4COCA

Hiv-1 capsid c-terminal domain mutant (y169l)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
TSILDIRQGPKEPFRDYVDRFLKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords CAPSID PROTEIN P24
publication title Cryo-Electron Microscopy of Tubular Arrays of HIV-1 Gag Resolves Structures Essential for Immature Virus Assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 28
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4cocA00
1E6JP 3G21A 3DS0A 4COCA 3G28A 3H4EA 2JYLA 5HGOA 3NTEA 4U0BA 4XFYA 5HGMA 3VRLC 4IPYA 3G0VA 3G29A 2M8NA 5HGNA 2LF4A 2XT1A 5I4TG 1A8OA 1D1DA 2M8PA 3MGEA 4QNBA 2JO0A 4U0FA 4U0CA 4XRQA 4XROA 3H47A 4COPA 5DCKA 1AUMA 3G1IA 4WYMA 4XFXA 4PH0A 1EOQA 2ONTA 3P05A 4U0AA 2JYGA 3G1GA 2XV6A 4U0EA 1EIAA 1BAJA 2EIAA 4M0IA 4PH1A 5JPAA 2L6EA 4XFZA 2XXMA 5HGLA 3DS3A 2M8LA 3DS2A 4U0DA 3DS1A 3DPHA 3DS4A 3G26A 1A43A 3DS5A 2KODA 1QRJA 3DTJA 2BUOA 3LRYA
chains in the Genus database with same CATH superfamily
3G28A 2LTEA 2JGPA 1GPJA 4BPHA 3MGEA 1BXIA 2GYKA 3CC7P 3EJDA 3WBHA 2LIWA 3DS3A 2NO8A 3LMOA 2LKIA 2LMLA 2MVVA 2VLNA 3DS0A 1OR5A 3G4SP 3U43A 3Q20A 3B4QA 1RNIA 2BHVA 2FVEA 2JU2A 1GXHA 3DS4A 2N50A 2L0QA 2L6EA 2GZJA 4BPGA 1W2BO 1S72P 2FQ2A 5HV8A 2FAEA 2P9XA 1ZMBA 3G1GA 1K73Q 1EIAA 1VHNA 2KOSA 2KG8A 2JBGA 2GZIA 2K94A 2Z46A 2PEMA 3HZQA 3G26A 2LOLA 3I55P 2KODA 2K93A 2XZ0D 1Q7YQ 3B5IA 3CCSP 1VQOP 1VQ8P 2PEIA 2CWOA 2FQ0A 3GJNA 4PH0A 2ONTA 2JYGA 5F2OA 1BAJA 2ROQA 1K9MQ 2OTLP 1T8KA 3CCMP 2QNWA 1YJWP 5F2NA 2GZGA 4CA3A 2KOQA 3CD6P 2EHSA 3E2DA 4U0CA 2PEKA 2MR7A 1DV5A 3P05A 1Q82Q 4M0IA 2N6ZA 2WPTA 3GZMA 1E0HA 4PXHB 1Q86Q 1AF8A 1E6JP 2K2QA 2DNWA 2CG5B 4PWVB 1A8OA 2ERHA 4H2WC 1NQ4A 4R0MA 2M5RA 2MD9A 1HY8A 1M90Q 2MR8A 2KOPA 4QKOA 1QRJA 3DTJA 3OW2O 5CZDB 1L0HA 3H4EA 1VQ7P 2PNGA 3GZLA 2M8NA 2Z44A 2JO0A 2KR5A 3EJBA 1K8AQ 2KG6A 2EHTA 2L4BA 1EOQA 4U0AA 2AFDA 3NY7B 2K0YA 4PH1A 3I56P 4H2YC 1VQLP 2FQ1A 4NEOA 5EW5E 2EG5A 5F2KA 1VQMP 2GZEA 3NTEA 5HGMA 1VKUA 4IPYA 1UNKA 2E1MA 4UHPB 1VQ9P 3HYBA 2L9FA 1M6NA 3DS1A 1A43A 3CCJP 1F80D 3H0DA 2PY8A 2KORA 2JQ4A 1QVFO 4XFYA 1UJZA 2VLPA 2XT1A 2KGAA 4COPA 1AUMA 2LIUA 3CCEP 4XFXA 3CCQP 1ZNVA 2M8LA 1M1KQ 2JB0A 4U0DA 2KGDA 3DS5A 2GDWA 1L0IA 3RG6C 1Z6MA 1VQKP 5HGOA 1Q81Q 1GXGA 2MF4A 4QNBA 2FADA 4MRTC 5EJDA 1ACPA 1M74A 1RO0A 2KGEA 1KQSO 5HGLA 1VQPP 1YI2P 1YITP 5KP8B 1DNYA 3CMEP 1AYIA 3G6EP 1VQ4P 2VLOA 1HQBA 4U0BA 1IUQA 1KC8Q 1VQNP 4BPFA 1CEIA 1IMPA 2AVAA 3M1MA 4IZ6A 4U0EA 2XV6A 2AF8A 2XZ1C 3CMAP 2FVAA 5JPAA 3EJEA 1JJ2O 2L22A 3LRYA 3G21A 1KD1Q 3VRLC 2PEOA 3G29A 2LF4A 3CPWO 1IMQA 3H47A 2GDYA 1YIJP 2N98A 5BS2A 3CE7A 4HKGA 3RG2A 2CGQA 2KW2A 1X3OA 2XXMA 2N6YA 1RO2A 5KP6B 5HVCA 2JYLA 2KWLA 3CXCO 5BS1A 3CCRP 3G0VA 2GZFA 2K0XA 4GR2A 2MVUA 4WYMA 7CEIA 2VLQA 4XFZA 1VQ5P 1N8RQ 3DS2A 2DGYA 3CCVP 1FR2A 2KOOA 2QA4P 3CC4P 1VQ6P 1M6EX 2KG9A 1YHQP 5DCKA 2CNRA 2VSQA 1MZ8A 2CQ8A 2PEQA 2LL8A 1YJNP 1NJIQ 2FHSC 2EFJA 2FVFA 3CCUP 2PEJA 4F37A 2Z45A 2PENA 2GDXA 2QEXP 1EMVA 4COCA 2JU1A 3CC2P 5I4TG 2K92A 1D1DA 1YJ9P 2N5IA 2JAZA 3G1IA 1QVGO 3CCLP 2K5XA 2K0DX 5HGNA 2N5HA 2X2BA 2M8PA 4U0FA 4XRQA 4XROA 4H2XC 2AFEA 4GR6A 1KLPA 3G71P 2KGCA 3GKLC 4DG9A 2MY5A 2EIAA 2FACA 1K30A 2OARA 2OTJP 2LPKA 3DPHA 5KP7B 2BUOA
chains in the Genus database with same CATH topology
3H0DA 2PY8A 3CCMP 3G28A 5F2NA 2JYLA 1YJWP 3CXCO 1QVFO 4XFYA 5BS1A 3CCRP 3G0VA 3CD6P 2XT1A 3E2DA 4GR2A 3MGEA 4U0CA 4COPA 1AUMA 3CCEP 2PEKA 4WYMA 4XFXA 3P05A 3CC7P 3WBHA 1Q82Q 4M0IA 3CCQP 4XFZA 2M8LA 1VQ5P 3DS3A 1N8RQ 1M1KQ 3DS2A 4U0DA 2DGYA 3CCVP 3DS5A 1Q86Q 1E6JP 3RG6C 3DS0A 1VQKP 5HGOA 2QA4P 3CC4P 3G4SP 1Q81Q 1VQ6P 1M6EX 1A8OA 4QNBA 3Q20A 1YHQP 5DCKA 1M74A 1RO0A 1RNIA 2PEQA 1KQSO 2BHVA 1YJNP 1NJIQ 1M90Q 2EFJA 3CCUP 5HGLA 2PEJA 1VQPP 1YI2P 1YITP 3DS4A 2Z45A 2L6EA 1QRJA 3DTJA 2PENA 3OW2O 3CMEP 2QEXP 3G6EP 1VQ4P 4COCA 3H4EA 1VQ7P 4U0BA 3CC2P 1IUQA 1KC8Q 1VQNP 5I4TG 2M8NA 1W2BO 2Z44A 1D1DA 1S72P 2JO0A 1YJ9P 1K8AQ 3M1MA 3G1IA 2P9XA 1EOQA 4U0AA 1ZMBA 3G1GA 2XV6A 4U0EA 1K73Q 1EIAA 1QVGO 3CMAP 3CCLP 4PH1A 3I56P 2Z46A 5JPAA 2PEMA 3HZQA 1VQLP 3G26A 1JJ2O 2EG5A 5F2KA 3I55P 2KODA 3LRYA 1VQMP 3G21A 1KD1Q 3NTEA 1Q7YQ 3B5IA 5HGMA 3VRLC 3CCSP 2PEOA 1VQOP 4IPYA 5HGNA 3G29A 1VQ8P 2LF4A 2E1MA 2PEIA 3CPWO 2M8PA 4U0FA 4XRQA 4XROA 3H47A 2CWOA 1YIJP 5BS2A 4GR6A 4PH0A 2ONTA 2JYGA 3G71P 1VQ9P 5F2OA 1BAJA 2EIAA 3HYBA 2XXMA 1M6NA 1K30A 2OARA 2OTJP 3DS1A 1K9MQ 3DPHA 1RO2A 1A43A 2OTLP 3CCJP 2BUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6J P;  3G21 A;  3DS0 A;  4COC A;  3G28 A;  3H4E A;  2JYL A;  5HGO A;  3NTE A;  4U0B A;  4XFY A;  5HGM A;  3VRL C;  4IPY A;  3G0V A;  3G29 A;  2M8N A;  5HGN A;  2LF4 A;  2XT1 A;  5I4T G;  1A8O A;  1D1D A;  2M8P A;  3MGE A;  4QNB A;  2JO0 A;  4U0F A;  4U0C A;  4XRQ A;  4XRO A;  3H47 A;  4COP A;  5DCK A;  1AUM A;  3G1I A;  4WYM A;  4XFX A;  4PH0 A;  1EOQ A;  2ONT A;  3P05 A;  4U0A A;  2JYG A;  3G1G A;  2XV6 A;  4U0E A;  1EIA A;  1BAJ A;  2EIA A;  4M0I A;  4PH1 A;  5JPA A;  2L6E A;  4XFZ A;  2XXM A;  5HGL A;  3DS3 A;  2M8L A;  3DS2 A;  4U0D A;  3DS1 A;  3DPH A;  3DS4 A;  3G26 A;  1A43 A;  3DS5 A;  2KOD A;  1QRJ A;  3DTJ A;  2BUO A;  3LRY A; 
#chains in the Genus database with same CATH topology
 3G28 A;  2LTE A;  2JGP A;  1GPJ A;  4BPH A;  3MGE A;  1BXI A;  2GYK A;  3CC7 P;  3EJD A;  3WBH A;  2LIW A;  3DS3 A;  2NO8 A;  3LMO A;  2LKI A;  2LML A;  2MVV A;  2VLN A;  3DS0 A;  1OR5 A;  3G4S P;  3U43 A;  3Q20 A;  3B4Q A;  1RNI A;  2BHV A;  2FVE A;  2JU2 A;  1GXH A;  3DS4 A;  2N50 A;  2L0Q A;  2L6E A;  2GZJ A;  4BPG A;  1W2B O;  1S72 P;  2FQ2 A;  5HV8 A;  2FAE A;  2P9X A;  1ZMB A;  3G1G A;  1K73 Q;  1EIA A;  1VHN A;  2KOS A;  2KG8 A;  2JBG A;  2GZI A;  2K94 A;  2Z46 A;  2PEM A;  3HZQ A;  3G26 A;  2LOL A;  3I55 P;  2KOD A;  2K93 A;  2XZ0 D;  1Q7Y Q;  3B5I A;  3CCS P;  1VQO P;  1VQ8 P;  2PEI A;  2CWO A;  2FQ0 A;  3GJN A;  4PH0 A;  2ONT A;  2JYG A;  5F2O A;  1BAJ A;  2ROQ A;  1K9M Q;  2OTL P;  1T8K A;  3CCM P;  2QNW A;  1YJW P;  5F2N A;  2GZG A;  4CA3 A;  2KOQ A;  3CD6 P;  2EHS A;  3E2D A;  4U0C A;  2PEK A;  2MR7 A;  1DV5 A;  3P05 A;  1Q82 Q;  4M0I A;  2N6Z A;  2WPT A;  3GZM A;  1E0H A;  4PXH B;  1Q86 Q;  1AF8 A;  1E6J P;  2K2Q A;  2DNW A;  2CG5 B;  4PWV B;  1A8O A;  2ERH A;  4H2W C;  1NQ4 A;  4R0M A;  2M5R A;  2MD9 A;  1HY8 A;  1M90 Q;  2MR8 A;  2KOP A;  4QKO A;  1QRJ A;  3DTJ A;  3OW2 O;  5CZD B;  1L0H A;  3H4E A;  1VQ7 P;  2PNG A;  3GZL A;  2M8N A;  2Z44 A;  2JO0 A;  2KR5 A;  3EJB A;  1K8A Q;  2KG6 A;  2EHT A;  2L4B A;  1EOQ A;  4U0A A;  2AFD A;  3NY7 B;  2K0Y A;  4PH1 A;  3I56 P;  4H2Y C;  1VQL P;  2FQ1 A;  4NEO A;  5EW5 E;  2EG5 A;  5F2K A;  1VQM P;  2GZE A;  3NTE A;  5HGM A;  1VKU A;  4IPY A;  1UNK A;  2E1M A;  4UHP B;  1VQ9 P;  3HYB A;  2L9F A;  1M6N A;  3DS1 A;  1A43 A;  3CCJ P;  1F80 D;  3H0D A;  2PY8 A;  2KOR A;  2JQ4 A;  1QVF O;  4XFY A;  1UJZ A;  2VLP A;  2XT1 A;  2KGA A;  4COP A;  1AUM A;  2LIU A;  3CCE P;  4XFX A;  3CCQ P;  1ZNV A;  2M8L A;  1M1K Q;  2JB0 A;  4U0D A;  2KGD A;  3DS5 A;  2GDW A;  1L0I A;  3RG6 C;  1Z6M A;  1VQK P;  5HGO A;  1Q81 Q;  1GXG A;  2MF4 A;  4QNB A;  2FAD A;  4MRT C;  5EJD A;  1ACP A;  1M74 A;  1RO0 A;  2KGE A;  1KQS O;  5HGL A;  1VQP P;  1YI2 P;  1YIT P;  5KP8 B;  1DNY A;  3CME P;  1AYI A;  3G6E P;  1VQ4 P;  2VLO A;  1HQB A;  4U0B A;  1IUQ A;  1KC8 Q;  1VQN P;  4BPF A;  1CEI A;  1IMP A;  2AVA A;  3M1M A;  4IZ6 A;  4U0E A;  2XV6 A;  2AF8 A;  2XZ1 C;  3CMA P;  2FVA A;  5JPA A;  3EJE A;  1JJ2 O;  2L22 A;  3LRY A;  3G21 A;  1KD1 Q;  3VRL C;  2PEO A;  3G29 A;  2LF4 A;  3CPW O;  1IMQ A;  3H47 A;  2GDY A;  1YIJ P;  2N98 A;  5BS2 A;  3CE7 A;  4HKG A;  3RG2 A;  2CGQ A;  2KW2 A;  1X3O A;  2XXM A;  2N6Y A;  1RO2 A;  5KP6 B;  5HVC A;  2JYL A;  2KWL A;  3CXC O;  5BS1 A;  3CCR P;  3G0V A;  2GZF A;  2K0X A;  4GR2 A;  2MVU A;  4WYM A;  7CEI A;  2VLQ A;  4XFZ A;  1VQ5 P;  1N8R Q;  3DS2 A;  2DGY A;  3CCV P;  1FR2 A;  2KOO A;  2QA4 P;  3CC4 P;  1VQ6 P;  1M6E X;  2KG9 A;  1YHQ P;  5DCK A;  2CNR A;  2VSQ A;  1MZ8 A;  2CQ8 A;  2PEQ A;  2LL8 A;  1YJN P;  1NJI Q;  2FHS C;  2EFJ A;  2FVF A;  3CCU P;  2PEJ A;  4F37 A;  2Z45 A;  2PEN A;  2GDX A;  2QEX P;  1EMV A;  4COC A;  2JU1 A;  3CC2 P;  5I4T G;  2K92 A;  1D1D A;  1YJ9 P;  2N5I A;  2JAZ A;  3G1I A;  1QVG O;  3CCL P;  2K5X A;  2K0D X;  5HGN A;  2N5H A;  2X2B A;  2M8P A;  4U0F A;  4XRQ A;  4XRO A;  4H2X C;  2AFE A;  4GR6 A;  1KLP A;  3G71 P;  2KGC A;  3GKL C;  4DG9 A;  2MY5 A;  2EIA A;  2FAC A;  1K30 A;  2OAR A;  2OTJ P;  2LPK A;  3DPH A;  5KP7 B;  2BUO A; 
#chains in the Genus database with same CATH homology
 3H0D A;  2PY8 A;  3CCM P;  3G28 A;  5F2N A;  2JYL A;  1YJW P;  3CXC O;  1QVF O;  4XFY A;  5BS1 A;  3CCR P;  3G0V A;  3CD6 P;  2XT1 A;  3E2D A;  4GR2 A;  3MGE A;  4U0C A;  4COP A;  1AUM A;  3CCE P;  2PEK A;  4WYM A;  4XFX A;  3P05 A;  3CC7 P;  3WBH A;  1Q82 Q;  4M0I A;  3CCQ P;  4XFZ A;  2M8L A;  1VQ5 P;  3DS3 A;  1N8R Q;  1M1K Q;  3DS2 A;  4U0D A;  2DGY A;  3CCV P;  3DS5 A;  1Q86 Q;  1E6J P;  3RG6 C;  3DS0 A;  1VQK P;  5HGO A;  2QA4 P;  3CC4 P;  3G4S P;  1Q81 Q;  1VQ6 P;  1M6E X;  1A8O A;  4QNB A;  3Q20 A;  1YHQ P;  5DCK A;  1M74 A;  1RO0 A;  1RNI A;  2PEQ A;  1KQS O;  2BHV A;  1YJN P;  1NJI Q;  1M90 Q;  2EFJ A;  3CCU P;  5HGL A;  2PEJ A;  1VQP P;  1YI2 P;  1YIT P;  3DS4 A;  2Z45 A;  2L6E A;  1QRJ A;  3DTJ A;  2PEN A;  3OW2 O;  3CME P;  2QEX P;  3G6E P;  1VQ4 P;  4COC A;  3H4E A;  1VQ7 P;  4U0B A;  3CC2 P;  1IUQ A;  1KC8 Q;  1VQN P;  5I4T G;  2M8N A;  1W2B O;  2Z44 A;  1D1D A;  1S72 P;  2JO0 A;  1YJ9 P;  1K8A Q;  3M1M A;  3G1I A;  2P9X A;  1EOQ A;  4U0A A;  1ZMB A;  3G1G A;  2XV6 A;  4U0E A;  1K73 Q;  1EIA A;  1QVG O;  3CMA P;  3CCL P;  4PH1 A;  3I56 P;  2Z46 A;  5JPA A;  2PEM A;  3HZQ A;  1VQL P;  3G26 A;  1JJ2 O;  2EG5 A;  5F2K A;  3I55 P;  2KOD A;  3LRY A;  1VQM P;  3G21 A;  1KD1 Q;  3NTE A;  1Q7Y Q;  3B5I A;  5HGM A;  3VRL C;  3CCS P;  2PEO A;  1VQO P;  4IPY A;  5HGN A;  3G29 A;  1VQ8 P;  2LF4 A;  2E1M A;  2PEI A;  3CPW O;  2M8P A;  4U0F A;  4XRQ A;  4XRO A;  3H47 A;  2CWO A;  1YIJ P;  5BS2 A;  4GR6 A;  4PH0 A;  2ONT A;  2JYG A;  3G71 P;  1VQ9 P;  5F2O A;  1BAJ A;  2EIA A;  3HYB A;  2XXM A;  1M6N A;  1K30 A;  2OAR A;  2OTJ P;  3DS1 A;  1K9M Q;  3DPH A;  1RO2 A;  1A43 A;  2OTL P;  3CCJ P;  2BUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...