A;  1UJZ A;  3GJN A;  1GXG A;  2VLO A;  2JB0 A;  3GKL C;  2GZI A;  3U43 A;  2K5X A;  4QKO A;  2VLQ A;  2GZE A;  4UHP B;  2JAZ A;  1AYI A;  2GZF A;  2VLN A;  2NO8 A;  1EMV A;  1CEI A;  2K0D X;  2ERH A;  1ZNV A;  2GZJ A;  2WPT A;  4F37 A;  1MZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...