2KORA

Nmr solution structures of 2-octenoyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 26
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2korA00
1OR5A 1NQ4A 1HQBA 2N5HA 1KLPA 2MR8A 3CE7A 2K92A 2LL8A 1HY8A 2L9FA 2MD9A 1DV5A 2KG9A 2LPKA 2KOQA 2DNWA 2GDWA 2XZ0D 2JU2A 4H2YC 1ACPA 2FQ1A 5KP6B 1T8KA 2LMLA 4PXHB 2KG6A 4CA3A 2X2BA 3NY7B 3GZLA 2LTEA 2K0XA 5KP7B 2N6YA 2MR7A 2L4BA 2KOPA 2JU1A 2JGPA 2L22A 2FVAA 2FACA 2MVVA 4NEOA 2FHSC 2EHSA 2GDYA 2ROQA 2CNRA 2FADA 4IZ6A 2FQ2A 2LIWA 2FVFA 1DNYA 4HKGA 2N6ZA 2AFDA 2K94A 5KP8B 2N5IA 2KOSA 2VSQA 5HV8A 2AFEA 2K0YA 2CQ8A 2FVEA 2LIUA 2FAEA 4BPHA 2MY5A 2N50A 2KORA 2AF8A 1L0HA 1AF8A 2KR5A 2KW2A 2KOOA 4R0MA 2CG5B 2KWLA 1X3OA 2N98A 3EJDA 2MF4A 2FQ0A 3GZMA 4H2XC 2XZ1C 4PWVB 2LOLA 3LMOA 4MRTC 2QNWA 4BPFA 2KGEA 2KGAA 3EJEA 2JQ4A 2CGQA 3RG2A 2EHTA 3EJBA 2M5RA 2KGDA 5CZDB 5HVCA 4BPGA 1F80D 2LKIA 2K2QA 2KG8A 2L0QA 2AVAA 2KGCA 1L0IA 2PNGA 1VKUA 5EJDA 2GDXA 4DG9A 4H2WC 2MVUA 2K93A
chains in the Genus database with same CATH superfamily
1HQBA 2MR8A 4QKOA 1ZMBA 2K92A 2DGYA 2XXMA 1Q81Q 2MD9A 2QEXP 3I56P 3CCLP 3HZQA 1IMPA 3H4EA 4H2YC 4PH1A 5DCKA 1ACPA 1T8KA 3CC7P 3DS4A 1GXHA 1VQPP 3G29A 3GZLA 1S72P 2PEJA 3WBHA 1W2BO 1QRJA 2JGPA 2K0DX 1EMVA 3CMEP 2FHSC 3DS5A 1YI2P 5F2KA 2Z44A 3G4SP 4M0IA 2FADA 2GZEA 2FQ2A 4F37A 1DNYA 2KOSA 2VSQA 2FVEA 2FAEA 2ONTA 5HGNA 4U0FA 2AF8A 4GR2A 1L0HA 2JBGA 1NJIQ 4XFYA 2E1MA 4U0AA 2KWLA 2JO0A 2N98A 1VQ8P 2FQ0A 1RO2A 3EJEA 3G71P 5JPAA 3RG2A 4COCA 3EJBA 1VQ4P 4BPGA 3GKLC 2LKIA 1Z6MA 2PY8A 2L0QA 2AVAA 3CC2P 1K73Q 5EJDA 2OARA 1BAJA 2NO8A 2VLNA 1NQ4A 3Q20A 3CE7A 3CC4P 4U0EA 4COPA 2LPKA 2DNWA 3NTEA 1FR2A 4IPYA 1M6EX 5KP6B 2LMLA 3CCQP 2KG6A 4CA3A 2X2BA 2GZJA 3DPHA 2L4BA 1JJ2O 3OW2O 1D1DA 2XT1A 2Z45A 2FVAA 2FACA 4UHPB 2MVVA 4NEOA 1Q86Q 5I4TG 3E2DA 3G1IA 2EIAA 4IZ6A 5BS1A 1YJWP 1EOQA 1IMQA 2PEIA 2M8LA 2PEMA 2AFEA 2K0YA 2PEOA 3CXCO 3H47A 4BPHA 2KORA 3CD6P 2GZFA 2KOOA 3DS0A 2CG5B 1X3OA 2BHVA 3EJDA 2P9XA 3G28A 2XZ1C 5HGOA 2VLPA 1BXIA 2QNWA 2PEQA 4BPFA 1A8OA 1M1KQ 2CGQA 1VQKP 2EHTA 2KGDA 5CZDB 5HVCA 2M8NA 3CCSP 2BUOA 2EFJA 3HYBA 3LRYA 3B4QA 4XFZA 1UNKA 2VLOA 5F2OA 1VKUA 4H2WC 2MVUA 3G26A 3G1GA 1OR5A 4U0BA 1E0HA 2N5HA 3CPWO 2L9FA 2KODA 4XROA 1DV5A 2KG9A 2GDWA 1MZ8A 3G6EP 1YHQP 5HGLA 1M90Q 2FQ1A 4GR6A 1KC8Q 4PXHB 1VQ7P 1GXGA 2LTEA 1Q82Q 5KP7B 3CCMP 2M8PA 2JU1A 3G21A 3GJNA 5HGMA 2L22A 1VQ5P 2OTLP 5EW5E 2EHSA 1QVGO 2GDYA 2ROQA 1A43A 2K5XA 2ERHA 2FVFA 4HKGA 2N6ZA 4U0DA 5HV8A 2LIUA 1RNIA 1VQNP 1YITP 4WYMA 2N50A 1AF8A 3DS3A 3P05A 2KW2A 4R0MA 2VLQA 4H2XC 4PWVB 2JB0A 3B5IA 2GZGA 2Z46A 2KGEA 2WPTA 2QA4P 1VQ6P 4PH0A 2GYKA 4XRQA 5F2NA 1YJ9P 1GPJA 1UJZA 7CEIA 1CEIA 2KGCA 2PNGA 4DG9A 2GZIA 1M74A 2K93A 1YJNP 1KLPA 1K9MQ 2CWOA 1VQ9P 2LL8A 1HY8A 3MGEA 5BS2A 1RO0A 3CMAP 2KOQA 2XZ0D 2JU2A 1AYIA 2JYLA 3CCRP 1N8RQ 3G0VA 3NY7B 3CCUP 2OTJP 2K0XA 3CCVP 1K30A 2N6YA 2MR7A 2KOPA 3I55P 2JAZA 1AUMA 2CNRA 3DTJA 1QVFO 2LIWA 3U43A 3M1MA 2LF4A 2AFDA 2K94A 5KP8B 2N5IA 3VRLC 2CQ8A 1KQSO 3RG6C 4XFXA 2MY5A 3CCEP 1E6JP 1KD1Q 1VQOP 2XV6A 2KR5A 2PENA 2MF4A 3GZMA 2LOLA 3LMOA 4MRTC 1YIJP 3DS2A 2EG5A 2KGAA 1IUQA 3CCJP 1EIAA 2JYGA 1M6NA 2JQ4A 2M5RA 1ZNVA 1F80D 2K2QA 4U0CA 2KG8A 2PEKA 2L6EA 3DS1A 1L0IA 3H0DA 1Q7YQ 1K8AQ 1VHNA 2GDXA 4QNBA 1VQLP 1VQMP
chains in the Genus database with same CATH topology
1OR5A 1NQ4A 1HQBA 2N5HA 1KLPA 2MR8A 3CE7A 2K92A 2LL8A 1HY8A 2L9FA 2MD9A 1DV5A 2KG9A 2LPKA 2KOQA 2DNWA 2GDWA 2XZ0D 2JU2A 4H2YC 1ACPA 2FQ1A 5KP6B 1T8KA 2LMLA 4PXHB 2KG6A 4CA3A 2X2BA 3NY7B 3GZLA 2LTEA 2K0XA 5KP7B 2N6YA 2MR7A 2L4BA 2KOPA 2JU1A 2JGPA 2L22A 2FVAA 2FACA 2MVVA 4NEOA 2FHSC 2EHSA 2GDYA 2ROQA 2CNRA 2FADA 4IZ6A 2FQ2A 2LIWA 2FVFA 1DNYA 4HKGA 2N6ZA 2AFDA 2K94A 5KP8B 2N5IA 2KOSA 2VSQA 5HV8A 2AFEA 2K0YA 2CQ8A 2FVEA 2LIUA 2FAEA 4BPHA 2MY5A 2N50A 2KORA 2AF8A 1L0HA 1AF8A 2KR5A 2KW2A 2KOOA 4R0MA 2CG5B 2KWLA 1X3OA 2N98A 3EJDA 2MF4A 2FQ0A 3GZMA 4H2XC 2XZ1C 4PWVB 2LOLA 3LMOA 4MRTC 2QNWA 4BPFA 2KGEA 2KGAA 3EJEA 2JQ4A 2CGQA 3RG2A 2EHTA 3EJBA 2M5RA 2KGDA 5CZDB 5HVCA 4BPGA 1F80D 2LKIA 2K2QA 2KG8A 2L0QA 2AVAA 2KGCA 1L0IA 2PNGA 1VKUA 5EJDA 2GDXA 4DG9A 4H2WC 2MVUA 2K93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR5 A;  1NQ4 A;  1HQB A;  2N5H A;  1KLP A;  2MR8 A;  3CE7 A;  2K92 A;  2LL8 A;  1HY8 A;  2L9F A;  2MD9 A;  1DV5 A;  2KG9 A;  2LPK A;  2KOQ A;  2DNW A;  2GDW A;  2XZ0 D;  2JU2 A;  4H2Y C;  1ACP A;  2FQ1 A;  5KP6 B;  1T8K A;  2LML A;  4PXH B;  2KG6 A;  4CA3 A;  2X2B A;  3NY7 B;  3GZL A;  2LTE A;  2K0X A;  5KP7 B;  2N6Y A;  2MR7 A;  2L4B A;  2KOP A;  2JU1 A;  2JGP A;  2L22 A;  2FVA A;  2FAC A;  2MVV A;  4NEO A;  2FHS C;  2EHS A;  2GDY A;  2ROQ A;  2CNR A;  2FAD A;  4IZ6 A;  2FQ2 A;  2LIW A;  2FVF A;  1DNY A;  4HKG A;  2N6Z A;  2AFD A;  2K94 A;  5KP8 B;  2N5I A;  2KOS A;  2VSQ A;  5HV8 A;  2AFE A;  2K0Y A;  2CQ8 A;  2FVE A;  2LIU A;  2FAE A;  4BPH A;  2MY5 A;  2N50 A;  2KOR A;  2AF8 A;  1L0H A;  1AF8 A;  2KR5 A;  2KW2 A;  2KOO A;  4R0M A;  2CG5 B;  2KWL A;  1X3O A;  2N98 A;  3EJD A;  2MF4 A;  2FQ0 A;  3GZM A;  4H2X C;  2XZ1 C;  4PWV B;  2LOL A;  3LMO A;  4MRT C;  2QNW A;  4BPF A;  2KGE A;  2KGA A;  3EJE A;  2JQ4 A;  2CGQ A;  3RG2 A;  2EHT A;  3EJB A;  2M5R A;  2KGD A;  5CZD B;  5HVC A;  4BPG A;  1F80 D;  2LKI A;  2K2Q A;  2KG8 A;  2L0Q A;  2AVA A;  2KGC A;  1L0I A;  2PNG A;  1VKU A;  5EJD A;  2GDX A;  4DG9 A;  4H2W C;  2MVU A;  2K93 A; 
#chains in the Genus database with same CATH topology
 1HQB A;  2MR8 A;  4QKO A;  1ZMB A;  2K92 A;  2DGY A;  2XXM A;  1Q81 Q;  2MD9 A;  2QEX P;  3I56 P;  3CCL P;  3HZQ A;  1IMP A;  3H4E A;  4H2Y C;  4PH1 A;  5DCK A;  1ACP A;  1T8K A;  3CC7 P;  3DS4 A;  1GXH A;  1VQP P;  3G29 A;  3GZL A;  1S72 P;  2PEJ A;  3WBH A;  1W2B O;  1QRJ A;  2JGP A;  2K0D X;  1EMV A;  3CME P;  2FHS C;  3DS5 A;  1YI2 P;  5F2K A;  2Z44 A;  3G4S P;  4M0I A;  2FAD A;  2GZE A;  2FQ2 A;  4F37 A;  1DNY A;  2KOS A;  2VSQ A;  2FVE A;  2FAE A;  2ONT A;  5HGN A;  4U0F A;  2AF8 A;  4GR2 A;  1L0H A;  2JBG A;  1NJI Q;  4XFY A;  2E1M A;  4U0A A;  2KWL A;  2JO0 A;  2N98 A;  1VQ8 P;  2FQ0 A;  1RO2 A;  3EJE A;  3G71 P;  5JPA A;  3RG2 A;  4COC A;  3EJB A;  1VQ4 P;  4BPG A;  3GKL C;  2LKI A;  1Z6M A;  2PY8 A;  2L0Q A;  2AVA A;  3CC2 P;  1K73 Q;  5EJD A;  2OAR A;  1BAJ A;  2NO8 A;  2VLN A;  1NQ4 A;  3Q20 A;  3CE7 A;  3CC4 P;  4U0E A;  4COP A;  2LPK A;  2DNW A;  3NTE A;  1FR2 A;  4IPY A;  1M6E X;  5KP6 B;  2LML A;  3CCQ P;  2KG6 A;  4CA3 A;  2X2B A;  2GZJ A;  3DPH A;  2L4B A;  1JJ2 O;  3OW2 O;  1D1D A;  2XT1 A;  2Z45 A;  2FVA A;  2FAC A;  4UHP B;  2MVV A;  4NEO A;  1Q86 Q;  5I4T G;  3E2D A;  3G1I A;  2EIA A;  4IZ6 A;  5BS1 A;  1YJW P;  1EOQ A;  1IMQ A;  2PEI A;  2M8L A;  2PEM A;  2AFE A;  2K0Y A;  2PEO A;  3CXC O;  3H47 A;  4BPH A;  2KOR A;  3CD6 P;  2GZF A;  2KOO A;  3DS0 A;  2CG5 B;  1X3O A;  2BHV A;  3EJD A;  2P9X A;  3G28 A;  2XZ1 C;  5HGO A;  2VLP A;  1BXI A;  2QNW A;  2PEQ A;  4BPF A;  1A8O A;  1M1K Q;  2CGQ A;  1VQK P;  2EHT A;  2KGD A;  5CZD B;  5HVC A;  2M8N A;  3CCS P;  2BUO A;  2EFJ A;  3HYB A;  3LRY A;  3B4Q A;  4XFZ A;  1UNK A;  2VLO A;  5F2O A;  1VKU A;  4H2W C;  2MVU A;  3G26 A;  3G1G A;  1OR5 A;  4U0B A;  1E0H A;  2N5H A;  3CPW O;  2L9F A;  2KOD A;  4XRO A;  1DV5 A;  2KG9 A;  2GDW A;  1MZ8 A;  3G6E P;  1YHQ P;  5HGL A;  1M90 Q;  2FQ1 A;  4GR6 A;  1KC8 Q;  4PXH B;  1VQ7 P;  1GXG A;  2LTE A;  1Q82 Q;  5KP7 B;  3CCM P;  2M8P A;  2JU1 A;  3G21 A;  3GJN A;  5HGM A;  2L22 A;  1VQ5 P;  2OTL P;  5EW5 E;  2EHS A;  1QVG O;  2GDY A;  2ROQ A;  1A43 A;  2K5X A;  2ERH A;  2FVF A;  4HKG A;  2N6Z A;  4U0D A;  5HV8 A;  2LIU A;  1RNI A;  1VQN P;  1YIT P;  4WYM A;  2N50 A;  1AF8 A;  3DS3 A;  3P05 A;  2KW2 A;  4R0M A;  2VLQ A;  4H2X C;  4PWV B;  2JB0 A;  3B5I A;  2GZG A;  2Z46 A;  2KGE A;  2WPT A;  2QA4 P;  1VQ6 P;  4PH0 A;  2GYK A;  4XRQ A;  5F2N A;  1YJ9 P;  1GPJ A;  1UJZ A;  7CEI A;  1CEI A;  2KGC A;  2PNG A;  4DG9 A;  2GZI A;  1M74 A;  2K93 A;  1YJN P;  1KLP A;  1K9M Q;  2CWO A;  1VQ9 P;  2LL8 A;  1HY8 A;  3MGE A;  5BS2 A;  1RO0 A;  3CMA P;  2KOQ A;  2XZ0 D;  2JU2 A;  1AYI A;  2JYL A;  3CCR P;  1N8R Q;  3G0V A;  3NY7 B;  3CCU P;  2OTJ P;  2K0X A;  3CCV P;  1K30 A;  2N6Y A;  2MR7 A;  2KOP A;  3I55 P;  2JAZ A;  1AUM A;  2CNR A;  3DTJ A;  1QVF O;  2LIW A;  3U43 A;  3M1M A;  2LF4 A;  2AFD A;  2K94 A;  5KP8 B;  2N5I A;  3VRL C;  2CQ8 A;  1KQS O;  3RG6 C;  4XFX A;  2MY5 A;  3CCE P;  1E6J P;  1KD1 Q;  1VQO P;  2XV6 A;  2KR5 A;  2PEN A;  2MF4 A;  3GZM A;  2LOL A;  3LMO A;  4MRT C;  1YIJ P;  3DS2 A;  2EG5 A;  2KGA A;  1IUQ A;  3CCJ P;  1EIA A;  2JYG A;  1M6N A;  2JQ4 A;  2M5R A;  1ZNV A;  1F80 D;  2K2Q A;  4U0C A;  2KG8 A;  2PEK A;  2L6E A;  3DS1 A;  1L0I A;  3H0D A;  1Q7Y Q;  1K8A Q;  1VHN A;  2GDX A;  4QNB A;  1VQL P;  1VQM P; 
#chains in the Genus database with same CATH homology
 1OR5 A;  1NQ4 A;  1HQB A;  2N5H A;  1KLP A;  2MR8 A;  3CE7 A;  2K92 A;  2LL8 A;  1HY8 A;  2L9F A;  2MD9 A;  1DV5 A;  2KG9 A;  2LPK A;  2KOQ A;  2DNW A;  2GDW A;  2XZ0 D;  2JU2 A;  4H2Y C;  1ACP A;  2FQ1 A;  5KP6 B;  1T8K A;  2LML A;  4PXH B;  2KG6 A;  4CA3 A;  2X2B A;  3NY7 B;  3GZL A;  2LTE A;  2K0X A;  5KP7 B;  2N6Y A;  2MR7 A;  2L4B A;  2KOP A;  2JU1 A;  2JGP A;  2L22 A;  2FVA A;  2FAC A;  2MVV A;  4NEO A;  2FHS C;  2EHS A;  2GDY A;  2ROQ A;  2CNR A;  2FAD A;  4IZ6 A;  2FQ2 A;  2LIW A;  2FVF A;  1DNY A;  4HKG A;  2N6Z A;  2AFD A;  2K94 A;  5KP8 B;  2N5I A;  2KOS A;  2VSQ A;  5HV8 A;  2AFE A;  2K0Y A;  2CQ8 A;  2FVE A;  2LIU A;  2FAE A;  4BPH A;  2MY5 A;  2N50 A;  2KOR A;  2AF8 A;  1L0H A;  1AF8 A;  2KR5 A;  2KW2 A;  2KOO A;  4R0M A;  2CG5 B;  2KWL A;  1X3O A;  2N98 A;  3EJD A;  2MF4 A;  2FQ0 A;  3GZM A;  4H2X C;  2XZ1 C;  4PWV B;  2LOL A;  3LMO A;  4MRT C;  2QNW A;  4BPF A;  2KGE A;  2KGA A;  3EJE A;  2JQ4 A;  2CGQ A;  3RG2 A;  2EHT A;  3EJB A;  2M5R A;  2KGD A;  5CZD B;  5HVC A;  4BPG A;  1F80 D;  2LKI A;  2K2Q A;  2KG8 A;  2L0Q A;  2AVA A;  2KGC A;  1L0I A;  2PNG A;  1VKU A;  5EJD A;  2GDX A;  4DG9 A;  4H2W C;  2MVU A;  2K93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...