2NO8A

Nmr structure analysis of the colicin immuntiy protein im2
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
ELKHSISDYTEAEFLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin-E2 immunity protein
publication title Structural Models for non Cognate Complexes of the DNase Domain of Colicin E9 and Colicin Immunity Proteins
rcsb
source organism Escherichia coli
molecule tags Immune system
total genus 25
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2no8A00
1FR2A 1AYIA 2GZJA 4QKOA 3GKLC 2NO8A 2JAZA 2VLOA 2GZGA 2JB0A 1GXGA 1ZNVA 1IMQA 1CEIA 4UHPB 2JBGA 2GYKA 1E0HA 2VLQA 7CEIA 2K5XA 1UJZA 2K0DX 3GJNA 2VLPA 2GZIA 1BXIA 1MZ8A 5EW5E 2VLNA 3U43A 2ERHA 1IMPA 2GZFA 1UNKA 1EMVA 2WPTA 4F37A 1GXHA 2GZEA
chains in the Genus database with same CATH superfamily
1KLPA 2K0YA 4HKGA 2FHSC 4PH0A 1QRJA 2LIUA 4IPYA 2N5HA 3CCEP 1S72P 2ROQA 2Z45A 2KG6A 1W2BO 2KGDA 3H4EA 1D1DA 1EMVA 3CC4P 3HYBA 1K8AQ 1ACPA 5JPAA 1M6NA 3CE7A 5HGNA 1EIAA 3DS3A 4BPFA 2JB0A 2KW2A 2XZ1C 1ZNVA 1JJ2O 1CEIA 3RG6C 1VQ9P 5HGMA 4GR2A 1Q86Q 2CG5B 1A8OA 2EHTA 2QEXP 5I4TG 4XFYA 4QKOA 2CGQA 5HV8A 1Q82Q 1YIJP 2CNRA 5DCKA 2KGCA 2JGPA 3CCLP 2X2BA 3H47A 5EW5E 2LOLA 2KG8A 1UNKA 2DNWA 4R0MA 3CCMP 2FVFA 1KQSO 1IUQA 1FR2A 2L0QA 2GDWA 3I55P 2KR5A 2PEOA 3G28A 3E2DA 3CCVP 2PEQA 2QNWA 2N50A 4U0FA 2CQ8A 5HGLA 1RNIA 2LIWA 3OW2O 4COPA 2JO0A 3GZMA 4F37A 2BUOA 4PWVB 1YJ9P 2KGAA 1F80D 3M1MA 1VQ4P 3GKLC 3DPHA 2FAEA 2PEMA 2N6ZA 1NJIQ 1GPJA 3HZQA 1M90Q 2VSQA 2FACA 2VLNA 3VRLC 4XRQA 4U0CA 2K2QA 3G26A 2GZJA 2JYGA 3CD6P 4PXHB 2K94A 3CCJP 3WBHA 2CWOA 2LKIA 2N98A 3B5IA 4BPGA 2M8NA 2VLPA 2E1MA 2WPTA 2GZEA 1DNYA 4WYMA 3G71P 3P05A 2LL8A 1VQPP 1NQ4A 2GZGA 5KP7B 4U0AA 4H2XC 5F2NA 1VQOP 2K5XA 3G1GA 3G21A 3I56P 2MVUA 1N8RQ 2AFDA 4U0BA 2P9XA 2LMLA 1A43A 4GR6A 5HVCA 2NO8A 4PH1A 1VQMP 2JQ4A 2EFJA 3DS2A 2PY8A 2GYKA 2KODA 1UJZA 2JU2A 2XT1A 3CXCO 1AF8A 1BXIA 1MZ8A 3CCUP 1KC8Q 2MF4A 1QVGO 1RO2A 4QNBA 3B4QA 1RO0A 2K92A 2Z46A 3GZLA 2KWLA 1YJNP 2XZ0D 4IZ6A 5KP6B 3EJEA 3RG2A 1IMQA 5BS2A 4UHPB 3DTJA 4XFXA 1VQLP 4H2WC 2K0XA 3NY7B 3LRYA 2L4BA 2MR7A 1QVFO 3G0VA 2M8PA 2PENA 1AYIA 3EJDA 2FQ2A 1VQ6P 2VLOA 3CC2P 4COCA 3MGEA 2KOOA 3EJBA 1VQ8P 1E0HA 2MY5A 2BHVA 4BPHA 4DG9A 4XFZA 3CCQP 1OR5A 2GDYA 2XV6A 3NTEA 1YITP 2KOSA 1GXHA 2LTEA 4CA3A 1BAJA 2XXMA 3DS4A 1Q7YQ 2FVEA 1GXGA 1Z6MA 2PEKA 1Q81Q 2JBGA 1M74A 2AFEA 2Z44A 1IMPA 2ERHA 2L9FA 2GZFA 5F2KA 4MRTC 1E6JP 2JU1A 3Q20A 1EOQA 2KG9A 1X3OA 3CMEP 2OARA 2EG5A 4U0DA 5CZDB 3U43A 1YI2P 3G29A 2AVAA 4XROA 2MD9A 1HQBA 2MVVA 2OTLP 3CC7P 2K93A 1VHNA 7CEIA 2EHSA 1AUMA 2LF4A 1YHQP 2FQ0A 4H2YC 2OTJP 2L22A 1KD1Q 2LPKA 2KGEA 3CPWO 2PEJA 2AF8A 2FQ1A 2KOPA 2M5RA 2N5IA 3G6EP 1K9MQ 5EJDA 1T8KA 1K30A 2GDXA 2MR8A 5KP8B 4U0EA 1VQ7P 1VKUA 1ZMBA 1L0IA 3CCRP 2FVAA 1VQNP 1HY8A 2PNGA 2QA4P 2L6EA 1M1KQ 3DS5A 2M8LA 3CMAP 2DGYA 1K73Q 1VQKP 1L0HA 2JYLA 3G1IA 2K0DX 2FADA 3LMOA 2EIAA 2ONTA 3H0DA 1VQ5P 2N6YA 1DV5A 1YJWP 2JAZA 5HGOA 5BS1A 5F2OA 2PEIA 3CCSP 2VLQA 3DS1A 3DS0A 2KORA 4M0IA 4NEOA 3GJNA 2GZIA 3G4SP 1M6EX 2KOQA
chains in the Genus database with same CATH topology
1FR2A 1AYIA 2GZJA 4QKOA 3GKLC 2NO8A 2JAZA 2VLOA 2GZGA 2JB0A 1GXGA 1ZNVA 1IMQA 1CEIA 4UHPB 2JBGA 2GYKA 1E0HA 2VLQA 7CEIA 2K5XA 1UJZA 2K0DX 3GJNA 2VLPA 2GZIA 1BXIA 1MZ8A 5EW5E 2VLNA 3U43A 2ERHA 1IMPA 2GZFA 1UNKA 1EMVA 2WPTA 4F37A 1GXHA 2GZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FR2 A;  1AYI A;  2GZJ A;  4QKO A;  3GKL C;  2NO8 A;  2JAZ A;  2VLO A;  2GZG A;  2JB0 A;  1GXG A;  1ZNV A;  1IMQ A;  1CEI A;  4UHP B;  2JBG A;  2GYK A;  1E0H A;  2VLQ A;  7CEI A;  2K5X A;  1UJZ A;  2K0D X;  3GJN A;  2VLP A;  2GZI A;  1BXI A;  1MZ8 A;  5EW5 E;  2VLN A;  3U43 A;  2ERH A;  1IMP A;  2GZF A;  1UNK A;  1EMV A;  2WPT A;  4F37 A;  1GXH A;  2GZE A; 
#chains in the Genus database with same CATH topology
 1KLP A;  2K0Y A;  4HKG A;  2FHS C;  4PH0 A;  1QRJ A;  2LIU A;  4IPY A;  2N5H A;  3CCE P;  1S72 P;  2ROQ A;  2Z45 A;  2KG6 A;  1W2B O;  2KGD A;  3H4E A;  1D1D A;  1EMV A;  3CC4 P;  3HYB A;  1K8A Q;  1ACP A;  5JPA A;  1M6N A;  3CE7 A;  5HGN A;  1EIA A;  3DS3 A;  4BPF A;  2JB0 A;  2KW2 A;  2XZ1 C;  1ZNV A;  1JJ2 O;  1CEI A;  3RG6 C;  1VQ9 P;  5HGM A;  4GR2 A;  1Q86 Q;  2CG5 B;  1A8O A;  2EHT A;  2QEX P;  5I4T G;  4XFY A;  4QKO A;  2CGQ A;  5HV8 A;  1Q82 Q;  1YIJ P;  2CNR A;  5DCK A;  2KGC A;  2JGP A;  3CCL P;  2X2B A;  3H47 A;  5EW5 E;  2LOL A;  2KG8 A;  1UNK A;  2DNW A;  4R0M A;  3CCM P;  2FVF A;  1KQS O;  1IUQ A;  1FR2 A;  2L0Q A;  2GDW A;  3I55 P;  2KR5 A;  2PEO A;  3G28 A;  3E2D A;  3CCV P;  2PEQ A;  2QNW A;  2N50 A;  4U0F A;  2CQ8 A;  5HGL A;  1RNI A;  2LIW A;  3OW2 O;  4COP A;  2JO0 A;  3GZM A;  4F37 A;  2BUO A;  4PWV B;  1YJ9 P;  2KGA A;  1F80 D;  3M1M A;  1VQ4 P;  3GKL C;  3DPH A;  2FAE A;  2PEM A;  2N6Z A;  1NJI Q;  1GPJ A;  3HZQ A;  1M90 Q;  2VSQ A;  2FAC A;  2VLN A;  3VRL C;  4XRQ A;  4U0C A;  2K2Q A;  3G26 A;  2GZJ A;  2JYG A;  3CD6 P;  4PXH B;  2K94 A;  3CCJ P;  3WBH A;  2CWO A;  2LKI A;  2N98 A;  3B5I A;  4BPG A;  2M8N A;  2VLP A;  2E1M A;  2WPT A;  2GZE A;  1DNY A;  4WYM A;  3G71 P;  3P05 A;  2LL8 A;  1VQP P;  1NQ4 A;  2GZG A;  5KP7 B;  4U0A A;  4H2X C;  5F2N A;  1VQO P;  2K5X A;  3G1G A;  3G21 A;  3I56 P;  2MVU A;  1N8R Q;  2AFD A;  4U0B A;  2P9X A;  2LML A;  1A43 A;  4GR6 A;  5HVC A;  2NO8 A;  4PH1 A;  1VQM P;  2JQ4 A;  2EFJ A;  3DS2 A;  2PY8 A;  2GYK A;  2KOD A;  1UJZ A;  2JU2 A;  2XT1 A;  3CXC O;  1AF8 A;  1BXI A;  1MZ8 A;  3CCU P;  1KC8 Q;  2MF4 A;  1QVG O;  1RO2 A;  4QNB A;  3B4Q A;  1RO0 A;  2K92 A;  2Z46 A;  3GZL A;  2KWL A;  1YJN P;  2XZ0 D;  4IZ6 A;  5KP6 B;  3EJE A;  3RG2 A;  1IMQ A;  5BS2 A;  4UHP B;  3DTJ A;  4XFX A;  1VQL P;  4H2W C;  2K0X A;  3NY7 B;  3LRY A;  2L4B A;  2MR7 A;  1QVF O;  3G0V A;  2M8P A;  2PEN A;  1AYI A;  3EJD A;  2FQ2 A;  1VQ6 P;  2VLO A;  3CC2 P;  4COC A;  3MGE A;  2KOO A;  3EJB A;  1VQ8 P;  1E0H A;  2MY5 A;  2BHV A;  4BPH A;  4DG9 A;  4XFZ A;  3CCQ P;  1OR5 A;  2GDY A;  2XV6 A;  3NTE A;  1YIT P;  2KOS A;  1GXH A;  2LTE A;  4CA3 A;  1BAJ A;  2XXM A;  3DS4 A;  1Q7Y Q;  2FVE A;  1GXG A;  1Z6M A;  2PEK A;  1Q81 Q;  2JBG A;  1M74 A;  2AFE A;  2Z44 A;  1IMP A;  2ERH A;  2L9F A;  2GZF A;  5F2K A;  4MRT C;  1E6J P;  2JU1 A;  3Q20 A;  1EOQ A;  2KG9 A;  1X3O A;  3CME P;  2OAR A;  2EG5 A;  4U0D A;  5CZD B;  3U43 A;  1YI2 P;  3G29 A;  2AVA A;  4XRO A;  2MD9 A;  1HQB A;  2MVV A;  2OTL P;  3CC7 P;  2K93 A;  1VHN A;  7CEI A;  2EHS A;  1AUM A;  2LF4 A;  1YHQ P;  2FQ0 A;  4H2Y C;  2OTJ P;  2L22 A;  1KD1 Q;  2LPK A;  2KGE A;  3CPW O;  2PEJ A;  2AF8 A;  2FQ1 A;  2KOP A;  2M5R A;  2N5I A;  3G6E P;  1K9M Q;  5EJD A;  1T8K A;  1K30 A;  2GDX A;  2MR8 A;  5KP8 B;  4U0E A;  1VQ7 P;  1VKU A;  1ZMB A;  1L0I A;  3CCR P;  2FVA A;  1VQN P;  1HY8 A;  2PNG A;  2QA4 P;  2L6E A;  1M1K Q;  3DS5 A;  2M8L A;  3CMA P;  2DGY A;  1K73 Q;  1VQK P;  1L0H A;  2JYL A;  3G1I A;  2K0D X;  2FAD A;  3LMO A;  2EIA A;  2ONT A;  3H0D A;  1VQ5 P;  2N6Y A;  1DV5 A;  1YJW P;  2JAZ A;  5HGO A;  5BS1 A;  5F2O A;  2PEI A;  3CCS P;  2VLQ A;  3DS1 A;  3DS0 A;  2KOR A;  4M0I A;  4NEO A;  3GJN A;  2GZI A;  3G4S P;  1M6E X;  2KOQ A; 
#chains in the Genus database with same CATH homology
 1FR2 A;  1AYI A;  2GZJ A;  4QKO A;  3GKL C;  2NO8 A;  2JAZ A;  2VLO A;  2GZG A;  2JB0 A;  1GXG A;  1ZNV A;  1IMQ A;  1CEI A;  4UHP B;  2JBG A;  2GYK A;  1E0H A;  2VLQ A;  7CEI A;  2K5X A;  1UJZ A;  2K0D X;  3GJN A;  2VLP A;  2GZI A;  1BXI A;  1MZ8 A;  5EW5 E;  2VLN A;  3U43 A;  2ERH A;  1IMP A;  2GZF A;  1UNK A;  1EMV A;  2WPT A;  4F37 A;  1GXH A;  2GZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...