4COCA

Hiv-1 capsid c-terminal domain mutant (y169l)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
b'TSILDIRQGPKEPFRDYVDRFLKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CAPSID PROTEIN P24
publication title Cryo-Electron Microscopy of Tubular Arrays of HIV-1 Gag Resolves Structures Essential for Immature Virus Assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 28
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4cocA00
5JPAA 2XXMA 1EIAA 4WYMA 4COCA 3G28A 2M8PA 4U0CA 2ONTA 1AUMA 1QRJA 2XV6A 1D1DA 2L6EA 4M0IA 4U0DA 3P05A 4PH0A 5I4TG 4XFZA 5HGOA 4U0EA 3DS1A 4XFXA 1BAJA 1A43A 3DTJA 3DS0A 4U0FA 4XRQA 4XFYA 3DPHA 3DS5A 3NTEA 1E6JP 3G29A 4U0AA 4U0BA 2EIAA 2XT1A 2JYLA 3DS3A 3G1IA 5HGNA 2BUOA 2M8NA 1EOQA 3DS2A 3G0VA 3LRYA 4QNBA 3VRLC 1A8OA 3G1GA 4XROA 3H47A 3H4EA 4IPYA 2KODA 5DCKA 2JYGA 5HGMA 2M8LA 4COPA 3DS4A 3G26A 5HGLA 3MGEA 3G21A 4PH1A 2LF4A 2JO0A
chains in the Genus database with same CATH superfamily
2XZ1C 1QRJA 3OW2O 2MVVA 4U0DA 2VLPA 4H2YC 4XFZA 2K94A 1K73Q 1VQ8P 1K8AQ 1M90Q 1YJNP 1BXIA 3CD6P 3EJBA 3DS3A 2FQ0A 2M8NA 2OARA 5HGMA 3CMAP 3MGEA 2K2QA 4COCA 4PXHB 3G28A 2L0QA 2CQ8A 2KOPA 2K92A 5I4TG 1N8RQ 2KW2A 4UHPB 1KD1Q 2JQ4A 2VLOA 2PEIA 3WBHA 5KP8B 3CE7A 1ZMBA 1E6JP 2QNWA 2MD9A 5BS2A 2KODA 2JYGA 2KGEA 2PEKA 2Z46A 2PEOA 3H0DA 2JU2A 1GXGA 1VQNP 2MVUA 2VLQA 1VQKP 1IMQA 2LTEA 2EHSA 2EFJA 2VSQA 2XT1A 2JYLA 2QEXP 2KOQA 1EOQA 5HV8A 5KP7B 3G4SP 3GZMA 1EIAA 4IZ6A 2XV6A 4M0IA 2PENA 3CC4P 2AVAA 4XFXA 3I56P 4XFYA 2MF4A 2JB0A 1K30A 2GZJA 3CCQP 2PEQA 2FACA 2AFEA 3CCMP 5HGLA 2DGYA 2CNRA 2LMLA 1VQMP 2X2BA 3U43A 5BS1A 2N6ZA 1Q81Q 2LIUA 1A43A 3EJEA 2PEJA 1S72P 1MZ8A 5KP6B 1KLPA 3CPWO 4QNBA 1VQ6P 2K0XA 3H4EA 3CC7P 3RG2A 2GZGA 2ONTA 2K5XA 2FQ2A 4BPFA 1Q86Q 1L0IA 3CCEP 2VLNA 1Q7YQ 2PNGA 1GXHA 4U0AA 5HGNA 1VQ4P 1A8OA 3G6EP 3H47A 4IPYA 1VQ5P 2N5HA 3I55P 2KGAA 4MRTC 1CEIA 1UNKA 2GZFA 2KG6A 1VQLP 1M6EX 4GR2A 1Z6MA 3CCLP 1HY8A 2KGDA 5EW5E 4COPA 1VKUA 2K0DX 4DG9A 4WYMA 2M8PA 2Z45A 2OTLP 3CMEP 4NEOA 2LPKA 2OTJP 1AYIA 1E0HA 2FHSC 2LL8A 2JGPA 5F2KA 5CZDB 1RO0A 5HVCA 1VQOP 3EJDA 1HQBA 4U0BA 3M1MA 1VQ7P 1YIJP 7CEIA 3G26A 1L0HA 3G21A 2L6EA 3CC2P 2K0YA 2MY5A 5HGOA 1ACPA 4U0EA 3DS1A 3GKLC 4HKGA 2GDYA 1YI2P 1M1KQ 1RO2A 3G29A 2EIAA 3CCVP 3B4QA 3E2DA 2XZ0D 1VQ9P 1RNIA 2GDXA 2KG8A 1AF8A 4BPGA 2KG9A 2N6YA 1NQ4A 4F37A 1YJ9P 4PWVB 3CCSP 5F2OA 2PY8A 2JBGA 3Q20A 4CA3A 2GZIA 1W2BO 3G1GA 2LIWA 1NJIQ 1T8KA 2L22A 4PH1A 1K9MQ 1IUQA 2KOSA 3G71P 2KR5A 2EG5A 2DNWA 3LMOA 2L9FA 3G0VA 4QKOA 4XROA 5DCKA 2M5RA 2L4BA 1DV5A 4R0MA 2KGCA 1EMVA 2AFDA 2CWOA 2PEMA 3DPHA 1Q82Q 2FADA 3DS5A 1KQSO 2MR7A 4BPHA 1F80D 5JPAA 1QVGO 2QA4P 4PH0A 4GR6A 5EJDA 2N50A 3CCUP 2CGQA 2CG5B 3B5IA 4H2WC 2K93A 2AF8A 2KORA 1FR2A 2FVEA 1QVFO 3DS2A 3VRLC 2GYKA 1M74A 1KC8Q 3DS4A 2FAEA 2MR8A 2P9XA 2XXMA 3GZLA 1VHNA 1DNYA 2FVFA 3GJNA 2LKIA 1OR5A 2BHVA 1BAJA 3DTJA 3DS0A 4U0FA 3RG6C 2WPTA 1X3OA 1GPJA 4H2XC 1JJ2O 1ZNVA 3G1IA 3LRYA 2GZEA 2FVAA 2N5IA 3CCJP 2LOLA 1YHQP 2LF4A 2E1MA 2FQ1A 4U0CA 1D1DA 5F2NA 2JAZA 3P05A 3HZQA 1IMPA 2NO8A 2ROQA 4XRQA 3CCRP 3HYBA 1M6NA 2KWLA 3NTEA 3NY7B 2BUOA 1YJWP 3CXCO 2EHTA 1AUMA 1UJZA 1VQPP 2JU1A 2GDWA 1YITP 2KOOA 2Z44A 2N98A 2ERHA 2M8LA 2JO0A
chains in the Genus database with same CATH topology
5JPAA 2DGYA 1QVGO 1QRJA 1VQMP 3OW2O 2L6EA 4U0DA 2QA4P 4PH0A 3CC2P 5BS1A 4GR6A 4XFZA 5HGOA 4U0EA 3DS1A 3CCUP 1Q81Q 1K73Q 1A43A 2PEJA 3B5IA 1S72P 1VQ8P 1YI2P 1K8AQ 1M1KQ 1M90Q 1RO2A 3G29A 1YJNP 3CD6P 2EIAA 3CCVP 3DS3A 3CPWO 3E2DA 2M8NA 1QVFO 3DS2A 4QNBA 3VRLC 1VQ9P 1RNIA 2OARA 1VQ6P 3H4EA 5HGMA 1M74A 3CMAP 1KC8Q 3CC7P 3DS4A 3MGEA 2P9XA 2XXMA 4COCA 3G28A 2ONTA 1YJ9P 5I4TG 1N8RQ 1KD1Q 1Q86Q 2BHVA 1BAJA 3CCEP 3DTJA 3DS0A 2PEIA 4U0FA 3RG6C 3WBHA 1Q7YQ 3CCSP 5F2OA 2PY8A 1ZMBA 1E6JP 4U0AA 1JJ2O 3Q20A 3G1IA 5HGNA 1VQ4P 3LRYA 1W2BO 1A8OA 3G1GA 3G6EP 5BS2A 3H47A 4IPYA 2KODA 1VQ5P 2JYGA 1NJIQ 2PEKA 3CCJP 2Z46A 1YHQP 2PEOA 2LF4A 4PH1A 3H0DA 2E1MA 3I55P 1K9MQ 4U0CA 1IUQA 3G71P 1VQNP 1D1DA 5F2NA 3P05A 2EG5A 1VQKP 3HZQA 4XRQA 3CCRP 2EFJA 3HYBA 1M6NA 3NTEA 1VQLP 1M6EX 4GR2A 2XT1A 2JYLA 2QEXP 2BUOA 1EOQA 3G0VA 4XROA 3CCLP 5DCKA 4COPA 1YJWP 3CXCO 3G4SP 4WYMA 1EIAA 2M8PA 2Z45A 1AUMA 3CMEP 2OTLP 2XV6A 4M0IA 2PENA 3CC4P 2OTJP 1VQPP 2CWOA 2PEMA 3I56P 4XFXA 4XFYA 5F2KA 3DPHA 1Q82Q 1RO0A 1VQOP 3DS5A 1KQSO 1YITP 4U0BA 1K30A 3CCQP 2PEQA 3M1MA 1VQ7P 2Z44A 1YIJP 3CCMP 3G26A 5HGLA 3G21A 2M8LA 2JO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPA A;  2XXM A;  1EIA A;  4WYM A;  4COC A;  3G28 A;  2M8P A;  4U0C A;  2ONT A;  1AUM A;  1QRJ A;  2XV6 A;  1D1D A;  2L6E A;  4M0I A;  4U0D A;  3P05 A;  4PH0 A;  5I4T G;  4XFZ A;  5HGO A;  4U0E A;  3DS1 A;  4XFX A;  1BAJ A;  1A43 A;  3DTJ A;  3DS0 A;  4U0F A;  4XRQ A;  4XFY A;  3DPH A;  3DS5 A;  3NTE A;  1E6J P;  3G29 A;  4U0A A;  4U0B A;  2EIA A;  2XT1 A;  2JYL A;  3DS3 A;  3G1I A;  5HGN A;  2BUO A;  2M8N A;  1EOQ A;  3DS2 A;  3G0V A;  3LRY A;  4QNB A;  3VRL C;  1A8O A;  3G1G A;  4XRO A;  3H47 A;  3H4E A;  4IPY A;  2KOD A;  5DCK A;  2JYG A;  5HGM A;  2M8L A;  4COP A;  3DS4 A;  3G26 A;  5HGL A;  3MGE A;  3G21 A;  4PH1 A;  2LF4 A;  2JO0 A; 
#chains in the Genus database with same CATH topology
 2XZ1 C;  1QRJ A;  3OW2 O;  2MVV A;  4U0D A;  2VLP A;  4H2Y C;  4XFZ A;  2K94 A;  1K73 Q;  1VQ8 P;  1K8A Q;  1M90 Q;  1YJN P;  1BXI A;  3CD6 P;  3EJB A;  3DS3 A;  2FQ0 A;  2M8N A;  2OAR A;  5HGM A;  3CMA P;  3MGE A;  2K2Q A;  4COC A;  4PXH B;  3G28 A;  2L0Q A;  2CQ8 A;  2KOP A;  2K92 A;  5I4T G;  1N8R Q;  2KW2 A;  4UHP B;  1KD1 Q;  2JQ4 A;  2VLO A;  2PEI A;  3WBH A;  5KP8 B;  3CE7 A;  1ZMB A;  1E6J P;  2QNW A;  2MD9 A;  5BS2 A;  2KOD A;  2JYG A;  2KGE A;  2PEK A;  2Z46 A;  2PEO A;  3H0D A;  2JU2 A;  1GXG A;  1VQN P;  2MVU A;  2VLQ A;  1VQK P;  1IMQ A;  2LTE A;  2EHS A;  2EFJ A;  2VSQ A;  2XT1 A;  2JYL A;  2QEX P;  2KOQ A;  1EOQ A;  5HV8 A;  5KP7 B;  3G4S P;  3GZM A;  1EIA A;  4IZ6 A;  2XV6 A;  4M0I A;  2PEN A;  3CC4 P;  2AVA A;  4XFX A;  3I56 P;  4XFY A;  2MF4 A;  2JB0 A;  1K30 A;  2GZJ A;  3CCQ P;  2PEQ A;  2FAC A;  2AFE A;  3CCM P;  5HGL A;  2DGY A;  2CNR A;  2LML A;  1VQM P;  2X2B A;  3U43 A;  5BS1 A;  2N6Z A;  1Q81 Q;  2LIU A;  1A43 A;  3EJE A;  2PEJ A;  1S72 P;  1MZ8 A;  5KP6 B;  1KLP A;  3CPW O;  4QNB A;  1VQ6 P;  2K0X A;  3H4E A;  3CC7 P;  3RG2 A;  2GZG A;  2ONT A;  2K5X A;  2FQ2 A;  4BPF A;  1Q86 Q;  1L0I A;  3CCE P;  2VLN A;  1Q7Y Q;  2PNG A;  1GXH A;  4U0A A;  5HGN A;  1VQ4 P;  1A8O A;  3G6E P;  3H47 A;  4IPY A;  1VQ5 P;  2N5H A;  3I55 P;  2KGA A;  4MRT C;  1CEI A;  1UNK A;  2GZF A;  2KG6 A;  1VQL P;  1M6E X;  4GR2 A;  1Z6M A;  3CCL P;  1HY8 A;  2KGD A;  5EW5 E;  4COP A;  1VKU A;  2K0D X;  4DG9 A;  4WYM A;  2M8P A;  2Z45 A;  2OTL P;  3CME P;  4NEO A;  2LPK A;  2OTJ P;  1AYI A;  1E0H A;  2FHS C;  2LL8 A;  2JGP A;  5F2K A;  5CZD B;  1RO0 A;  5HVC A;  1VQO P;  3EJD A;  1HQB A;  4U0B A;  3M1M A;  1VQ7 P;  1YIJ P;  7CEI A;  3G26 A;  1L0H A;  3G21 A;  2L6E A;  3CC2 P;  2K0Y A;  2MY5 A;  5HGO A;  1ACP A;  4U0E A;  3DS1 A;  3GKL C;  4HKG A;  2GDY A;  1YI2 P;  1M1K Q;  1RO2 A;  3G29 A;  2EIA A;  3CCV P;  3B4Q A;  3E2D A;  2XZ0 D;  1VQ9 P;  1RNI A;  2GDX A;  2KG8 A;  1AF8 A;  4BPG A;  2KG9 A;  2N6Y A;  1NQ4 A;  4F37 A;  1YJ9 P;  4PWV B;  3CCS P;  5F2O A;  2PY8 A;  2JBG A;  3Q20 A;  4CA3 A;  2GZI A;  1W2B O;  3G1G A;  2LIW A;  1NJI Q;  1T8K A;  2L22 A;  4PH1 A;  1K9M Q;  1IUQ A;  2KOS A;  3G71 P;  2KR5 A;  2EG5 A;  2DNW A;  3LMO A;  2L9F A;  3G0V A;  4QKO A;  4XRO A;  5DCK A;  2M5R A;  2L4B A;  1DV5 A;  4R0M A;  2KGC A;  1EMV A;  2AFD A;  2CWO A;  2PEM A;  3DPH A;  1Q82 Q;  2FAD A;  3DS5 A;  1KQS O;  2MR7 A;  4BPH A;  1F80 D;  5JPA A;  1QVG O;  2QA4 P;  4PH0 A;  4GR6 A;  5EJD A;  2N50 A;  3CCU P;  2CGQ A;  2CG5 B;  3B5I A;  4H2W C;  2K93 A;  2AF8 A;  2KOR A;  1FR2 A;  2FVE A;  1QVF O;  3DS2 A;  3VRL C;  2GYK A;  1M74 A;  1KC8 Q;  3DS4 A;  2FAE A;  2MR8 A;  2P9X A;  2XXM A;  3GZL A;  1VHN A;  1DNY A;  2FVF A;  3GJN A;  2LKI A;  1OR5 A;  2BHV A;  1BAJ A;  3DTJ A;  3DS0 A;  4U0F A;  3RG6 C;  2WPT A;  1X3O A;  1GPJ A;  4H2X C;  1JJ2 O;  1ZNV A;  3G1I A;  3LRY A;  2GZE A;  2FVA A;  2N5I A;  3CCJ P;  2LOL A;  1YHQ P;  2LF4 A;  2E1M A;  2FQ1 A;  4U0C A;  1D1D A;  5F2N A;  2JAZ A;  3P05 A;  3HZQ A;  1IMP A;  2NO8 A;  2ROQ A;  4XRQ A;  3CCR P;  3HYB A;  1M6N A;  2KWL A;  3NTE A;  3NY7 B;  2BUO A;  1YJW P;  3CXC O;  2EHT A;  1AUM A;  1UJZ A;  1VQP P;  2JU1 A;  2GDW A;  1YIT P;  2KOO A;  2Z44 A;  2N98 A;  2ERH A;  2M8L A;  2JO0 A; 
#chains in the Genus database with same CATH homology
 5JPA A;  2DGY A;  1QVG O;  1QRJ A;  1VQM P;  3OW2 O;  2L6E A;  4U0D A;  2QA4 P;  4PH0 A;  3CC2 P;  5BS1 A;  4GR6 A;  4XFZ A;  5HGO A;  4U0E A;  3DS1 A;  3CCU P;  1Q81 Q;  1K73 Q;  1A43 A;  2PEJ A;  3B5I A;  1S72 P;  1VQ8 P;  1YI2 P;  1K8A Q;  1M1K Q;  1M90 Q;  1RO2 A;  3G29 A;  1YJN P;  3CD6 P;  2EIA A;  3CCV P;  3DS3 A;  3CPW O;  3E2D A;  2M8N A;  1QVF O;  3DS2 A;  4QNB A;  3VRL C;  1VQ9 P;  1RNI A;  2OAR A;  1VQ6 P;  3H4E A;  5HGM A;  1M74 A;  3CMA P;  1KC8 Q;  3CC7 P;  3DS4 A;  3MGE A;  2P9X A;  2XXM A;  4COC A;  3G28 A;  2ONT A;  1YJ9 P;  5I4T G;  1N8R Q;  1KD1 Q;  1Q86 Q;  2BHV A;  1BAJ A;  3CCE P;  3DTJ A;  3DS0 A;  2PEI A;  4U0F A;  3RG6 C;  3WBH A;  1Q7Y Q;  3CCS P;  5F2O A;  2PY8 A;  1ZMB A;  1E6J P;  4U0A A;  1JJ2 O;  3Q20 A;  3G1I A;  5HGN A;  1VQ4 P;  3LRY A;  1W2B O;  1A8O A;  3G1G A;  3G6E P;  5BS2 A;  3H47 A;  4IPY A;  2KOD A;  1VQ5 P;  2JYG A;  1NJI Q;  2PEK A;  3CCJ P;  2Z46 A;  1YHQ P;  2PEO A;  2LF4 A;  4PH1 A;  3H0D A;  2E1M A;  3I55 P;  1K9M Q;  4U0C A;  1IUQ A;  3G71 P;  1VQN P;  1D1D A;  5F2N A;  3P05 A;  2EG5 A;  1VQK P;  3HZQ A;  4XRQ A;  3CCR P;  2EFJ A;  3HYB A;  1M6N A;  3NTE A;  1VQL P;  1M6E X;  4GR2 A;  2XT1 A;  2JYL A;  2QEX P;  2BUO A;  1EOQ A;  3G0V A;  4XRO A;  3CCL P;  5DCK A;  4COP A;  1YJW P;  3CXC O;  3G4S P;  4WYM A;  1EIA A;  2M8P A;  2Z45 A;  1AUM A;  3CME P;  2OTL P;  2XV6 A;  4M0I A;  2PEN A;  3CC4 P;  2OTJ P;  1VQP P;  2CWO A;  2PEM A;  3I56 P;  4XFX A;  4XFY A;  5F2K A;  3DPH A;  1Q82 Q;  1RO0 A;  1VQO P;  3DS5 A;  1KQS O;  1YIT P;  4U0B A;  1K30 A;  3CCQ P;  2PEQ A;  3M1M A;  1VQ7 P;  2Z44 A;  1YIJ P;  3CCM P;  3G26 A;  5HGL A;  3G21 A;  2M8L A;  2JO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...