4COCA

Hiv-1 capsid c-terminal domain mutant (y169l)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
TSILDIRQGPKEPFRDYVDRFLKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-Electron Microscopy of Tubular Arrays of HIV-1 Gag Resolves Structures Essential for Immature Virus Assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords CAPSID PROTEIN P24
total genus 28
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4cocA00
3LRYA 4WYMA 3DS5A 3G29A 4U0DA 4XFYA 4COCA 1QRJA 2XXMA 2JYLA 3DTJA 4XFZA 3P05A 3DS2A 3DS4A 3H47A 4IPYA 4XFXA 4XROA 4M0IA 3G1IA 2L6EA 3H4EA 2ONTA 4U0EA 5HGNA 5HGMA 3G26A 3MGEA 5I4TG 2XT1A 4COPA 5HGOA 5JPAA 3DS3A 1EIAA 4U0BA 5DCKA 2M8PA 3DPHA 4QNBA 2XV6A 4U0FA 1E6JP 2BUOA 1EOQA 3G0VA 2LF4A 3VRLC 4PH0A 1D1DA 1A43A 3DS0A 1AUMA 4U0AA 3DS1A 4XRQA 2JO0A 4PH1A 3G28A 1A8OA 3G1GA 2JYGA 3G21A 3NTEA 4U0CA 5HGLA 1BAJA 2KODA 2M8NA 2M8LA 2EIAA
chains in the Genus database with same CATH superfamily
1QVGO 5KP8B 1Z6MA 1K9MQ 1VQ7P 4QKOA 4F37A 2N5IA 1Q81Q 3H4EA 2XZ1C 4BPHA 5JPAA 7CEIA 5HVCA 2KOPA 2BUOA 2KOOA 2KOSA 2X2BA 2KODA 2M8NA 2GZEA 3LRYA 3G71P 5BS1A 1GPJA 1ACPA 1IMQA 1VQ6P 1K30A 2KWLA 1N8RQ 3CCJP 2MD9A 2L22A 5I4TG 3RG6C 5HV8A 1EIAA 2EFJA 1A43A 2WPTA 2LPKA 2OARA 3CPWO 5EJDA 1VQ4P 2LIUA 4GR6A 3Q20A 1UNKA 2AF8A 2LOLA 1IMPA 1QRJA 2K0YA 2NO8A 3DS2A 1E0HA 5HGMA 1DV5A 2LL8A 1AF8A 2KGDA 2KOQA 2XZ0D 2FQ0A 2KW2A 2VLNA 2JO0A 2GDWA 1ZNVA 1JJ2O 1NQ4A 5EW5E 3GJNA 4H2WC 2MR7A 3CMAP 2MR8A 4BPGA 3G29A 4U0DA 1VQ9P 1YI2P 2QEXP 1GXGA 3P05A 2AFDA 1YJWP 1KQSO 2JB0A 2AVAA 2FVAA 1RO2A 3G26A 4MRTC 2GYKA 4HKGA 3G0VA 3CCLP 3G28A 3NTEA 2JU1A 2MVUA 3RG2A 3DS5A 3LMOA 2N6ZA 1YIJP 2PEOA 3CC7P 2KG9A 4PXHB 1M90Q 5HGOA 2PEKA 3DPHA 3CE7A 1QVFO 1E6JP 1Q7YQ 1VHNA 1F80D 2AFEA 2JGPA 2FADA 2K0XA 2L6EA 3MGEA 1K8AQ 4COPA 1VQ5P 2K0DX 4U0AA 3GKLC 1A8OA 4U0CA 5HGLA 1CEIA 3CC4P 2JYLA 2FQ1A 2GDXA 1IUQA 2JAZA 2Z44A 4U0EA 2LIWA 2PEIA 2CNRA 2EHTA 2JBGA 2OTJP 2CQ8A 1S72P 1M1KQ 3G21A 3G6EP 1VKUA 3CCEP 1KD1Q 4DG9A 2M8LA 2N50A 2N6YA 2M5RA 4PWVB 3CCMP 3DTJA 3EJEA 2PNGA 4XROA 2KGEA 1GXHA 2FAEA 1FR2A 4U0FA 3I55P 1EOQA 1VQKP 2DNWA 2PY8A 1RNIA 5F2OA 5BS2A 2PEJA 4XFYA 3H47A 4XFXA 2KR5A 1KC8Q 1VQLP 4UHPB 3I56P 2VLPA 2EG5A 2E1MA 2PEMA 2LKIA 2M8PA 2K93A 4H2YC 3DS1A 1EMVA 3G1GA 1DNYA 5F2KA 4WYMA 1KLPA 4GR2A 1AYIA 2LTEA 2MY5A 1M74A 2QA4P 2VSQA 3CXCO 4CA3A 4BPFA 4U0BA 2K2QA 2MF4A 1MZ8A 2DGYA 2P9XA 2PENA 4NEOA 3CCQP 3CC2P 3HZQA 1ZMBA 2FACA 3EJBA 3GZLA 2L9FA 2LMLA 4XFZA 2ERHA 1VQNP 3G1IA 2K5XA 1YITP 2GZFA 3B5IA 2KG6A 2KG8A 1YJ9P 2CGQA 3OW2O 2XV6A 1HQBA 1NJIQ 1L0HA 1D1DA 3CMEP 2K92A 5KP6B 1OR5A 2KORA 1Q82Q 3HYBA 2XXMA 1YJNP 1M6EX 1T8KA 2ONTA 2OTLP 1M6NA 3U43A 3WBHA 4QNBA 2GZIA 1BXIA 2KGCA 3DS0A 2JYGA 2FHSC 3CCUP 2FVEA 1VQMP 3CCSP 2PEQA 2VLOA 5HGNA 2EHSA 3NY7B 2CWOA 2JQ4A 2N5HA 2GZJA 1K73Q 2GDYA 4R0MA 3GZMA 1HY8A 3B4QA 4H2XC 1VQOP 2VLQA 2MVVA 1W2BO 2BHVA 2Z45A 4IZ6A 2K94A 1Q86Q 1VQPP 1YHQP 2XT1A 2CG5B 1X3OA 2FQ2A 1L0IA 5DCKA 5F2NA 2QNWA 2LF4A 1AUMA 2Z46A 2ROQA 4XRQA 3CD6P 1BAJA 1RO0A 5KP7B 2GZGA 1UJZA 2EIAA 3G4SP 2L0QA 2KGAA 4COCA 3E2DA 2L4BA 3DS4A 4IPYA 4M0IA 1VQ8P 3M1MA 3CCRP 3EJDA 2JU2A 3DS3A 5CZDB 2FVFA 3VRLC 4PH0A 2N98A 4PH1A 3H0DA 3CCVP
chains in the Genus database with same CATH topology
1QVGO 3CMAP 1Q82Q 3HYBA 3G29A 4U0DA 1VQ9P 1YI2P 2XXMA 1YJNP 3CCMP 2QEXP 3DTJA 1K9MQ 1VQ7P 1M6EX 3P05A 4XROA 1Q81Q 1YJWP 1KQSO 3H4EA 2ONTA 2OTLP 3G26A 1RO2A 1M6NA 5JPAA 3WBHA 4QNBA 4U0FA 2BUOA 1EOQA 3G0VA 3I55P 2PY8A 5F2OA 1RNIA 1VQKP 3DS0A 3CCLP 3G28A 2JYGA 3NTEA 3CCUP 2KODA 5BS2A 2M8NA 2PEJA 3CCSP 1VQMP 3LRYA 3G71P 3DS5A 4XFYA 2PEQA 3H47A 4XFXA 5BS1A 1YIJP 1KC8Q 1VQ6P 5HGNA 1VQLP 1K30A 2PEOA 1N8RQ 3I56P 3CCJP 3CC7P 2CWOA 3RG6C 5I4TG 1M90Q 5HGOA 2EG5A 2E1MA 1EIAA 2PEKA 2PEMA 2M8PA 3DPHA 1K73Q 2EFJA 1QVFO 1E6JP 1Q7YQ 1A43A 3DS1A 3G1GA 5F2KA 4WYMA 4GR2A 1VQOP 1W2BO 2BHVA 2L6EA 1M74A 2OARA 2Z45A 3CPWO 2QA4P 1Q86Q 3CXCO 3MGEA 1VQPP 1K8AQ 1YHQP 2XT1A 4COPA 4U0BA 1VQ4P 5DCKA 5F2NA 1VQ5P 2LF4A 4GR6A 2DGYA 1AUMA 2P9XA 2Z46A 4U0AA 3Q20A 4XRQA 3CD6P 1A8OA 4U0CA 5HGLA 2PENA 1BAJA 1RO0A 3CCQP 2EIAA 3G4SP 4COCA 3CC4P 3E2DA 3CC2P 3HZQA 1QRJA 1ZMBA 2JYLA 4XFZA 3DS2A 3DS4A 4IPYA 1IUQA 2Z44A 3G1IA 4M0IA 1VQ8P 4U0EA 1VQNP 1YITP 3B5IA 3M1MA 2PEIA 5HGMA 3CCRP 1YJ9P 3DS3A 3OW2O 2XV6A 1NJIQ 3VRLC 4PH0A 1D1DA 2OTJP 1S72P 1M1KQ 2JO0A 4PH1A 3G21A 3G6EP 3CMEP 1JJ2O 3CCEP 1KD1Q 3H0DA 3CCVP 2M8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LRY A;  4WYM A;  3DS5 A;  3G29 A;  4U0D A;  4XFY A;  4COC A;  1QRJ A;  2XXM A;  2JYL A;  3DTJ A;  4XFZ A;  3P05 A;  3DS2 A;  3DS4 A;  3H47 A;  4IPY A;  4XFX A;  4XRO A;  4M0I A;  3G1I A;  2L6E A;  3H4E A;  2ONT A;  4U0E A;  5HGN A;  5HGM A;  3G26 A;  3MGE A;  5I4T G;  2XT1 A;  4COP A;  5HGO A;  5JPA A;  3DS3 A;  1EIA A;  4U0B A;  5DCK A;  2M8P A;  3DPH A;  4QNB A;  2XV6 A;  4U0F A;  1E6J P;  2BUO A;  1EOQ A;  3G0V A;  2LF4 A;  3VRL C;  4PH0 A;  1D1D A;  1A43 A;  3DS0 A;  1AUM A;  4U0A A;  3DS1 A;  4XRQ A;  2JO0 A;  4PH1 A;  3G28 A;  1A8O A;  3G1G A;  2JYG A;  3G21 A;  3NTE A;  4U0C A;  5HGL A;  1BAJ A;  2KOD A;  2M8N A;  2M8L A;  2EIA A; 
#chains in the Genus database with same CATH topology
 1QVG O;  5KP8 B;  1Z6M A;  1K9M Q;  1VQ7 P;  4QKO A;  4F37 A;  2N5I A;  1Q81 Q;  3H4E A;  2XZ1 C;  4BPH A;  5JPA A;  7CEI A;  5HVC A;  2KOP A;  2BUO A;  2KOO A;  2KOS A;  2X2B A;  2KOD A;  2M8N A;  2GZE A;  3LRY A;  3G71 P;  5BS1 A;  1GPJ A;  1ACP A;  1IMQ A;  1VQ6 P;  1K30 A;  2KWL A;  1N8R Q;  3CCJ P;  2MD9 A;  2L22 A;  5I4T G;  3RG6 C;  5HV8 A;  1EIA A;  2EFJ A;  1A43 A;  2WPT A;  2LPK A;  2OAR A;  3CPW O;  5EJD A;  1VQ4 P;  2LIU A;  4GR6 A;  3Q20 A;  1UNK A;  2AF8 A;  2LOL A;  1IMP A;  1QRJ A;  2K0Y A;  2NO8 A;  3DS2 A;  1E0H A;  5HGM A;  1DV5 A;  2LL8 A;  1AF8 A;  2KGD A;  2KOQ A;  2XZ0 D;  2FQ0 A;  2KW2 A;  2VLN A;  2JO0 A;  2GDW A;  1ZNV A;  1JJ2 O;  1NQ4 A;  5EW5 E;  3GJN A;  4H2W C;  2MR7 A;  3CMA P;  2MR8 A;  4BPG A;  3G29 A;  4U0D A;  1VQ9 P;  1YI2 P;  2QEX P;  1GXG A;  3P05 A;  2AFD A;  1YJW P;  1KQS O;  2JB0 A;  2AVA A;  2FVA A;  1RO2 A;  3G26 A;  4MRT C;  2GYK A;  4HKG A;  3G0V A;  3CCL P;  3G28 A;  3NTE A;  2JU1 A;  2MVU A;  3RG2 A;  3DS5 A;  3LMO A;  2N6Z A;  1YIJ P;  2PEO A;  3CC7 P;  2KG9 A;  4PXH B;  1M90 Q;  5HGO A;  2PEK A;  3DPH A;  3CE7 A;  1QVF O;  1E6J P;  1Q7Y Q;  1VHN A;  1F80 D;  2AFE A;  2JGP A;  2FAD A;  2K0X A;  2L6E A;  3MGE A;  1K8A Q;  4COP A;  1VQ5 P;  2K0D X;  4U0A A;  3GKL C;  1A8O A;  4U0C A;  5HGL A;  1CEI A;  3CC4 P;  2JYL A;  2FQ1 A;  2GDX A;  1IUQ A;  2JAZ A;  2Z44 A;  4U0E A;  2LIW A;  2PEI A;  2CNR A;  2EHT A;  2JBG A;  2OTJ P;  2CQ8 A;  1S72 P;  1M1K Q;  3G21 A;  3G6E P;  1VKU A;  3CCE P;  1KD1 Q;  4DG9 A;  2M8L A;  2N50 A;  2N6Y A;  2M5R A;  4PWV B;  3CCM P;  3DTJ A;  3EJE A;  2PNG A;  4XRO A;  2KGE A;  1GXH A;  2FAE A;  1FR2 A;  4U0F A;  3I55 P;  1EOQ A;  1VQK P;  2DNW A;  2PY8 A;  1RNI A;  5F2O A;  5BS2 A;  2PEJ A;  4XFY A;  3H47 A;  4XFX A;  2KR5 A;  1KC8 Q;  1VQL P;  4UHP B;  3I56 P;  2VLP A;  2EG5 A;  2E1M A;  2PEM A;  2LKI A;  2M8P A;  2K93 A;  4H2Y C;  3DS1 A;  1EMV A;  3G1G A;  1DNY A;  5F2K A;  4WYM A;  1KLP A;  4GR2 A;  1AYI A;  2LTE A;  2MY5 A;  1M74 A;  2QA4 P;  2VSQ A;  3CXC O;  4CA3 A;  4BPF A;  4U0B A;  2K2Q A;  2MF4 A;  1MZ8 A;  2DGY A;  2P9X A;  2PEN A;  4NEO A;  3CCQ P;  3CC2 P;  3HZQ A;  1ZMB A;  2FAC A;  3EJB A;  3GZL A;  2L9F A;  2LML A;  4XFZ A;  2ERH A;  1VQN P;  3G1I A;  2K5X A;  1YIT P;  2GZF A;  3B5I A;  2KG6 A;  2KG8 A;  1YJ9 P;  2CGQ A;  3OW2 O;  2XV6 A;  1HQB A;  1NJI Q;  1L0H A;  1D1D A;  3CME P;  2K92 A;  5KP6 B;  1OR5 A;  2KOR A;  1Q82 Q;  3HYB A;  2XXM A;  1YJN P;  1M6E X;  1T8K A;  2ONT A;  2OTL P;  1M6N A;  3U43 A;  3WBH A;  4QNB A;  2GZI A;  1BXI A;  2KGC A;  3DS0 A;  2JYG A;  2FHS C;  3CCU P;  2FVE A;  1VQM P;  3CCS P;  2PEQ A;  2VLO A;  5HGN A;  2EHS A;  3NY7 B;  2CWO A;  2JQ4 A;  2N5H A;  2GZJ A;  1K73 Q;  2GDY A;  4R0M A;  3GZM A;  1HY8 A;  3B4Q A;  4H2X C;  1VQO P;  2VLQ A;  2MVV A;  1W2B O;  2BHV A;  2Z45 A;  4IZ6 A;  2K94 A;  1Q86 Q;  1VQP P;  1YHQ P;  2XT1 A;  2CG5 B;  1X3O A;  2FQ2 A;  1L0I A;  5DCK A;  5F2N A;  2QNW A;  2LF4 A;  1AUM A;  2Z46 A;  2ROQ A;  4XRQ A;  3CD6 P;  1BAJ A;  1RO0 A;  5KP7 B;  2GZG A;  1UJZ A;  2EIA A;  3G4S P;  2L0Q A;  2KGA A;  4COC A;  3E2D A;  2L4B A;  3DS4 A;  4IPY A;  4M0I A;  1VQ8 P;  3M1M A;  3CCR P;  3EJD A;  2JU2 A;  3DS3 A;  5CZD B;  2FVF A;  3VRL C;  4PH0 A;  2N98 A;  4PH1 A;  3H0D A;  3CCV P; 
#chains in the Genus database with same CATH homology
 1QVG O;  3CMA P;  1Q82 Q;  3HYB A;  3G29 A;  4U0D A;  1VQ9 P;  1YI2 P;  2XXM A;  1YJN P;  3CCM P;  2QEX P;  3DTJ A;  1K9M Q;  1VQ7 P;  1M6E X;  3P05 A;  4XRO A;  1Q81 Q;  1YJW P;  1KQS O;  3H4E A;  2ONT A;  2OTL P;  3G26 A;  1RO2 A;  1M6N A;  5JPA A;  3WBH A;  4QNB A;  4U0F A;  2BUO A;  1EOQ A;  3G0V A;  3I55 P;  2PY8 A;  5F2O A;  1RNI A;  1VQK P;  3DS0 A;  3CCL P;  3G28 A;  2JYG A;  3NTE A;  3CCU P;  2KOD A;  5BS2 A;  2M8N A;  2PEJ A;  3CCS P;  1VQM P;  3LRY A;  3G71 P;  3DS5 A;  4XFY A;  2PEQ A;  3H47 A;  4XFX A;  5BS1 A;  1YIJ P;  1KC8 Q;  1VQ6 P;  5HGN A;  1VQL P;  1K30 A;  2PEO A;  1N8R Q;  3I56 P;  3CCJ P;  3CC7 P;  2CWO A;  3RG6 C;  5I4T G;  1M90 Q;  5HGO A;  2EG5 A;  2E1M A;  1EIA A;  2PEK A;  2PEM A;  2M8P A;  3DPH A;  1K73 Q;  2EFJ A;  1QVF O;  1E6J P;  1Q7Y Q;  1A43 A;  3DS1 A;  3G1G A;  5F2K A;  4WYM A;  4GR2 A;  1VQO P;  1W2B O;  2BHV A;  2L6E A;  1M74 A;  2OAR A;  2Z45 A;  3CPW O;  2QA4 P;  1Q86 Q;  3CXC O;  3MGE A;  1VQP P;  1K8A Q;  1YHQ P;  2XT1 A;  4COP A;  4U0B A;  1VQ4 P;  5DCK A;  5F2N A;  1VQ5 P;  2LF4 A;  4GR6 A;  2DGY A;  1AUM A;  2P9X A;  2Z46 A;  4U0A A;  3Q20 A;  4XRQ A;  3CD6 P;  1A8O A;  4U0C A;  5HGL A;  2PEN A;  1BAJ A;  1RO0 A;  3CCQ P;  2EIA A;  3G4S P;  4COC A;  3CC4 P;  3E2D A;  3CC2 P;  3HZQ A;  1QRJ A;  1ZMB A;  2JYL A;  4XFZ A;  3DS2 A;  3DS4 A;  4IPY A;  1IUQ A;  2Z44 A;  3G1I A;  4M0I A;  1VQ8 P;  4U0E A;  1VQN P;  1YIT P;  3B5I A;  3M1M A;  2PEI A;  5HGM A;  3CCR P;  1YJ9 P;  3DS3 A;  3OW2 O;  2XV6 A;  1NJI Q;  3VRL C;  4PH0 A;  1D1D A;  2OTJ P;  1S72 P;  1M1K Q;  2JO0 A;  4PH1 A;  3G21 A;  3G6E P;  3CME P;  1JJ2 O;  3CCE P;  1KD1 Q;  3H0D A;  3CCV P;  2M8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...