2KORA

Nmr solution structures of 2-octenoyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
total genus 26
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2korA00
2LKIA 2VSQA 2AFDA 2FHSC 2CG5B 1HY8A 2JU2A 4DG9A 2KG6A 2GDYA 2GDWA 2LIUA 2KGAA 1VKUA 2FQ1A 2FQ0A 1KLPA 3GZMA 2AF8A 2N50A 2L9FA 2XZ1C 2LIWA 1AF8A 2L22A 2AVAA 2FQ2A 2K94A 1X3OA 2AFEA 4MRTC 2LTEA 4H2WC 2JU1A 2KOQA 2FAEA 4CA3A 2LOLA 1HQBA 4IZ6A 5KP6B 1L0HA 2PNGA 2JGPA 2LPKA 2M5RA 2KG8A 1L0IA 1F80D 2FVAA 2KGCA 2MR8A 4NEOA 5KP7B 2KG9A 2N6YA 3EJEA 5CZDB 2EHTA 2MY5A 3NY7B 4R0MA 2FVEA 4BPFA 2LMLA 2N6ZA 2QNWA 2L0QA 2CGQA 3CE7A 1NQ4A 2KGDA 2XZ0D 2KW2A 2FADA 1DV5A 2KR5A 2N98A 2KWLA 2X2BA 2K2QA 2K92A 2LL8A 2KORA 2MD9A 4H2YC 2KOSA 2KGEA 1ACPA 3LMOA 2N5IA 2FVFA 2MVUA 2KOOA 5KP8B 2MR7A 4BPGA 3GZLA 2KOPA 5HV8A 2MF4A 2CNRA 1OR5A 2CQ8A 1DNYA 2ROQA 5HVCA 2N5HA 2DNWA 2K0YA 3EJDA 2K0XA 2FACA 2K93A 2GDXA 4PXHB 3EJBA 3RG2A 4BPHA 1T8KA 2JQ4A 5EJDA 2MVVA 4HKGA 2EHSA 4PWVB 2L4BA 4H2XC
chains in the Genus database with same CATH superfamily
1HY8A 2KODA 1RO0A 2XXMA 2GDWA 3DS1A 1VKUA 2FQ1A 3RG6C 2AF8A 1ZMBA 3DS2A 2JBGA 2AVAA 2AFEA 2JU1A 1M1KQ 3G1GA 1KC8Q 1VQLP 2JO0A 5KP6B 3I55P 1M6NA 3CCMP 2PEJA 2E1MA 2PNGA 5BS2A 4U0EA 1RNIA 2KGCA 1K8AQ 2MR8A 3NY7B 4R0MA 2PEKA 4BPFA 2L0QA 4M0IA 4IPYA 2KGDA 1JJ2O 1VQ9P 4GR2A 2FADA 1RO2A 2KR5A 2K2QA 2K92A 3CC7P 2LL8A 2MD9A 2JYLA 2WPTA 4XROA 3M1MA 1ACPA 3LMOA 5KP8B 2MR7A 2DGYA 1YIJP 2XT1A 5BS1A 2VLOA 2KOPA 2Z44A 3HYBA 1UJZA 2MF4A 5DCKA 1ZNVA 1DNYA 3I56P 1GXHA 1VQ4P 2GZFA 5JPAA 1UNKA 4COCA 4COPA 1YJ9P 3RG2A 1IMQA 1YITP 1Q86Q 4HKGA 2EHSA 4H2XC 3HZQA 4XFXA 2VSQA 5F2NA 4PH0A 3CC4P 4F37A 4U0BA 2KGAA 1KLPA 1EMVA 2JB0A 2N50A 2L9FA 4XRQA 2XZ1C 2L22A 3H0DA 2FQ2A 3G6EP 1K73Q 4CA3A 3MGEA 1FR2A 2ERHA 1VQNP 3VRLC 1M90Q 1L0IA 1BXIA 4NEOA 5KP7B 2GYKA 2N6YA 2Z46A 2EG5A 1MZ8A 3EJEA 3G29A 2FVEA 7CEIA 2GZIA 1VHNA 3CXCO 2L6EA 2QNWA 1Z6MA 1NQ4A 2K5XA 1W2BO 2XZ0D 2KW2A 1D1DA 2N98A 1IUQA 2KWLA 2CWOA 2XV6A 3Q20A 1Q81Q 2PEMA 2N5IA 2FVFA 5HGLA 4BPGA 1E0HA 1K30A 5EW5E 1IMPA 1S72P 3CMAP 2QEXP 3U43A 2M8PA 5HVCA 2N5HA 2K0XA 2FACA 1Q82Q 1VQMP 3CD6P 3G71P 1YHQP 4BPHA 1AUMA 2JQ4A 3B4QA 1VQ8P 3GKLC 5HGNA 2EFJA 3LRYA 1YI2P 3B5IA 2LKIA 1QVFO 1QRJA 2FHSC 2VLNA 1NJIQ 2KG6A 2GDYA 3GJNA 2LF4A 2QA4P 3P05A 2P9XA 2LIWA 3CCQP 1YJNP 2NO8A 2K94A 1EIAA 1M6EX 1Q7YQ 3CCUP 2KOQA 2FAEA 2LOLA 2ONTA 1L0HA 2BHVA 3CCVP 3DS5A 2JYGA 4QKOA 2JGPA 3DS4A 2BUOA 1M74A 1F80D 2FVAA 2PY8A 3DS0A 2KG9A 2MY5A 2M8LA 3CMEP 2LMLA 2OTJP 2CGQA 4U0FA 3CE7A 5I4TG 1DV5A 3CCRP 2KORA 4H2YC 2KOSA 3OW2O 2OTLP 1A43A 1EOQA 4U0AA 5HGMA 2KGEA 3G1IA 2MVUA 4XFYA 2Z45A 4WYMA 4PH1A 1VQPP 2PENA 3GZLA 3DTJA 2PEIA 1VQ7P 2CNRA 3E2DA 1E6JP 2CQ8A 2GZJA 2VLQA 2DNWA 1VQ6P 2K0YA 3EJDA 3CPWO 2GZGA 3G4SP 1YJWP 2K93A 4UHPB 2OARA 3H47A 4PWVB 2L4BA 4XFZA 1CEIA 2AFDA 1GXGA 2CG5B 2JU2A 4DG9A 2LIUA 2FQ0A 3GZMA 3DPHA 1VQOP 1AF8A 3H4EA 3CCEP 1N8RQ 1X3OA 4MRTC 2LTEA 4H2WC 4GR6A 1A8OA 3CCJP 1HQBA 4IZ6A 3CCLP 2JAZA 2LPKA 2M5RA 2KG8A 1BAJA 2M8NA 1VQ5P 4QNBA 2PEOA 5CZDB 2EHTA 2N6ZA 3DS3A 1QVGO 3G28A 3CC2P 2X2BA 2VLPA 5F2OA 2PEQA 4U0CA 1KD1Q 2KOOA 1KQSO 3WBHA 5HV8A 3CCSP 3NTEA 4U0DA 3G26A 1OR5A 2ROQA 5F2KA 5HGOA 1K9MQ 3G21A 2K0DX 2EIAA 2GDXA 4PXHB 3EJBA 1T8KA 1GPJA 5EJDA 2MVVA 2GZEA 3G0VA 1AYIA 1VQKP
chains in the Genus database with same CATH topology
2LKIA 2VSQA 2AFDA 2FHSC 2CG5B 1HY8A 2JU2A 4DG9A 2KG6A 2GDYA 2GDWA 2LIUA 2KGAA 1VKUA 2FQ1A 2FQ0A 1KLPA 3GZMA 2AF8A 2N50A 2L9FA 2XZ1C 2LIWA 1AF8A 2L22A 2AVAA 2FQ2A 2K94A 1X3OA 2AFEA 4MRTC 2LTEA 4H2WC 2JU1A 2KOQA 2FAEA 4CA3A 2LOLA 1HQBA 4IZ6A 5KP6B 1L0HA 2PNGA 2JGPA 2LPKA 2M5RA 2KG8A 1L0IA 1F80D 2FVAA 2KGCA 2MR8A 4NEOA 5KP7B 2KG9A 2N6YA 3EJEA 5CZDB 2EHTA 2MY5A 3NY7B 4R0MA 2FVEA 4BPFA 2LMLA 2N6ZA 2QNWA 2L0QA 2CGQA 3CE7A 1NQ4A 2KGDA 2XZ0D 2KW2A 2FADA 1DV5A 2KR5A 2N98A 2KWLA 2X2BA 2K2QA 2K92A 2LL8A 2KORA 2MD9A 4H2YC 2KOSA 2KGEA 1ACPA 3LMOA 2N5IA 2FVFA 2MVUA 2KOOA 5KP8B 2MR7A 4BPGA 3GZLA 2KOPA 5HV8A 2MF4A 2CNRA 1OR5A 2CQ8A 1DNYA 2ROQA 5HVCA 2N5HA 2DNWA 2K0YA 3EJDA 2K0XA 2FACA 2K93A 2GDXA 4PXHB 3EJBA 3RG2A 4BPHA 1T8KA 2JQ4A 5EJDA 2MVVA 4HKGA 2EHSA 4PWVB 2L4BA 4H2XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKI A;  2VSQ A;  2AFD A;  2FHS C;  2CG5 B;  1HY8 A;  2JU2 A;  4DG9 A;  2KG6 A;  2GDY A;  2GDW A;  2LIU A;  2KGA A;  1VKU A;  2FQ1 A;  2FQ0 A;  1KLP A;  3GZM A;  2AF8 A;  2N50 A;  2L9F A;  2XZ1 C;  2LIW A;  1AF8 A;  2L22 A;  2AVA A;  2FQ2 A;  2K94 A;  1X3O A;  2AFE A;  4MRT C;  2LTE A;  4H2W C;  2JU1 A;  2KOQ A;  2FAE A;  4CA3 A;  2LOL A;  1HQB A;  4IZ6 A;  5KP6 B;  1L0H A;  2PNG A;  2JGP A;  2LPK A;  2M5R A;  2KG8 A;  1L0I A;  1F80 D;  2FVA A;  2KGC A;  2MR8 A;  4NEO A;  5KP7 B;  2KG9 A;  2N6Y A;  3EJE A;  5CZD B;  2EHT A;  2MY5 A;  3NY7 B;  4R0M A;  2FVE A;  4BPF A;  2LML A;  2N6Z A;  2QNW A;  2L0Q A;  2CGQ A;  3CE7 A;  1NQ4 A;  2KGD A;  2XZ0 D;  2KW2 A;  2FAD A;  1DV5 A;  2KR5 A;  2N98 A;  2KWL A;  2X2B A;  2K2Q A;  2K92 A;  2LL8 A;  2KOR A;  2MD9 A;  4H2Y C;  2KOS A;  2KGE A;  1ACP A;  3LMO A;  2N5I A;  2FVF A;  2MVU A;  2KOO A;  5KP8 B;  2MR7 A;  4BPG A;  3GZL A;  2KOP A;  5HV8 A;  2MF4 A;  2CNR A;  1OR5 A;  2CQ8 A;  1DNY A;  2ROQ A;  5HVC A;  2N5H A;  2DNW A;  2K0Y A;  3EJD A;  2K0X A;  2FAC A;  2K93 A;  2GDX A;  4PXH B;  3EJB A;  3RG2 A;  4BPH A;  1T8K A;  2JQ4 A;  5EJD A;  2MVV A;  4HKG A;  2EHS A;  4PWV B;  2L4B A;  4H2X C; 
#chains in the Genus database with same CATH topology
 1HY8 A;  2KOD A;  1RO0 A;  2XXM A;  2GDW A;  3DS1 A;  1VKU A;  2FQ1 A;  3RG6 C;  2AF8 A;  1ZMB A;  3DS2 A;  2JBG A;  2AVA A;  2AFE A;  2JU1 A;  1M1K Q;  3G1G A;  1KC8 Q;  1VQL P;  2JO0 A;  5KP6 B;  3I55 P;  1M6N A;  3CCM P;  2PEJ A;  2E1M A;  2PNG A;  5BS2 A;  4U0E A;  1RNI A;  2KGC A;  1K8A Q;  2MR8 A;  3NY7 B;  4R0M A;  2PEK A;  4BPF A;  2L0Q A;  4M0I A;  4IPY A;  2KGD A;  1JJ2 O;  1VQ9 P;  4GR2 A;  2FAD A;  1RO2 A;  2KR5 A;  2K2Q A;  2K92 A;  3CC7 P;  2LL8 A;  2MD9 A;  2JYL A;  2WPT A;  4XRO A;  3M1M A;  1ACP A;  3LMO A;  5KP8 B;  2MR7 A;  2DGY A;  1YIJ P;  2XT1 A;  5BS1 A;  2VLO A;  2KOP A;  2Z44 A;  3HYB A;  1UJZ A;  2MF4 A;  5DCK A;  1ZNV A;  1DNY A;  3I56 P;  1GXH A;  1VQ4 P;  2GZF A;  5JPA A;  1UNK A;  4COC A;  4COP A;  1YJ9 P;  3RG2 A;  1IMQ A;  1YIT P;  1Q86 Q;  4HKG A;  2EHS A;  4H2X C;  3HZQ A;  4XFX A;  2VSQ A;  5F2N A;  4PH0 A;  3CC4 P;  4F37 A;  4U0B A;  2KGA A;  1KLP A;  1EMV A;  2JB0 A;  2N50 A;  2L9F A;  4XRQ A;  2XZ1 C;  2L22 A;  3H0D A;  2FQ2 A;  3G6E P;  1K73 Q;  4CA3 A;  3MGE A;  1FR2 A;  2ERH A;  1VQN P;  3VRL C;  1M90 Q;  1L0I A;  1BXI A;  4NEO A;  5KP7 B;  2GYK A;  2N6Y A;  2Z46 A;  2EG5 A;  1MZ8 A;  3EJE A;  3G29 A;  2FVE A;  7CEI A;  2GZI A;  1VHN A;  3CXC O;  2L6E A;  2QNW A;  1Z6M A;  1NQ4 A;  2K5X A;  1W2B O;  2XZ0 D;  2KW2 A;  1D1D A;  2N98 A;  1IUQ A;  2KWL A;  2CWO A;  2XV6 A;  3Q20 A;  1Q81 Q;  2PEM A;  2N5I A;  2FVF A;  5HGL A;  4BPG A;  1E0H A;  1K30 A;  5EW5 E;  1IMP A;  1S72 P;  3CMA P;  2QEX P;  3U43 A;  2M8P A;  5HVC A;  2N5H A;  2K0X A;  2FAC A;  1Q82 Q;  1VQM P;  3CD6 P;  3G71 P;  1YHQ P;  4BPH A;  1AUM A;  2JQ4 A;  3B4Q A;  1VQ8 P;  3GKL C;  5HGN A;  2EFJ A;  3LRY A;  1YI2 P;  3B5I A;  2LKI A;  1QVF O;  1QRJ A;  2FHS C;  2VLN A;  1NJI Q;  2KG6 A;  2GDY A;  3GJN A;  2LF4 A;  2QA4 P;  3P05 A;  2P9X A;  2LIW A;  3CCQ P;  1YJN P;  2NO8 A;  2K94 A;  1EIA A;  1M6E X;  1Q7Y Q;  3CCU P;  2KOQ A;  2FAE A;  2LOL A;  2ONT A;  1L0H A;  2BHV A;  3CCV P;  3DS5 A;  2JYG A;  4QKO A;  2JGP A;  3DS4 A;  2BUO A;  1M74 A;  1F80 D;  2FVA A;  2PY8 A;  3DS0 A;  2KG9 A;  2MY5 A;  2M8L A;  3CME P;  2LML A;  2OTJ P;  2CGQ A;  4U0F A;  3CE7 A;  5I4T G;  1DV5 A;  3CCR P;  2KOR A;  4H2Y C;  2KOS A;  3OW2 O;  2OTL P;  1A43 A;  1EOQ A;  4U0A A;  5HGM A;  2KGE A;  3G1I A;  2MVU A;  4XFY A;  2Z45 A;  4WYM A;  4PH1 A;  1VQP P;  2PEN A;  3GZL A;  3DTJ A;  2PEI A;  1VQ7 P;  2CNR A;  3E2D A;  1E6J P;  2CQ8 A;  2GZJ A;  2VLQ A;  2DNW A;  1VQ6 P;  2K0Y A;  3EJD A;  3CPW O;  2GZG A;  3G4S P;  1YJW P;  2K93 A;  4UHP B;  2OAR A;  3H47 A;  4PWV B;  2L4B A;  4XFZ A;  1CEI A;  2AFD A;  1GXG A;  2CG5 B;  2JU2 A;  4DG9 A;  2LIU A;  2FQ0 A;  3GZM A;  3DPH A;  1VQO P;  1AF8 A;  3H4E A;  3CCE P;  1N8R Q;  1X3O A;  4MRT C;  2LTE A;  4H2W C;  4GR6 A;  1A8O A;  3CCJ P;  1HQB A;  4IZ6 A;  3CCL P;  2JAZ A;  2LPK A;  2M5R A;  2KG8 A;  1BAJ A;  2M8N A;  1VQ5 P;  4QNB A;  2PEO A;  5CZD B;  2EHT A;  2N6Z A;  3DS3 A;  1QVG O;  3G28 A;  3CC2 P;  2X2B A;  2VLP A;  5F2O A;  2PEQ A;  4U0C A;  1KD1 Q;  2KOO A;  1KQS O;  3WBH A;  5HV8 A;  3CCS P;  3NTE A;  4U0D A;  3G26 A;  1OR5 A;  2ROQ A;  5F2K A;  5HGO A;  1K9M Q;  3G21 A;  2K0D X;  2EIA A;  2GDX A;  4PXH B;  3EJB A;  1T8K A;  1GPJ A;  5EJD A;  2MVV A;  2GZE A;  3G0V A;  1AYI A;  1VQK P; 
#chains in the Genus database with same CATH homology
 2LKI A;  2VSQ A;  2AFD A;  2FHS C;  2CG5 B;  1HY8 A;  2JU2 A;  4DG9 A;  2KG6 A;  2GDY A;  2GDW A;  2LIU A;  2KGA A;  1VKU A;  2FQ1 A;  2FQ0 A;  1KLP A;  3GZM A;  2AF8 A;  2N50 A;  2L9F A;  2XZ1 C;  2LIW A;  1AF8 A;  2L22 A;  2AVA A;  2FQ2 A;  2K94 A;  1X3O A;  2AFE A;  4MRT C;  2LTE A;  4H2W C;  2JU1 A;  2KOQ A;  2FAE A;  4CA3 A;  2LOL A;  1HQB A;  4IZ6 A;  5KP6 B;  1L0H A;  2PNG A;  2JGP A;  2LPK A;  2M5R A;  2KG8 A;  1L0I A;  1F80 D;  2FVA A;  2KGC A;  2MR8 A;  4NEO A;  5KP7 B;  2KG9 A;  2N6Y A;  3EJE A;  5CZD B;  2EHT A;  2MY5 A;  3NY7 B;  4R0M A;  2FVE A;  4BPF A;  2LML A;  2N6Z A;  2QNW A;  2L0Q A;  2CGQ A;  3CE7 A;  1NQ4 A;  2KGD A;  2XZ0 D;  2KW2 A;  2FAD A;  1DV5 A;  2KR5 A;  2N98 A;  2KWL A;  2X2B A;  2K2Q A;  2K92 A;  2LL8 A;  2KOR A;  2MD9 A;  4H2Y C;  2KOS A;  2KGE A;  1ACP A;  3LMO A;  2N5I A;  2FVF A;  2MVU A;  2KOO A;  5KP8 B;  2MR7 A;  4BPG A;  3GZL A;  2KOP A;  5HV8 A;  2MF4 A;  2CNR A;  1OR5 A;  2CQ8 A;  1DNY A;  2ROQ A;  5HVC A;  2N5H A;  2DNW A;  2K0Y A;  3EJD A;  2K0X A;  2FAC A;  2K93 A;  2GDX A;  4PXH B;  3EJB A;  3RG2 A;  4BPH A;  1T8K A;  2JQ4 A;  5EJD A;  2MVV A;  4HKG A;  2EHS A;  4PWV B;  2L4B A;  4H2X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...