4COCA

Hiv-1 capsid c-terminal domain mutant (y169l)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
75
structure length
75
Chain Sequence
TSILDIRQGPKEPFRDYVDRFLKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CAPSID PROTEIN P24
publication title Cryo-Electron Microscopy of Tubular Arrays of HIV-1 Gag Resolves Structures Essential for Immature Virus Assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 28
structure length 75
sequence length 75
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4cocA00
2JO0A 3H47A 2LF4A 2M8PA 3DS2A 4IPYA 5JPAA 1AUMA 4U0BA 3NTEA 4U0EA 2XV6A 2XXMA 1E6JP 3H4EA 4U0AA 4PH0A 3MGEA 3G0VA 4U0FA 3DS0A 4QNBA 4XROA 3G1GA 5HGMA 5HGNA 1EIAA 1A8OA 1D1DA 3P05A 1QRJA 3DPHA 4WYMA 2XT1A 2M8NA 4PH1A 2JYLA 2M8LA 4COPA 3DS3A 2EIAA 4U0DA 3G28A 5HGLA 3DS4A 2KODA 3G29A 3DS5A 2L6EA 3DS1A 3G21A 1BAJA 4XFXA 4XFYA 2ONTA 4M0IA 4XRQA 3G26A 5HGOA 3DTJA 3LRYA 2BUOA 3VRLC 4COCA 1EOQA 1A43A 2JYGA 4XFZA 5I4TG 4U0CA 5DCKA 3G1IA
chains in the Genus database with same CATH superfamily
3GJNA 2EHTA 3GZMA 1VQOP 4F37A 2MY5A 2AF8A 2GYKA 2K0YA 1M6NA 2PY8A 2N98A 2FQ0A 1YJWP 2MF4A 2N5HA 2M8LA 3DS1A 1BAJA 2FADA 2KGCA 5F2OA 2BUOA 1M90Q 4PWVB 1K73Q 1GXGA 2JQ4A 2MR7A 2OARA 1T8KA 1ACPA 2PEQA 2M8NA 2JYLA 1VQKP 3G28A 2GZJA 5HGOA 2MR8A 3VRLC 2VLPA 3H47A 2M8PA 5JPAA 1YHQP 2GDXA 2L9FA 3CC7P 4NEOA 4H2XC 1DNYA 4QKOA 3HZQA 1Q81Q 1CEIA 3DPHA 2AVAA 2QA4P 1HY8A 5BS2A 4XFXA 4BPGA 3CMAP 1VKUA 3EJBA 2EG5A 1ZNVA 3OW2O 2VLNA 1IUQA 2FACA 2QEXP 1HQBA 4BPHA 1Q82Q 2X2BA 2XV6A 3CD6P 2CNRA 2N5IA 2AFEA 1JJ2O 2WPTA 3CPWO 1UJZA 1S72P 3E2DA 4M0IA 2LMLA 1DV5A 1VQ4P 1M6EX 2VLQA 1YJ9P 2Z44A 2PENA 3G6EP 1VQ6P 2GZGA 4PH0A 3CE7A 4U0FA 2P9XA 2PNGA 1RO2A 1KLPA 2FQ2A 3H0DA 1KD1Q 2EIAA 3CCVP 5F2NA 1AYIA 3HYBA 3NY7B 2PEKA 3B4QA 2KW2A 1YJNP 2PEOA 1EMVA 2GZIA 2LTEA 1AUMA 4U0EA 2KORA 1NJIQ 1VQ5P 1QRJA 1E0HA 2MD9A 2L6EA 2KGDA 3I55P 5CZDB 2Z46A 5I4TG 5DCKA 1Q7YQ 3RG6C 2JO0A 2LF4A 3DS2A 3GKLC 4IPYA 2EFJA 1IMPA 3H4EA 2FAEA 4GR2A 4CA3A 3RG2A 2LKIA 4XROA 1D1DA 1KC8Q 4MRTC 1YIJP 1VQMP 2FQ1A 2N6ZA 3G21A 4H2YC 3CCJP 2ONTA 4XRQA 3LRYA 5HVCA 4U0CA 1L0IA 3G4SP 3CXCO 1KQSO 3EJDA 4R0MA 3NTEA 5BS1A 2VLOA 2XZ1C 3B5IA 5HGNA 1A8OA 3P05A 2PEMA 5EJDA 2FHSC 2FVEA 3DS3A 4U0DA 3CCUP 1K9MQ 1NQ4A 2K0DX 1RNIA 3I56P 1GXHA 2K93A 3G1IA 4IZ6A 2KG9A 3CMEP 2QNWA 3MGEA 2KGEA 4HKGA 1EIAA 2N50A 4WYMA 2XT1A 2PEIA 2KODA 5KP6B 2KGAA 2KWLA 5EW5E 2K2QA 2CWOA 1VQ7P 2JU2A 2NO8A 2E1MA 1F80D 1ZMBA 2AFDA 1FR2A 2KOQA 2KG6A 2XXMA 3G0VA 3CCEP 1M1KQ 1VQPP 2GZEA 2FVAA 2FVFA 5KP7B 2OTLP 3CC4P 2N6YA 3G29A 1YI2P 2LPKA 1K30A 1OR5A 4H2WC 1UNKA 3CCQP 1EOQA 2JBGA 2KR5A 2DNWA 1VHNA 1MZ8A 1W2BO 2KOSA 2JU1A 3CCMP 3EJEA 2CG5B 2BHVA 2K5XA 2LIUA 1L0HA 1X3OA 4PXHB 5HGLA 4XFYA 3Q20A 5KP8B 1AF8A 3G71P 1QVFO 2MVUA 4U0BA 3M1MA 2JAZA 2KOPA 3GZLA 2L22A 2Z45A 4COPA 2DGYA 1QVGO 3G26A 2CGQA 2EHSA 2K0XA 2ROQA 2PEJA 2GDWA 3WBHA 1BXIA 2MVVA 1RO0A 1E6JP 4PH1A 1IMQA 1K8AQ 2LL8A 3CCLP 2KG8A 3U43A 3DS0A 4BPFA 5HGMA 2OTJP 3CCRP 3CC2P 1VQNP 4COCA 1GPJA 5F2KA 2CQ8A 2JGPA 4UHPB 1VQLP 4QNBA 1VQ8P 2VSQA 2KOOA 3DS4A 4DG9A 3DS5A 2XZ0D 1Q86Q 2JYGA 2L4BA 2GZFA 3CCSP 2JB0A 2LOLA 4U0AA 2K92A 3LMOA 1VQ9P 2GDYA 3G1GA 4GR6A 2L0QA 5HV8A 7CEIA 2K94A 2M5RA 2LIWA 1M74A 1YITP 1N8RQ 1Z6MA 3DTJA 1A43A 2ERHA 4XFZA
chains in the Genus database with same CATH topology
2Z44A 2PENA 1RO0A 3G6EP 1VQ6P 1VQOP 3CMEP 1E6JP 4PH0A 3MGEA 4U0FA 2P9XA 1M6NA 2PY8A 1RO2A 1EIAA 4WYMA 3H0DA 2XT1A 1YJWP 4PH1A 2M8LA 1KD1Q 2EIAA 2PEIA 3CCVP 2KODA 5F2NA 3DS1A 3HYBA 1BAJA 2CWOA 1VQ7P 5F2OA 2BUOA 1K8AQ 2E1MA 2PEKA 1M90Q 1YJNP 2PEOA 1ZMBA 3CCLP 1K73Q 1AUMA 4U0EA 2XXMA 3G0VA 1NJIQ 1VQ5P 3DS0A 3CCEP 2OARA 1M1KQ 5HGMA 1VQPP 1QRJA 2PEQA 2M8NA 2JYLA 2OTLP 1VQKP 3G28A 3CC4P 2OTJP 3G29A 1YI2P 2L6EA 3CCRP 3CC2P 1VQNP 1K30A 3I55P 5HGOA 4COCA 3VRLC 3CCQP 1EOQA 2Z46A 5I4TG 5F2KA 5DCKA 1Q7YQ 3RG6C 2JO0A 3H47A 2LF4A 2M8PA 3DS2A 4IPYA 5JPAA 1YHQP 2EFJA 3CC7P 1W2BO 1VQLP 3H4EA 4GR2A 3HZQA 3CCMP 4QNBA 4XROA 1Q81Q 2BHVA 1VQ8P 1D1DA 3DPHA 1KC8Q 2QA4P 1YIJP 5HGLA 3DS4A 1VQMP 3DS5A 5BS2A 3G21A 4XFYA 4XFXA 3CCJP 2ONTA 3Q20A 4XRQA 3CMAP 3LRYA 2EG5A 3G71P 3OW2O 1Q86Q 2JYGA 1YJ9P 4U0CA 1IUQA 3G4SP 2QEXP 3CCSP 1QVFO 3CXCO 1KQSO 1Q82Q 4U0BA 3NTEA 4U0AA 2XV6A 5BS1A 3CD6P 3M1MA 1VQ9P 3B5IA 3G1GA 5HGNA 2Z45A 4GR6A 1A8OA 3P05A 2PEMA 4COPA 3DS3A 2DGYA 4U0DA 3CCUP 3CPWO 1QVGO 1JJ2O 1S72P 3E2DA 1K9MQ 1M74A 4M0IA 1RNIA 3G26A 3I56P 1YITP 1N8RQ 1VQ4P 1M6EX 3DTJA 1A43A 2PEJA 4XFZA 3WBHA 3G1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JO0 A;  3H47 A;  2LF4 A;  2M8P A;  3DS2 A;  4IPY A;  5JPA A;  1AUM A;  4U0B A;  3NTE A;  4U0E A;  2XV6 A;  2XXM A;  1E6J P;  3H4E A;  4U0A A;  4PH0 A;  3MGE A;  3G0V A;  4U0F A;  3DS0 A;  4QNB A;  4XRO A;  3G1G A;  5HGM A;  5HGN A;  1EIA A;  1A8O A;  1D1D A;  3P05 A;  1QRJ A;  3DPH A;  4WYM A;  2XT1 A;  2M8N A;  4PH1 A;  2JYL A;  2M8L A;  4COP A;  3DS3 A;  2EIA A;  4U0D A;  3G28 A;  5HGL A;  3DS4 A;  2KOD A;  3G29 A;  3DS5 A;  2L6E A;  3DS1 A;  3G21 A;  1BAJ A;  4XFX A;  4XFY A;  2ONT A;  4M0I A;  4XRQ A;  3G26 A;  5HGO A;  3DTJ A;  3LRY A;  2BUO A;  3VRL C;  4COC A;  1EOQ A;  1A43 A;  2JYG A;  4XFZ A;  5I4T G;  4U0C A;  5DCK A;  3G1I A; 
#chains in the Genus database with same CATH topology
 3GJN A;  2EHT A;  3GZM A;  1VQO P;  4F37 A;  2MY5 A;  2AF8 A;  2GYK A;  2K0Y A;  1M6N A;  2PY8 A;  2N98 A;  2FQ0 A;  1YJW P;  2MF4 A;  2N5H A;  2M8L A;  3DS1 A;  1BAJ A;  2FAD A;  2KGC A;  5F2O A;  2BUO A;  1M90 Q;  4PWV B;  1K73 Q;  1GXG A;  2JQ4 A;  2MR7 A;  2OAR A;  1T8K A;  1ACP A;  2PEQ A;  2M8N A;  2JYL A;  1VQK P;  3G28 A;  2GZJ A;  5HGO A;  2MR8 A;  3VRL C;  2VLP A;  3H47 A;  2M8P A;  5JPA A;  1YHQ P;  2GDX A;  2L9F A;  3CC7 P;  4NEO A;  4H2X C;  1DNY A;  4QKO A;  3HZQ A;  1Q81 Q;  1CEI A;  3DPH A;  2AVA A;  2QA4 P;  1HY8 A;  5BS2 A;  4XFX A;  4BPG A;  3CMA P;  1VKU A;  3EJB A;  2EG5 A;  1ZNV A;  3OW2 O;  2VLN A;  1IUQ A;  2FAC A;  2QEX P;  1HQB A;  4BPH A;  1Q82 Q;  2X2B A;  2XV6 A;  3CD6 P;  2CNR A;  2N5I A;  2AFE A;  1JJ2 O;  2WPT A;  3CPW O;  1UJZ A;  1S72 P;  3E2D A;  4M0I A;  2LML A;  1DV5 A;  1VQ4 P;  1M6E X;  2VLQ A;  1YJ9 P;  2Z44 A;  2PEN A;  3G6E P;  1VQ6 P;  2GZG A;  4PH0 A;  3CE7 A;  4U0F A;  2P9X A;  2PNG A;  1RO2 A;  1KLP A;  2FQ2 A;  3H0D A;  1KD1 Q;  2EIA A;  3CCV P;  5F2N A;  1AYI A;  3HYB A;  3NY7 B;  2PEK A;  3B4Q A;  2KW2 A;  1YJN P;  2PEO A;  1EMV A;  2GZI A;  2LTE A;  1AUM A;  4U0E A;  2KOR A;  1NJI Q;  1VQ5 P;  1QRJ A;  1E0H A;  2MD9 A;  2L6E A;  2KGD A;  3I55 P;  5CZD B;  2Z46 A;  5I4T G;  5DCK A;  1Q7Y Q;  3RG6 C;  2JO0 A;  2LF4 A;  3DS2 A;  3GKL C;  4IPY A;  2EFJ A;  1IMP A;  3H4E A;  2FAE A;  4GR2 A;  4CA3 A;  3RG2 A;  2LKI A;  4XRO A;  1D1D A;  1KC8 Q;  4MRT C;  1YIJ P;  1VQM P;  2FQ1 A;  2N6Z A;  3G21 A;  4H2Y C;  3CCJ P;  2ONT A;  4XRQ A;  3LRY A;  5HVC A;  4U0C A;  1L0I A;  3G4S P;  3CXC O;  1KQS O;  3EJD A;  4R0M A;  3NTE A;  5BS1 A;  2VLO A;  2XZ1 C;  3B5I A;  5HGN A;  1A8O A;  3P05 A;  2PEM A;  5EJD A;  2FHS C;  2FVE A;  3DS3 A;  4U0D A;  3CCU P;  1K9M Q;  1NQ4 A;  2K0D X;  1RNI A;  3I56 P;  1GXH A;  2K93 A;  3G1I A;  4IZ6 A;  2KG9 A;  3CME P;  2QNW A;  3MGE A;  2KGE A;  4HKG A;  1EIA A;  2N50 A;  4WYM A;  2XT1 A;  2PEI A;  2KOD A;  5KP6 B;  2KGA A;  2KWL A;  5EW5 E;  2K2Q A;  2CWO A;  1VQ7 P;  2JU2 A;  2NO8 A;  2E1M A;  1F80 D;  1ZMB A;  2AFD A;  1FR2 A;  2KOQ A;  2KG6 A;  2XXM A;  3G0V A;  3CCE P;  1M1K Q;  1VQP P;  2GZE A;  2FVA A;  2FVF A;  5KP7 B;  2OTL P;  3CC4 P;  2N6Y A;  3G29 A;  1YI2 P;  2LPK A;  1K30 A;  1OR5 A;  4H2W C;  1UNK A;  3CCQ P;  1EOQ A;  2JBG A;  2KR5 A;  2DNW A;  1VHN A;  1MZ8 A;  1W2B O;  2KOS A;  2JU1 A;  3CCM P;  3EJE A;  2CG5 B;  2BHV A;  2K5X A;  2LIU A;  1L0H A;  1X3O A;  4PXH B;  5HGL A;  4XFY A;  3Q20 A;  5KP8 B;  1AF8 A;  3G71 P;  1QVF O;  2MVU A;  4U0B A;  3M1M A;  2JAZ A;  2KOP A;  3GZL A;  2L22 A;  2Z45 A;  4COP A;  2DGY A;  1QVG O;  3G26 A;  2CGQ A;  2EHS A;  2K0X A;  2ROQ A;  2PEJ A;  2GDW A;  3WBH A;  1BXI A;  2MVV A;  1RO0 A;  1E6J P;  4PH1 A;  1IMQ A;  1K8A Q;  2LL8 A;  3CCL P;  2KG8 A;  3U43 A;  3DS0 A;  4BPF A;  5HGM A;  2OTJ P;  3CCR P;  3CC2 P;  1VQN P;  4COC A;  1GPJ A;  5F2K A;  2CQ8 A;  2JGP A;  4UHP B;  1VQL P;  4QNB A;  1VQ8 P;  2VSQ A;  2KOO A;  3DS4 A;  4DG9 A;  3DS5 A;  2XZ0 D;  1Q86 Q;  2JYG A;  2L4B A;  2GZF A;  3CCS P;  2JB0 A;  2LOL A;  4U0A A;  2K92 A;  3LMO A;  1VQ9 P;  2GDY A;  3G1G A;  4GR6 A;  2L0Q A;  5HV8 A;  7CEI A;  2K94 A;  2M5R A;  2LIW A;  1M74 A;  1YIT P;  1N8R Q;  1Z6M A;  3DTJ A;  1A43 A;  2ERH A;  4XFZ A; 
#chains in the Genus database with same CATH homology
 2Z44 A;  2PEN A;  1RO0 A;  3G6E P;  1VQ6 P;  1VQO P;  3CME P;  1E6J P;  4PH0 A;  3MGE A;  4U0F A;  2P9X A;  1M6N A;  2PY8 A;  1RO2 A;  1EIA A;  4WYM A;  3H0D A;  2XT1 A;  1YJW P;  4PH1 A;  2M8L A;  1KD1 Q;  2EIA A;  2PEI A;  3CCV P;  2KOD A;  5F2N A;  3DS1 A;  3HYB A;  1BAJ A;  2CWO A;  1VQ7 P;  5F2O A;  2BUO A;  1K8A Q;  2E1M A;  2PEK A;  1M90 Q;  1YJN P;  2PEO A;  1ZMB A;  3CCL P;  1K73 Q;  1AUM A;  4U0E A;  2XXM A;  3G0V A;  1NJI Q;  1VQ5 P;  3DS0 A;  3CCE P;  2OAR A;  1M1K Q;  5HGM A;  1VQP P;  1QRJ A;  2PEQ A;  2M8N A;  2JYL A;  2OTL P;  1VQK P;  3G28 A;  3CC4 P;  2OTJ P;  3G29 A;  1YI2 P;  2L6E A;  3CCR P;  3CC2 P;  1VQN P;  1K30 A;  3I55 P;  5HGO A;  4COC A;  3VRL C;  3CCQ P;  1EOQ A;  2Z46 A;  5I4T G;  5F2K A;  5DCK A;  1Q7Y Q;  3RG6 C;  2JO0 A;  3H47 A;  2LF4 A;  2M8P A;  3DS2 A;  4IPY A;  5JPA A;  1YHQ P;  2EFJ A;  3CC7 P;  1W2B O;  1VQL P;  3H4E A;  4GR2 A;  3HZQ A;  3CCM P;  4QNB A;  4XRO A;  1Q81 Q;  2BHV A;  1VQ8 P;  1D1D A;  3DPH A;  1KC8 Q;  2QA4 P;  1YIJ P;  5HGL A;  3DS4 A;  1VQM P;  3DS5 A;  5BS2 A;  3G21 A;  4XFY A;  4XFX A;  3CCJ P;  2ONT A;  3Q20 A;  4XRQ A;  3CMA P;  3LRY A;  2EG5 A;  3G71 P;  3OW2 O;  1Q86 Q;  2JYG A;  1YJ9 P;  4U0C A;  1IUQ A;  3G4S P;  2QEX P;  3CCS P;  1QVF O;  3CXC O;  1KQS O;  1Q82 Q;  4U0B A;  3NTE A;  4U0A A;  2XV6 A;  5BS1 A;  3CD6 P;  3M1M A;  1VQ9 P;  3B5I A;  3G1G A;  5HGN A;  2Z45 A;  4GR6 A;  1A8O A;  3P05 A;  2PEM A;  4COP A;  3DS3 A;  2DGY A;  4U0D A;  3CCU P;  3CPW O;  1QVG O;  1JJ2 O;  1S72 P;  3E2D A;  1K9M Q;  1M74 A;  4M0I A;  1RNI A;  3G26 A;  3I56 P;  1YIT P;  1N8R Q;  1VQ4 P;  1M6E X;  3DTJ A;  1A43 A;  2PEJ A;  4XFZ A;  3WBH A;  3G1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...