2KORA

Nmr solution structures of 2-octenoyl-acp from streptomyces coelicolor fatty acid synthase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
81
structure length
81
Chain Sequence
AATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPDDDVKNLKTVGDATKYILDHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Recognition of intermediate functionality by acyl carrier protein over a complete cycle of fatty acid biosynthesis
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport protein
total genus 26
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2korA00
2LTEA 2JU1A 2EHSA 1HY8A 2AFDA 3NY7B 2N6YA 2KGDA 4PXHB 2LKIA 2FACA 4MRTC 2MVUA 2FHSC 1ACPA 2CGQA 4PWVB 5CZDB 2K93A 1KLPA 2FVEA 1AF8A 3RG2A 3EJDA 4H2WC 3GZMA 2ROQA 2KOSA 2M5RA 2FQ2A 2KORA 2K0YA 3GZLA 4HKGA 2MD9A 2N50A 4NEOA 4H2XC 2LPKA 2KG6A 2K94A 2QNWA 2KG9A 2KR5A 2L22A 1F80D 2KOPA 2GDXA 2PNGA 2EHTA 2FQ1A 2CG5B 2GDYA 5KP6B 2KGAA 2N6ZA 2L4BA 4BPGA 1DV5A 1L0HA 5EJDA 2JU2A 2KG8A 2K2QA 2FVAA 2FQ0A 3EJBA 2LMLA 2GDWA 1X3OA 1NQ4A 2AVAA 2L9FA 2MF4A 1DNYA 2X2BA 4R0MA 2AFEA 2LOLA 2K92A 2XZ0D 1OR5A 2MVVA 4DG9A 2MR8A 2MY5A 2KOOA 5KP7B 2KGEA 1T8KA 2CNRA 2CQ8A 2DNWA 4IZ6A 1VKUA 2JQ4A 2KOQA 3EJEA 2LIUA 2LIWA 2VSQA 3CE7A 2FVFA 2MR7A 2KW2A 3LMOA 4H2YC 2FADA 5HV8A 5KP8B 1HQBA 2XZ1C 2KWLA 4BPFA 2JGPA 2AF8A 2L0QA 2N5HA 2FAEA 2K0XA 4BPHA 2N5IA 2N98A 5HVCA 1L0IA 2LL8A 4CA3A 2KGCA
chains in the Genus database with same CATH superfamily
3CCEP 2LTEA 2Z45A 1VQ8P 2N6YA 2XT1A 1VQ9P 5CZDB 1ZNVA 3I56P 4XFYA 1AF8A 3RG2A 2BHVA 1M6NA 3G6EP 2ROQA 2K0YA 1VQOP 3DPHA 4NEOA 4PH1A 3G29A 2KG9A 2KR5A 2L22A 1M90Q 1GPJA 3DS4A 2CG5B 5KP6B 2KGAA 4BPGA 3RG6C 1KD1Q 5EJDA 1Z6MA 2FVAA 1Q7YQ 1EIAA 1ZMBA 1M6EX 1D1DA 4R0MA 1EOQA 2AFEA 2K92A 2XZ0D 4XFZA 1OR5A 2MVVA 4DG9A 2MR8A 2PEIA 2VLNA 3B4QA 2KGEA 1VQLP 3B5IA 1Q86Q 2VLQA 2DNWA 1A8OA 1VKUA 3NTEA 4UHPB 2KOQA 3CCJP 2ERHA 2FVFA 2MR7A 3DTJA 2KW2A 1CEIA 4H2YC 3GJNA 5HV8A 2PENA 2Z44A 1M74A 2AF8A 5EW5E 2M8PA 2K0XA 3M1MA 2N98A 4U0CA 2KGCA 2PEQA 3NY7B 2KGDA 2VLPA 4PXHB 3MGEA 2FACA 1K73Q 4MRTC 2LF4A 5DCKA 2JBGA 2FHSC 1BAJA 4PH0A 1ACPA 2CGQA 4PWVB 1K8AQ 4H2WC 4F37A 2K5XA 5F2NA 2VLOA 2FQ2A 2M5RA 4HKGA 2N50A 3DS0A 2EFJA 2KG6A 2E1MA 7CEIA 1QVGO 3U43A 2GDXA 2XV6A 2EHTA 3CCVP 3CCSP 1YITP 2N6ZA 4U0AA 1DV5A 3CCRP 3CMEP 2KG8A 4U0EA 1A43A 2OARA 2FQ0A 2LMLA 2GDWA 1X3OA 2L9FA 3E2DA 3GKLC 2X2BA 2GZJA 2DGYA 3CCLP 4U0DA 2NO8A 3I55P 5JPAA 1T8KA 2CNRA 2JO0A 1NJIQ 2JQ4A 1UJZA 2LIUA 2LIWA 2VSQA 1VQ6P 1Q82Q 3CCMP 1VHNA 2FADA 5KP8B 3G1IA 1Q81Q 4U0BA 2L6EA 2JGPA 1RNIA 2FAEA 5F2KA 5BS2A 3HZQA 2JU1A 2EHSA 2PY8A 4COCA 1HY8A 2JYLA 1FR2A 3DS1A 1YJNP 2JB0A 2LKIA 3G4SP 1JJ2O 5I4TG 1KLPA 3G0VA 1YI2P 3CC7P 2FVEA 3CD6P 2WPTA 3EJDA 3GZMA 3CCQP 2XXMA 2KODA 1AUMA 2JYGA 2KORA 2M8NA 2MD9A 2PEJA 3LRYA 4H2XC 4QNBA 2K94A 2QNWA 3CC2P 1F80D 4XFXA 2PNGA 2PEMA 3G21A 2L4BA 3G71P 4M0IA 1KC8Q 1L0HA 2JU2A 3EJBA 1IMQA 1UNKA 3CPWO 2MF4A 1DNYA 3CXCO 1RO0A 2M8LA 1VQKP 2GYKA 2GZEA 3H0DA 1E0HA 5HGNA 1M1KQ 5KP7B 2EG5A 3G1GA 1YIJP 1GXHA 1QRJA 3G28A 1VQMP 1VQPP 1MZ8A 2ONTA 2CQ8A 1IUQA 4GR6A 4WYMA 4IZ6A 2PEKA 2Z46A 1RO2A 1S72P 2GZIA 1QVFO 3WBHA 2L0QA 1GXGA 1K9MQ 3CCUP 2CWOA 2N5IA 4XRQA 5HVCA 1L0IA 2LL8A 4CA3A 4GR2A 2QEXP 2AFDA 5HGOA 2MVUA 1VQNP 2K93A 1KQSO 2OTJP 1BXIA 1E6JP 1YHQP 3VRLC 2P9XA 2GZGA 3G26A 1VQ5P 3H4EA 2KOSA 4XROA 3GZLA 2QA4P 3DS5A 2LPKA 2GZFA 2JAZA 1YJ9P 3DS2A 2KOPA 2FQ1A 2GDYA 1VQ7P 1W2BO 3Q20A 3DS3A 2BUOA 2K2QA 2OTLP 3HYBA 4IPYA 1NQ4A 2AVAA 1VQ4P 3OW2O 2PEOA 1N8RQ 2LOLA 2K0DX 1IMPA 2MY5A 1K30A 5HGMA 3P05A 2KOOA 5HGLA 4COPA 3H47A 5F2OA 1EMVA 3EJEA 1YJWP 3CMAP 3CE7A 3LMOA 4QKOA 4U0FA 3CC4P 1HQBA 2XZ1C 2KWLA 4BPFA 1AYIA 2EIAA 5BS1A 2N5HA 4BPHA
chains in the Genus database with same CATH topology
2LTEA 2JU1A 2EHSA 1HY8A 2AFDA 3NY7B 2N6YA 2KGDA 4PXHB 2LKIA 2FACA 4MRTC 2MVUA 2FHSC 1ACPA 2CGQA 4PWVB 5CZDB 2K93A 1KLPA 2FVEA 1AF8A 3RG2A 3EJDA 4H2WC 3GZMA 2ROQA 2KOSA 2M5RA 2FQ2A 2KORA 2K0YA 3GZLA 4HKGA 2MD9A 2N50A 4NEOA 4H2XC 2LPKA 2KG6A 2K94A 2QNWA 2KG9A 2KR5A 2L22A 1F80D 2KOPA 2GDXA 2PNGA 2EHTA 2FQ1A 2CG5B 2GDYA 5KP6B 2KGAA 2N6ZA 2L4BA 4BPGA 1DV5A 1L0HA 5EJDA 2JU2A 2KG8A 2K2QA 2FVAA 2FQ0A 3EJBA 2LMLA 2GDWA 1X3OA 1NQ4A 2AVAA 2L9FA 2MF4A 1DNYA 2X2BA 4R0MA 2AFEA 2LOLA 2K92A 2XZ0D 1OR5A 2MVVA 4DG9A 2MR8A 2MY5A 2KOOA 5KP7B 2KGEA 1T8KA 2CNRA 2CQ8A 2DNWA 4IZ6A 1VKUA 2JQ4A 2KOQA 3EJEA 2LIUA 2LIWA 2VSQA 3CE7A 2FVFA 2MR7A 2KW2A 3LMOA 4H2YC 2FADA 5HV8A 5KP8B 1HQBA 2XZ1C 2KWLA 4BPFA 2JGPA 2AF8A 2L0QA 2N5HA 2FAEA 2K0XA 4BPHA 2N5IA 2N98A 5HVCA 1L0IA 2LL8A 4CA3A 2KGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LTE A;  2JU1 A;  2EHS A;  1HY8 A;  2AFD A;  3NY7 B;  2N6Y A;  2KGD A;  4PXH B;  2LKI A;  2FAC A;  4MRT C;  2MVU A;  2FHS C;  1ACP A;  2CGQ A;  4PWV B;  5CZD B;  2K93 A;  1KLP A;  2FVE A;  1AF8 A;  3RG2 A;  3EJD A;  4H2W C;  3GZM A;  2ROQ A;  2KOS A;  2M5R A;  2FQ2 A;  2KOR A;  2K0Y A;  3GZL A;  4HKG A;  2MD9 A;  2N50 A;  4NEO A;  4H2X C;  2LPK A;  2KG6 A;  2K94 A;  2QNW A;  2KG9 A;  2KR5 A;  2L22 A;  1F80 D;  2KOP A;  2GDX A;  2PNG A;  2EHT A;  2FQ1 A;  2CG5 B;  2GDY A;  5KP6 B;  2KGA A;  2N6Z A;  2L4B A;  4BPG A;  1DV5 A;  1L0H A;  5EJD A;  2JU2 A;  2KG8 A;  2K2Q A;  2FVA A;  2FQ0 A;  3EJB A;  2LML A;  2GDW A;  1X3O A;  1NQ4 A;  2AVA A;  2L9F A;  2MF4 A;  1DNY A;  2X2B A;  4R0M A;  2AFE A;  2LOL A;  2K92 A;  2XZ0 D;  1OR5 A;  2MVV A;  4DG9 A;  2MR8 A;  2MY5 A;  2KOO A;  5KP7 B;  2KGE A;  1T8K A;  2CNR A;  2CQ8 A;  2DNW A;  4IZ6 A;  1VKU A;  2JQ4 A;  2KOQ A;  3EJE A;  2LIU A;  2LIW A;  2VSQ A;  3CE7 A;  2FVF A;  2MR7 A;  2KW2 A;  3LMO A;  4H2Y C;  2FAD A;  5HV8 A;  5KP8 B;  1HQB A;  2XZ1 C;  2KWL A;  4BPF A;  2JGP A;  2AF8 A;  2L0Q A;  2N5H A;  2FAE A;  2K0X A;  4BPH A;  2N5I A;  2N98 A;  5HVC A;  1L0I A;  2LL8 A;  4CA3 A;  2KGC A; 
#chains in the Genus database with same CATH topology
 3CCE P;  2LTE A;  2Z45 A;  1VQ8 P;  2N6Y A;  2XT1 A;  1VQ9 P;  5CZD B;  1ZNV A;  3I56 P;  4XFY A;  1AF8 A;  3RG2 A;  2BHV A;  1M6N A;  3G6E P;  2ROQ A;  2K0Y A;  1VQO P;  3DPH A;  4NEO A;  4PH1 A;  3G29 A;  2KG9 A;  2KR5 A;  2L22 A;  1M90 Q;  1GPJ A;  3DS4 A;  2CG5 B;  5KP6 B;  2KGA A;  4BPG A;  3RG6 C;  1KD1 Q;  5EJD A;  1Z6M A;  2FVA A;  1Q7Y Q;  1EIA A;  1ZMB A;  1M6E X;  1D1D A;  4R0M A;  1EOQ A;  2AFE A;  2K92 A;  2XZ0 D;  4XFZ A;  1OR5 A;  2MVV A;  4DG9 A;  2MR8 A;  2PEI A;  2VLN A;  3B4Q A;  2KGE A;  1VQL P;  3B5I A;  1Q86 Q;  2VLQ A;  2DNW A;  1A8O A;  1VKU A;  3NTE A;  4UHP B;  2KOQ A;  3CCJ P;  2ERH A;  2FVF A;  2MR7 A;  3DTJ A;  2KW2 A;  1CEI A;  4H2Y C;  3GJN A;  5HV8 A;  2PEN A;  2Z44 A;  1M74 A;  2AF8 A;  5EW5 E;  2M8P A;  2K0X A;  3M1M A;  2N98 A;  4U0C A;  2KGC A;  2PEQ A;  3NY7 B;  2KGD A;  2VLP A;  4PXH B;  3MGE A;  2FAC A;  1K73 Q;  4MRT C;  2LF4 A;  5DCK A;  2JBG A;  2FHS C;  1BAJ A;  4PH0 A;  1ACP A;  2CGQ A;  4PWV B;  1K8A Q;  4H2W C;  4F37 A;  2K5X A;  5F2N A;  2VLO A;  2FQ2 A;  2M5R A;  4HKG A;  2N50 A;  3DS0 A;  2EFJ A;  2KG6 A;  2E1M A;  7CEI A;  1QVG O;  3U43 A;  2GDX A;  2XV6 A;  2EHT A;  3CCV P;  3CCS P;  1YIT P;  2N6Z A;  4U0A A;  1DV5 A;  3CCR P;  3CME P;  2KG8 A;  4U0E A;  1A43 A;  2OAR A;  2FQ0 A;  2LML A;  2GDW A;  1X3O A;  2L9F A;  3E2D A;  3GKL C;  2X2B A;  2GZJ A;  2DGY A;  3CCL P;  4U0D A;  2NO8 A;  3I55 P;  5JPA A;  1T8K A;  2CNR A;  2JO0 A;  1NJI Q;  2JQ4 A;  1UJZ A;  2LIU A;  2LIW A;  2VSQ A;  1VQ6 P;  1Q82 Q;  3CCM P;  1VHN A;  2FAD A;  5KP8 B;  3G1I A;  1Q81 Q;  4U0B A;  2L6E A;  2JGP A;  1RNI A;  2FAE A;  5F2K A;  5BS2 A;  3HZQ A;  2JU1 A;  2EHS A;  2PY8 A;  4COC A;  1HY8 A;  2JYL A;  1FR2 A;  3DS1 A;  1YJN P;  2JB0 A;  2LKI A;  3G4S P;  1JJ2 O;  5I4T G;  1KLP A;  3G0V A;  1YI2 P;  3CC7 P;  2FVE A;  3CD6 P;  2WPT A;  3EJD A;  3GZM A;  3CCQ P;  2XXM A;  2KOD A;  1AUM A;  2JYG A;  2KOR A;  2M8N A;  2MD9 A;  2PEJ A;  3LRY A;  4H2X C;  4QNB A;  2K94 A;  2QNW A;  3CC2 P;  1F80 D;  4XFX A;  2PNG A;  2PEM A;  3G21 A;  2L4B A;  3G71 P;  4M0I A;  1KC8 Q;  1L0H A;  2JU2 A;  3EJB A;  1IMQ A;  1UNK A;  3CPW O;  2MF4 A;  1DNY A;  3CXC O;  1RO0 A;  2M8L A;  1VQK P;  2GYK A;  2GZE A;  3H0D A;  1E0H A;  5HGN A;  1M1K Q;  5KP7 B;  2EG5 A;  3G1G A;  1YIJ P;  1GXH A;  1QRJ A;  3G28 A;  1VQM P;  1VQP P;  1MZ8 A;  2ONT A;  2CQ8 A;  1IUQ A;  4GR6 A;  4WYM A;  4IZ6 A;  2PEK A;  2Z46 A;  1RO2 A;  1S72 P;  2GZI A;  1QVF O;  3WBH A;  2L0Q A;  1GXG A;  1K9M Q;  3CCU P;  2CWO A;  2N5I A;  4XRQ A;  5HVC A;  1L0I A;  2LL8 A;  4CA3 A;  4GR2 A;  2QEX P;  2AFD A;  5HGO A;  2MVU A;  1VQN P;  2K93 A;  1KQS O;  2OTJ P;  1BXI A;  1E6J P;  1YHQ P;  3VRL C;  2P9X A;  2GZG A;  3G26 A;  1VQ5 P;  3H4E A;  2KOS A;  4XRO A;  3GZL A;  2QA4 P;  3DS5 A;  2LPK A;  2GZF A;  2JAZ A;  1YJ9 P;  3DS2 A;  2KOP A;  2FQ1 A;  2GDY A;  1VQ7 P;  1W2B O;  3Q20 A;  3DS3 A;  2BUO A;  2K2Q A;  2OTL P;  3HYB A;  4IPY A;  1NQ4 A;  2AVA A;  1VQ4 P;  3OW2 O;  2PEO A;  1N8R Q;  2LOL A;  2K0D X;  1IMP A;  2MY5 A;  1K30 A;  5HGM A;  3P05 A;  2KOO A;  5HGL A;  4COP A;  3H47 A;  5F2O A;  1EMV A;  3EJE A;  1YJW P;  3CMA P;  3CE7 A;  3LMO A;  4QKO A;  4U0F A;  3CC4 P;  1HQB A;  2XZ1 C;  2KWL A;  4BPF A;  1AYI A;  2EIA A;  5BS1 A;  2N5H A;  4BPH A; 
#chains in the Genus database with same CATH homology
 2LTE A;  2JU1 A;  2EHS A;  1HY8 A;  2AFD A;  3NY7 B;  2N6Y A;  2KGD A;  4PXH B;  2LKI A;  2FAC A;  4MRT C;  2MVU A;  2FHS C;  1ACP A;  2CGQ A;  4PWV B;  5CZD B;  2K93 A;  1KLP A;  2FVE A;  1AF8 A;  3RG2 A;  3EJD A;  4H2W C;  3GZM A;  2ROQ A;  2KOS A;  2M5R A;  2FQ2 A;  2KOR A;  2K0Y A;  3GZL A;  4HKG A;  2MD9 A;  2N50 A;  4NEO A;  4H2X C;  2LPK A;  2KG6 A;  2K94 A;  2QNW A;  2KG9 A;  2KR5 A;  2L22 A;  1F80 D;  2KOP A;  2GDX A;  2PNG A;  2EHT A;  2FQ1 A;  2CG5 B;  2GDY A;  5KP6 B;  2KGA A;  2N6Z A;  2L4B A;  4BPG A;  1DV5 A;  1L0H A;  5EJD A;  2JU2 A;  2KG8 A;  2K2Q A;  2FVA A;  2FQ0 A;  3EJB A;  2LML A;  2GDW A;  1X3O A;  1NQ4 A;  2AVA A;  2L9F A;  2MF4 A;  1DNY A;  2X2B A;  4R0M A;  2AFE A;  2LOL A;  2K92 A;  2XZ0 D;  1OR5 A;  2MVV A;  4DG9 A;  2MR8 A;  2MY5 A;  2KOO A;  5KP7 B;  2KGE A;  1T8K A;  2CNR A;  2CQ8 A;  2DNW A;  4IZ6 A;  1VKU A;  2JQ4 A;  2KOQ A;  3EJE A;  2LIU A;  2LIW A;  2VSQ A;  3CE7 A;  2FVF A;  2MR7 A;  2KW2 A;  3LMO A;  4H2Y C;  2FAD A;  5HV8 A;  5KP8 B;  1HQB A;  2XZ1 C;  2KWL A;  4BPF A;  2JGP A;  2AF8 A;  2L0Q A;  2N5H A;  2FAE A;  2K0X A;  4BPH A;  2N5I A;  2N98 A;  5HVC A;  1L0I A;  2LL8 A;  4CA3 A;  2KGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...