1VQNP

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqnP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqnP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqnP02
1NJIQ 1VQ6P 3CCLP 3CXCO 1QVFO 2OTJP 1YJWP 1VQ5P 1YI2P 1Q82Q 1VQLP 1Q7YQ 1KC8Q 1QVGO 2QA4P 1KQSO 3CPWO 1VQKP 1VQOP 1W2BO 1S72P 1VQ8P 1VQNP 1K9MQ 1YJNP 3CCMP 1M1KQ 3CC2P 3CCQP 3CCUP 1KD1Q 3CCJP 3CMEP 1Q81Q 3G6EP 3CC4P 1YHQP 3CCSP 1VQMP 3I56P 3CCRP 1YIJP 3CMAP 3OW2O 1M90Q 1YITP 1JJ2O 3CCEP 1N8RQ 1K8AQ 3CC7P 1Q86Q 1K73Q 3I55P 3CCVP 3G71P 1VQ7P 3G4SP 2OTLP 2QEXP 1VQPP 1VQ9P 1VQ4P 1YJ9P 3CD6P
chains in the Genus database with same CATH superfamily
1LT9C 1M8OB 4K3AA 1GPJA 5KAIE 3DS1A 1EOQA 3SFDC 1NTMK 1VQNP 3B5NB 3H25A 4ZNCA 2KGCA 1OWAA 2I1JA 1W2EA 1JMBA 3DPHA 1LWUB 2FKWB 3BVHA 4WY4C 1KYOD 2WPQA 1Q7YQ 1NWQA 5CJ0A 4PV1C 3FX0A 4WYMA 2PAJA 4IL6X 4D6TE 2SPZA 2PEQA 1NAYA 3Q5SA 2M5RA 1MZ9A 1K73Q 2M8NA 4GODA 1HBWA 2QEXP 3CXHE 1YTZI 1J1DC 1ZR2A 5CBNA 1E6JP 3H1JD 2W90A 3RG2A 3AE2C 4BRYA 3W68A 1NTKJ 1SQXD 3CCQP 3H1KD 3HE5A 2AFEA 2WPVB 1A02F 2PEOA 1LT1A 1SFCC 3GLMA 2ZXXA 3A5TA 3BATA 1WT6A 1L0LJ 5KP6B 2PRRA 2QJPB 3PP5A 2KGAA 2E75B 2GDYA 2A06D 1SQQE 1LTTC 2JWDA 1OX3A 3P32A 2PNGA 2A45I 3M91A 2VLNA 3CE7A 2LTEA 4XFJA 1VQMP 1NU1K 1UIXA 2OYIB 2EIAA 4XA4A 1HGVA 1SQVE 3B4SA 1HWTC 1IO4A 3HTKA 2XZRA 1GW3A 2CNRA 1KILC 1KB9E 1J2JB 1M1JA 1QEXA 3NTNA 3AEBC 3KQGA 2LF4A 1IK9A 4L73A 2L91A 2Y9YA 1Q81Q 1GW4A 1EXIA 3TDKA 2E76D 2LMLA 1UIIA 2ZFCA 5B5EH 4JBZA 2B88A 2KOOA 3WUVA 5KJ7D 2OYOA 1G1JA 3B71A 3SFEC 3E1IA 3HRNA 3L75D 3L73E 1FZCB 2BCCG 1JY3P 2HPCB 2Q7CA 1SQBE 2IFNA 4C7NA 3R4YA 5AW7B 2ZAEB 1IMPA 1H89A 2J58A 2KG9A 5F2NA 3JCUH 2K2QA 1AVYA 3BRVB 1P84I 1VKUA 3MD0A 1QL2A 2WSSH 2QE7H 3B5NC 3DS4A 5H2FE 1HY8A 2EHSA 3AEEC 3L70G 4WY4D 4COCA 2GUVA 2OYHC 1T2KC 1PGPA 4PV1D 1KYOE 3MUDA 1Q86Q 3L72D 2GZEA 4WB4A 1RHZB 1ZV8A 3PRJA 4IZ6A 1EDKA 1UNKA 2JQ4A 1NTMJ 5E79E 1A02J 1RF1B 2Y0DA 1IZNB 1FZFA 2W6AA 3CX5D 2M5AA 2IYOA 4HYTB 3H1JE 3OA7A 3LMOA 1USEA 1E0HA 1IFIA 2WVRA 1SQXE 3D70A 1SFCD 3H1KE 3UIAA 1CW5A 5CBOA 1QVGO 2VRSA 2R5DA 5AVQB 1X0TA 3HUSC 2O3JA 2ZT9B 1PP9G 3KZIH 2A06E 2MVUA 1MZ8A 1BE3J 4IL6H 5KLVD 1SQPK 4HH2A 1YJWP 1OW7A 1PPJD 1QRJA 2IBZD 1Y9BA 3D71A 5AVSB 4PWVB 1KILD 3NXSA 4COPA 2WQYC 2N5HA 1EMVA 1GL2A 3AE7C 3CL3D 3TSIA 2MF4A 1HGZA 3VP8A 3H1ID 1PEUA 1K8AQ 2BCCJ 3G4SP 3GF7A 2KGEA 4M3LA 2G3AA 1KTMA 3L71G 3CPWO 2JJLA 1OZHA 3H1LG 2XZ0D 2KI7B 2B87B 3G6EP 3CC4P 2FHSC 1S9KD 3II6A 3VMYA 3GHGB 3L75E 3L70J 1WMKA 5TISH 1S5LX 5EFWB 3EFGA 1AVOA 2PP6A 1PEQA 1FR2A 3H1HJ 3DS0A 4GT1A 1EZVI 4H2YC 1FU1A 2NPSA 1BCCD 1JMMA 3B5ND 3M0DC 3MIWA 1T2KD 1ZR4A 1RQVA 5KP8B 1NH4A 3V2RA 3L72E 2H43A 5CCGA 3S9OA 3Q20A 1U57A 1CEIA 4CA3A 2W6BA 3FWLA 3V2QA 3PLNA 2VSQA 1UJZA 1BGYD 3Q1MA 2AEJA 4OH8B 1CI6A 3M9BA 3HD7A 5GTHE 3V4WA 3L74E 3DS3A 1BDCA 1URQC 3KDPB 5AW4B 4U0EA 2JAZA 1X22A 3H4EA 2BHVA 5CHXA 2C0XA 1LTIC 2KSJA 2MD9A 2ZJSE 1FS0E 3EJEA 2KR5A 3BCCE 2E76B 2QM8A 2HODA 4IFDK 3FGAD 5KLVK 5HGNA 3L71J 4ZKPA 2IBZE 1PPJE 4JF7A 3H1LJ 3M06A 2K94A 2E42A 1NTZG 1AQ5A 1Q90D 1L4AA 1L0NG 1VF5B 1LT9B 3M1MA 1LGHB 3CWBD 3M9QA 2BASA 3VTPC 4ZMDA 3OW2O 2MKVA 1JM0A 1NO4A 5DCKA 2E5TA 1SQPJ 2OTKE 5BU5A 3L35A 1KFMA 2G8YA 3ZDMA 1JTHB 1XTGB 4WY4B 3MGEA 1S9KE 4R4MA 1AV1A 1E5WA 2YXRB 4UHPB 1X8YA 2PENA 1KD1Q 3CCJP 1H88A 2QSIA 2LIWA 2CWOA 3RBXA 1GZLA 4H0LC 2JYGA 2C9NY 1LTJC 2KG8A 3GHGC 1Y8AA 2MY5A 5APWA 1J1DB 2BQ1E 1RF0C 1VQ6P 3TGUJ 1VDFA 2FFDA 3TNUB 3EJDA 1JEKA 1IUQA 3MP7B 1SFCB 5KKZC 1N8RQ 4I2LC 2VLPA 2NO8A 1AF8A 5CCHD 1VQPP 2N6ZA 2FYUK 2WPSA 2K0YA 1L0LE 1VL2A 2M8LA 1PGQA 2Z5HA 3CCMP 2ZXEB 2Z45A 3GW6A 1BGYE 4XROA 2JP3A 2MJZA 3G21A 4GDOA 4DJGA 1URQD 2Z5IA 2XZ1C 1GDTA 1NTKG 2Y0EA 2M3BA 3S4RA 1LTAC 1S2EA 3CXHH 3G9RA 4MN4C 4AUWA 5HVCA 1FZGA 1NTZJ 1J1EC 2M8PA 1FAVA 1L0NJ 1LWUA 4WVZA 3CCSP 4BPHA 1DH3A 1K04A 1KB9D 1NHLA 3VN0A 4BXLA 4Y28J 3AE9C 2P10A 3A0BE 4L74A 3JSVC 2JO1A 5GTIE 1FBMA 1CZQA 1FZAA 2Q1KA 1NKNA 3ITKA 3KHUA 2V7QH 1Z56A 3BRTB 3H0DA 3TF5A 3L73D 3AEAC 5KJ7C 1CSBA 4UB8E 1SQBD 1G2CB 1VF5C 1T8ZA 1N73C 4IFMA 4QKOA 1OVRA 3EJBA 2OYHB 2ROQA 2A45G 3G1GA 4PD4D 1HTLC 1M6EX 3U1AA 4H0LD 4OVNF 4MRTC 5B66E 2QIWA 2MR7A 5KP7B 5BVZA 2HG5D 2J59M 4ASVA 4KT0J 3L37A 1RE4A 2OYIA 2ZYDA 1HF9A 4O9BA 4NPDA 4EIJA 3N4XA 2ZYGA 3PTZA 1PP9D 3CC7P 1QLED 3RK2D 2JWAA 2X2BA 2LXCB 2FQ0A 3A0HE 1ZNVA 3JC22 2EFJA 1OVVA 5APQA 1OW8A 5L8RJ 2RMZA 1NAFA 2QM7A 4IPYA 1MKMA 4W80A 3HUSB 1YIJP 5H2FH 1SS1A 2KOPA 1ZRTD 2KIKA 1FOSE 1NTMG 2Y9ZA 4W7ZA 1FE6A 1VQ7P 1OVUA 1NYHA 1FZCA 4DT0A 3G28A 3O6QB 1KYOH 2HPCA 3Q3DA 1BAJA 3CD6P 1SQQK 1PIXA 2N9YB 2EHTA 1N7SC 1FZBA 2CQ8A 5E79H 2R3SA 1JNMA 2FVEA 1SQVK 1D7MA 4TLFA 1QGKB 2AFDA 2IDBA 2BCCE 2FYUJ 5APXA 2JU1A 3GZMA 3CC2P 1BE3G 3NFQA 3VYIA 1JJ2O 5AVVB 4PJ0H 4U0FA 2CPSA 1MV8A 2N1TC 3OAKA 2HR3A 1WRGA 2NZ2A 3L70E 1RF1A 4DZOA 2K3RA 2FYZA 4I7ZC 3EWKA 1SQBK 3I5CA 2Z44A 1VF5D 1KQFB 2QNWA 1LP1B 2AEFA 3G0VA 3MHVA 1OW6A 2WSFH 2KUBA 3WBHA 2OQQA 5AVXB 2DGYA 4U3FG 2PEJA 3HE4A 1HQBA 1JOCA 1NU1G 1FJPA 1YTZT 1YYCA 4PD4E 2K92A 2AXCA 3U1CA 2N98A 2WWWA 3V2PA 5AW9B 5AW2B 3H1HG 4GR6A 5AVYB 3AEDC 3CXHI 2W27A 2K93A 1SLQA 2YXQB 1PP9E 1URQB 1EDIA 1BXIA 1GTWA 4F37A 5HGOA 3G29A 3L74D 1SQXK 1ZOYC 3AE3C 4YTPC 1NOHA 3DTJA 1Z6MA 2B87A 2K9YA 5DJUB 4D6TJ 1ZRTE 4PH0A 3G26A 3GHGA 3QWOC 1T3UA 2Z4EA 2HYNA 1EZVG 3BCCD 1N7SD 4C7NB 2JEEA 4L76A 2WT7B 1RE3A 1NJIQ 5BS2A 1ZW0A 1AA0A 5AW3B 5B5EE 2WSCH 3GZLA 3CX5H 3LIEA 2KWLA 3OJAB 5GTHH 1PZQA 4I6MC 2M0BA 1YITP 2V7QJ 4Y99C 2OTLP 2R5BA 2ZYAA 3AE5C 2Q3EA 2KZIA 3P8MC 2KLVA 4R4LA 1SQQJ 1PGJA 3DS5A 1VPCA 3CXCO 2JO0A 2N1TD 3T97B 1K05A 3WU2E 4U3FJ 3AE8C 3JCUE 1NU1J 2GYKA 4H0LB 3M0AA 1KQLA 1SQVJ 1LTJB 3G71P 2K5XA 1FC2C 1IFMA 2C0WA 4BPGA 1S4XA 1OFCX 2Q5UA 5AVRB 1JY3O 4DOJA 1H8AA 1SQPG 2ONTA 4XE5B 3RK2B 2L22A 5KKZB 4WBAA 2GZIA 3L4FA 4PXHB 4IFFA 1KYOI 2GZFA 1N86A 1IC2A 1NTKD 3TK1A 2YIUC 2JDIH 3S1KA 1R8EA 3U43A 4CPGA 2KOSA 2H8PD 1R5SA 3HYBA 1Y47A 5KJ7A 2FXMA 2D2CD 2Q6QA 3H32B 1FZEA 5CCHC 1L0LD 3TGUG 1LT9A 2Q3IA 1E79H 4GOFA 1EC5A 1K9MQ 2JKVA 3KZIE 1GU4A 1J1EB 4KHXA 2KP8A 1M1JC 1NTZE 4IL6E 1EDJA 4HB1A 1L0NE 2M8RA 2R32A 2GUSA 1JTHA 2MR8A 2P67A 4WY4A 1ZN5A 2VLOA 1LJ2A 1H0TB 5CJ4A 2FBWC 1LTBC 2E1MA 3BASA 5APUA 1W2BO 1KV4A 3AE6C 2FACA 1S1CX 3H1JJ 2E5YA 3P8CD 3GG2A 1JUNA 1SQXJ 3H1KJ 3TNUA 1X9VA 3E2DA 3RGUA 4H13C 1KC8Q 3N7NA 3EQ2A 1N73B 1SFCA 4JYCA 2K0XA 1AJYA 2C9LY 1LNQA 4YPCA 2W8ZA 4KJMA 1KN7A 4JQ0D 4A7PA 1RO0A 2O1JA 1RH5B 4XRQA 3I55P 2AXTE 2PFXA 3F89A 1FDIA 4BPFA 3MUDC 3A0BH 3AE1C 5AW8B 2WSFJ 4EYYQ 4ZKUA 3RK3C 3WMM0 3HD7B 2LKMA 2FYNB 1GMJA 2Q9IA 2O01H 2GA1A 1KILA 4U0BA 2L4BA 5BU8B 1NTMD 4QNBA 5KLVG 1LTGC 2JR8A 4N3YB 2IX7C 3M9HA 2XNDH 4UB8H 2FAEA 1JY2N 2QVAA 1P84D 5HGMA 4U7JA 2P9XA 2CPBA 2AF8A 1GK4A 5KAIH 1NTKE 3L75J 4LC1A 3H1IG 3RK2C 4OGQD 2FQ1A 2GZJA 3B5IA 2POHA 1YJ9P 4DCKA 2I8DA 1FDMA 1L0LK 1JCCA 4EOTA 1PEOA 1TU3F 1VQOP 3CX5I 2NRGA 1L0IA 3DS2A 2K9JB 1N7SB 3SWKA 3NMDA 1BE3D 2QJKB 3G3ZA 3V4QA 2WPTA 1G2CA 3FXEA 2CGQA 1GL2C 2LOLA 2YMYA 3B5NA 2KG6A 2N9BA 4LLHA 5KAFE 5APTA 3L72J 2OYHA 2WMMA 3VP9A 2BCCD 1AYIA 4EI2A 1BCCG 1KZUB 2P58A 2FQ2A 2FVFA 2WSCJ 3GKLC 2CK3H 2N1TB 2KODA 2IBZI 2ZVOB 4HKGA 3P8CE 5EW5E 2XT1A 2EG5A 1Q82Q 1OMIA 2XU6A 3RBZA 4I7ZB 1DNYA 2PEIA 4H13D 4IOIH 2LPKA 5HGLA 1L0HA 2FYUG 2P1JA 3L70D 2E43A 2KNCB 2LL8A 3C8VA 1A8OA 2N50A 2NPSC 3H1HD 1NKZB 2JYLA 2OTJP 2WSEH 4U0AA 2ZVNB 3HUSA 5KLVJ 2KYVA 1KB9H 1OR5A 2KS1B 5CCGC 3RK3D 3PHLA 3RL0B 4HJGH 2WITA 1DEEG 5AVWB 1PGOA 3H1IJ 2D2CB 4RESB 1BSHA 5APVA 1NTME 4Z1MH 3PH0A 3CMEP 4H2WC 3HD7C 2FYNC 3CCRP 2IYPA 1EZVD 2WPRA 1P84E 4NPFX 5TJHA 1VQ9P 4H2XC 2HFED 1IMQA 1M7LA 5F2OA 1S5LE 3B8EB 1N7LA 3ABVC 3CWBG 3NY7B 1M74A 4DG9A 3VMAA 4GOEA 3E7KA 1U7MA 1AUMA 5AVUB 4PD4H 2V4HA 5AW0B 5I4TG 2E74C 2GM4A 3Q2YA 2XXMA 2QJYB 1BCCJ 1YQ3C 1BE3E 1JY2O 1AQTA 5AW6B 1GL2D 1IFDA 1L4AC 4NEOA 3L71D 3AEGC 1LP1A 4JYBA 1MFZA 5K5GB 3H1LD 1A43A 3M0DA 1KFNA 3VOPA 2QJKC 1DEBA 3KYQA 2PEKA 3GJNA 4Y99B 4D6TG 3Q5PA 4BWNA 5KLIC 2K88A 2YKOA 2RKLA 5AVTB 3LW5H 4B86A 5CCHA 1BGYJ 2YMKA 4EDFA 4GKGA 5EJDA 2GDWA 1JY3N 1QL1A 1SQPD 4UB6E 4U3FE 3LRYA 1FOSF 1NU1E 2KLUA 1T3JA 1NQ4A 1URQA 2LIUA 3SSUA 2NPSD 2K1AA 2PY8A 4H44B 1DIPA 3KXDA 1LTSC 1M57D 2IZ1A 2YKQA 1F80D 2FFDC 3H1HE 2R3CA 2FADA 1SQQG 1IFNA 4BRYB 1X79B 2JU2A 3H6PA 2O1KA 3HE5B 3VRLC 3TGUD 1ACPA 2UWJE 2PEMA 1HH0A 2KOQA 2YIUB 2GZGA 5CCGD 1RNIA 4U0CA 2O01J 1SQVG 3RK3E 1XTCC 4OGQB 1SP4A 1M90Q 3WU2H 3CWBJ 2WT7A 4R0MA 2L5GB 5AW5B 3RL0C 3HD7D 1JB0J 1X3OA 1PEMA 1MUUA 1FDOA 1VQLP 2KORA 1M56D 2D2CC 1EZVE 3FXDA 3HTKB 3RL0g 1S3JA 3CI9A 2JGPA 1OXZA 2J5UA 1M1JB 3L73G 3I56P 2IPPA 2R44A 1W5CE 1LWUC 1SQBG 2XKMA 1EQ7A 3T97A 2WZ7A 2B9BA 1GU5A 1NTZD 2RN0A 4W7YA 1L0ND 2E74D 1YI2P 4N78D 2QA4P 3V5BA 3D6ZA 1GK6A 1LTJA 1MFTA 2N6YA 2Z46A 1L4AD 2WTYA 1EDLA 1RF0A 4K35A 3F5HA 5CZDB 4AQRD 3L71E 2M3EA 4RO0A 3Q5RA 2QJYC 3H1LE 4H13B 4L75A 3WUTA 1KQSO 3B4QA 1FJKA 3HE4B 1KB9I 4PJ0E 1L2PA 2KOGA 3MGNA 1OIPA 1GXHA 1Q2NA 1PL5A 3H1JG 3NTEA 2QJPC 3AEFC 1SQPE 2E75C 2RH0A 3K5BA 3H32A 2KW2A 1G1IA 1SQXG 3LIDA 3H1KG 4JPZB 5AVZB 3RK3B 2LKIA 3IF4A 1EIAA 2WSEJ 1RE4C 2OYIC 1ZP0C 1N2DC 2ERHA 1ZXGA 4WWIA 1IFPA 1D1DA 2M5AB 4ASWA 1T6AA 3R2PA 3V6IA 2A06G 3D6YA 3SWFA 1U7JA 4QMAA 3TGUE 4H44C 5KTBA 3IAOA 1KLPA 4PD4I 2GDXA 2FY8A 1H0TA 4C46A 2QRXA 3HZQA 2IZ0A 2QG4A 2XV5A 3C9IA 2KGDA 2OARA 3L73J 2AXTH 1VQ5P 3RL0D 3IN6A 1FZCC 1GXGA 1SQBJ 4OGQC 2HLOA 2OGUA 2KXPB 3H47A 1YBKA 3A3YB 4OWFA 1R5LA 1DV5A 1GL2B 1N73A 4M0IA 3L75G 3AECC 1YJNP 1NTZK 1K30A 1L0NK 1KORA 3GMAA 2FYUD 4NPEA 4I1LA 2KSEA 2LR2A 4N78E 1SVFA 1ZMEC 1KQGB 2YO2A 5JPAA 3CX5E 2BEZF 3CCLP 1PP9J 1S72P 3CLQA 1RF1C 3G1IA 2FVAA 2XDJA 3LW5J 3AE4C 5F2KA 3L72G 3IFMA 3P7KA 2NPSB 2I1KA 3V2NA 3A7OA 4TT3H 3USSA 2L0QA 2BUOA 5KAFH 3CCUP 1DD4A 1USDA 2E75D 5KLVE 1DD3A 2ZT9C 3SWYA 3L74G 5TISE 3MZWB 5APSA 2L6EA 1NGMB 4YXWH 4HKZH 1KILE 2XV6A 2K9JA 1N7SA 1PV3A 5C39A 1VQKP 3H1IE 5BS1A 2O01N 3GF3A 4XFYA 5GTIH 1CI6B 1YHQP 2A45H 3BCCG 2FXOA 4H44D 1JO5A 2VLQA 1VQ4P 3QH9A 3W67A 4N6JA 5APYA 2IBZG 1PPJG 2PGDA 1PFIA 2H89C 4PH1A 1DX7A 1RY3A 4PV1B 4RKUJ 2YKPA 1NTKK 3FWNA 1RQUA 3VMXA 3L36A 2N1TA 3CCEP 1HUCA 2HODB 3P05A 2E74B 4D6TD 1M6NA 1QVFO 2BEQD 2H7HA 1BCCE 5M1BA 4XFXA 2YNYA 3PJSK 3IR9A 1L4AB 2H88C 1VQ8P 1RE3C 2KNCA 3CXHD 2AEMA 2JBGA 4AYCA 5B66H 4RJTA 2W6JH 3WUUA 3U59A 1IFJA 3RG6C 1KMIZ 2P7JA 1BSNA 2CG5B 5KLIB 1JY2P 2YO3A 1BDDA 1P84H 2FYUE 2B89A 2KS1A 1HJ0A 1S5LH 2MVVA 2AVAA 2K0DX 3A0HH 1IJDB 1IK7A 5HV8A 2FXPA 1SQQD 3EFFK 3TYYA 3E1RA 2K37A 3A2AA 2P2UA 1NVOA 1KILB 3O8ZA 4U3FD 1JCDA 3L74J 3VMZA 5AW1B 1NU1D 1YQ4C 2JB0A 1SQVD 2IFMA 4C7RA 7CEIA 4U0DA 1L0LG 2FFDB 2W83C 2ITAA 3CMAP 2L9FA 3KPEA 4LGDE 1T8KA 1RO2A 1VHNA 5DJTB 4YXDC 4XFZA 3CCVP 1HJBA 2Y0CA 1BGYG 2DNWA 2ZT9D 2KZJA 2N5IA 3BCCJ 3MTUE 2KB7P 2KK7A 2E76C 4GIFA 1M1KQ 1EXJA 1HVVA 2DW3A 4GR2A 3O6QA 1ZMBA 1GD2E 2LXBA 3CWBE 1AFOA 1ZLLA 4UB6H 3C1LA 2XNXA 5CMZA 1QX8A
chains in the Genus database with same CATH topology
5F2OA 3CCLP 1QVFO 1RNIA 4U0CA 3MGEA 1KC8Q 1M74A 4XFXA 1QVGO 3DS1A 1EOQA 1S72P 1VQ8P 1VQNP 2LF4A 3G1IA 2PENA 1KD1Q 3Q20A 3H0DA 3CCJP 1Q81Q 1AUMA 1EIAA 2ONTA 2CWOA 2JYGA 1M90Q 1BAJA 3CD6P 5HGOA 3G29A 3DPHA 5F2KA 1RO0A 3RG6C 5I4TG 4XRQA 3I55P 2XXMA 1D1DA 2KODA 2BQ1E 3DTJA 1PEMA 2XT1A 1VQ6P 1YJWP 2EG5A 1Q82Q 1QRJA 1VQLP 1Q7YQ 3DS3A 4PH0A 3HYBA 2BUOA 2PEIA 3G26A 3CC2P 1IUQA 4WYMA 3CCUP 4COPA 5HGLA 1A43A 4U0EA 2PEQA 3I56P 3H4EA 1JJ2O 1N8RQ 3G1GA 1PEUA 1A8OA 2BHVA 2PEKA 1M6EX 1K8AQ 4U0FA 1K73Q 3HZQA 4U0BA 2L6EA 2M8NA 5F2NA 4QNBA 3G4SP 2QEXP 1VQPP 2OARA 2XV6A 1E6JP 1NJIQ 2JYLA 2OTJP 5BS2A 4U0AA 1VQ5P 1YI2P 2M8LA 2QA4P 1VQKP 3CPWO 5BS1A 5HGMA 1K9MQ 4XFYA 3DS4A 2Z45A 3CCMP 2Z44A 3CCQP 5HGNA 2P9XA 4U0DA 3G6EP 3CC4P 4COCA 1YHQP 4XROA 2Z46A 2PEOA 3H47A 3CMAP 1YITP 3G21A 3LRYA 3G0VA 1RO2A 3CC7P 1Q86Q 4XFZA 3CCVP 2OTLP 3B5IA 3WBHA 2DGYA 1YJ9P 1VQ4P 2PEJA 3DS5A 4M0IA 3CXCO 2E1MA 1PEQA 1PEOA 2JO0A 4PH1A 3M1MA 1KQSO 1VQOP 1W2BO 2EFJA 2PY8A 1YJNP 3DS0A 1M1KQ 3DS2A 1K30A 2M8PA 4IPYA 3CMEP 3CCSP 4GR2A 1VQMP 1YIJP 3CCRP 3CCEP 3OW2O 2EIAA 1ZMBA 3VRLC 5DCKA 3P05A 3G71P 1VQ7P 1VQ9P 2PEMA 3G28A 3E2DA 4GR6A 5JPAA 3NTEA 1M6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI Q;  1VQ6 P;  3CCL P;  3CXC O;  1QVF O;  2OTJ P;  1YJW P;  1VQ5 P;  1YI2 P;  1Q82 Q;  1VQL P;  1Q7Y Q;  1KC8 Q;  1QVG O;  2QA4 P;  1KQS O;  3CPW O;  1VQK P;  1VQO P;  1W2B O;  1S72 P;  1VQ8 P;  1VQN P;  1K9M Q;  1YJN P;  3CCM P;  1M1K Q;  3CC2 P;  3CCQ P;  3CCU P;  1KD1 Q;  3CCJ P;  3CME P;  1Q81 Q;  3G6E P;  3CC4 P;  1YHQ P;  3CCS P;  1VQM P;  3I56 P;  3CCR P;  1YIJ P;  3CMA P;  3OW2 O;  1M90 Q;  1YIT P;  1JJ2 O;  3CCE P;  1N8R Q;  1K8A Q;  3CC7 P;  1Q86 Q;  1K73 Q;  3I55 P;  3CCV P;  3G71 P;  1VQ7 P;  3G4S P;  2OTL P;  2QEX P;  1VQP P;  1VQ9 P;  1VQ4 P;  1YJ9 P;  3CD6 P; 
#chains in the Genus database with same CATH topology
 1LT9 C;  1M8O B;  4K3A A;  1GPJ A;  5KAI E;  3DS1 A;  1EOQ A;  3SFD C;  1NTM K;  1VQN P;  3B5N B;  3H25 A;  4ZNC A;  2KGC A;  1OWA A;  2I1J A;  1W2E A;  1JMB A;  3DPH A;  1LWU B;  2FKW B;  3BVH A;  4WY4 C;  1KYO D;  2WPQ A;  1Q7Y Q;  1NWQ A;  5CJ0 A;  4PV1 C;  3FX0 A;  4WYM A;  2PAJ A;  4IL6 X;  4D6T E;  2SPZ A;  2PEQ A;  1NAY A;  3Q5S A;  2M5R A;  1MZ9 A;  1K73 Q;  2M8N A;  4GOD A;  1HBW A;  2QEX P;  3CXH E;  1YTZ I;  1J1D C;  1ZR2 A;  5CBN A;  1E6J P;  3H1J D;  2W90 A;  3RG2 A;  3AE2 C;  4BRY A;  3W68 A;  1NTK J;  1SQX D;  3CCQ P;  3H1K D;  3HE5 A;  2AFE A;  2WPV B;  1A02 F;  2PEO A;  1LT1 A;  1SFC C;  3GLM A;  2ZXX A;  3A5T A;  3BAT A;  1WT6 A;  1L0L J;  5KP6 B;  2PRR A;  2QJP B;  3PP5 A;  2KGA A;  2E75 B;  2GDY A;  2A06 D;  1SQQ E;  1LTT C;  2JWD A;  1OX3 A;  3P32 A;  2PNG A;  2A45 I;  3M91 A;  2VLN A;  3CE7 A;  2LTE A;  4XFJ A;  1VQM P;  1NU1 K;  1UIX A;  2OYI B;  2EIA A;  4XA4 A;  1HGV A;  1SQV E;  3B4S A;  1HWT C;  1IO4 A;  3HTK A;  2XZR A;  1GW3 A;  2CNR A;  1KIL C;  1KB9 E;  1J2J B;  1M1J A;  1QEX A;  3NTN A;  3AEB C;  3KQG A;  2LF4 A;  1IK9 A;  4L73 A;  2L91 A;  2Y9Y A;  1Q81 Q;  1GW4 A;  1EXI A;  3TDK A;  2E76 D;  2LML A;  1UII A;  2ZFC A;  5B5E H;  4JBZ A;  2B88 A;  2KOO A;  3WUV A;  5KJ7 D;  2OYO A;  1G1J A;  3B71 A;  3SFE C;  3E1I A;  3HRN A;  3L75 D;  3L73 E;  1FZC B;  2BCC G;  1JY3 P;  2HPC B;  2Q7C A;  1SQB E;  2IFN A;  4C7N A;  3R4Y A;  5AW7 B;  2ZAE B;  1IMP A;  1H89 A;  2J58 A;  2KG9 A;  5F2N A;  3JCU H;  2K2Q A;  1AVY A;  3BRV B;  1P84 I;  1VKU A;  3MD0 A;  1QL2 A;  2WSS H;  2QE7 H;  3B5N C;  3DS4 A;  5H2F E;  1HY8 A;  2EHS A;  3AEE C;  3L70 G;  4WY4 D;  4COC A;  2GUV A;  2OYH C;  1T2K C;  1PGP A;  4PV1 D;  1KYO E;  3MUD A;  1Q86 Q;  3L72 D;  2GZE A;  4WB4 A;  1RHZ B;  1ZV8 A;  3PRJ A;  4IZ6 A;  1EDK A;  1UNK A;  2JQ4 A;  1NTM J;  5E79 E;  1A02 J;  1RF1 B;  2Y0D A;  1IZN B;  1FZF A;  2W6A A;  3CX5 D;  2M5A A;  2IYO A;  4HYT B;  3H1J E;  3OA7 A;  3LMO A;  1USE A;  1E0H A;  1IFI A;  2WVR A;  1SQX E;  3D70 A;  1SFC D;  3H1K E;  3UIA A;  1CW5 A;  5CBO A;  1QVG O;  2VRS A;  2R5D A;  5AVQ B;  1X0T A;  3HUS C;  2O3J A;  2ZT9 B;  1PP9 G;  3KZI H;  2A06 E;  2MVU A;  1MZ8 A;  1BE3 J;  4IL6 H;  5KLV D;  1SQP K;  4HH2 A;  1YJW P;  1OW7 A;  1PPJ D;  1QRJ A;  2IBZ D;  1Y9B A;  3D71 A;  5AVS B;  4PWV B;  1KIL D;  3NXS A;  4COP A;  2WQY C;  2N5H A;  1EMV A;  1GL2 A;  3AE7 C;  3CL3 D;  3TSI A;  2MF4 A;  1HGZ A;  3VP8 A;  3H1I D;  1PEU A;  1K8A Q;  2BCC J;  3G4S P;  3GF7 A;  2KGE A;  4M3L A;  2G3A A;  1KTM A;  3L71 G;  3CPW O;  2JJL A;  1OZH A;  3H1L G;  2XZ0 D;  2KI7 B;  2B87 B;  3G6E P;  3CC4 P;  2FHS C;  1S9K D;  3II6 A;  3VMY A;  3GHG B;  3L75 E;  3L70 J;  1WMK A;  5TIS H;  1S5L X;  5EFW B;  3EFG A;  1AVO A;  2PP6 A;  1PEQ A;  1FR2 A;  3H1H J;  3DS0 A;  4GT1 A;  1EZV I;  4H2Y C;  1FU1 A;  2NPS A;  1BCC D;  1JMM A;  3B5N D;  3M0D C;  3MIW A;  1T2K D;  1ZR4 A;  1RQV A;  5KP8 B;  1NH4 A;  3V2R A;  3L72 E;  2H43 A;  5CCG A;  3S9O A;  3Q20 A;  1U57 A;  1CEI A;  4CA3 A;  2W6B A;  3FWL A;  3V2Q A;  3PLN A;  2VSQ A;  1UJZ A;  1BGY D;  3Q1M A;  2AEJ A;  4OH8 B;  1CI6 A;  3M9B A;  3HD7 A;  5GTH E;  3V4W A;  3L74 E;  3DS3 A;  1BDC A;  1URQ C;  3KDP B;  5AW4 B;  4U0E A;  2JAZ A;  1X22 A;  3H4E A;  2BHV A;  5CHX A;  2C0X A;  1LTI C;  2KSJ A;  2MD9 A;  2ZJS E;  1FS0 E;  3EJE A;  2KR5 A;  3BCC E;  2E76 B;  2QM8 A;  2HOD A;  4IFD K;  3FGA D;  5KLV K;  5HGN A;  3L71 J;  4ZKP A;  2IBZ E;  1PPJ E;  4JF7 A;  3H1L J;  3M06 A;  2K94 A;  2E42 A;  1NTZ G;  1AQ5 A;  1Q90 D;  1L4A A;  1L0N G;  1VF5 B;  1LT9 B;  3M1M A;  1LGH B;  3CWB D;  3M9Q A;  2BAS A;  3VTP C;  4ZMD A;  3OW2 O;  2MKV A;  1JM0 A;  1NO4 A;  5DCK A;  2E5T A;  1SQP J;  2OTK E;  5BU5 A;  3L35 A;  1KFM A;  2G8Y A;  3ZDM A;  1JTH B;  1XTG B;  4WY4 B;  3MGE A;  1S9K E;  4R4M A;  1AV1 A;  1E5W A;  2YXR B;  4UHP B;  1X8Y A;  2PEN A;  1KD1 Q;  3CCJ P;  1H88 A;  2QSI A;  2LIW A;  2CWO A;  3RBX A;  1GZL A;  4H0L C;  2JYG A;  2C9N Y;  1LTJ C;  2KG8 A;  3GHG C;  1Y8A A;  2MY5 A;  5APW A;  1J1D B;  2BQ1 E;  1RF0 C;  1VQ6 P;  3TGU J;  1VDF A;  2FFD A;  3TNU B;  3EJD A;  1JEK A;  1IUQ A;  3MP7 B;  1SFC B;  5KKZ C;  1N8R Q;  4I2L C;  2VLP A;  2NO8 A;  1AF8 A;  5CCH D;  1VQP P;  2N6Z A;  2FYU K;  2WPS A;  2K0Y A;  1L0L E;  1VL2 A;  2M8L A;  1PGQ A;  2Z5H A;  3CCM P;  2ZXE B;  2Z45 A;  3GW6 A;  1BGY E;  4XRO A;  2JP3 A;  2MJZ A;  3G21 A;  4GDO A;  4DJG A;  1URQ D;  2Z5I A;  2XZ1 C;  1GDT A;  1NTK G;  2Y0E A;  2M3B A;  3S4R A;  1LTA C;  1S2E A;  3CXH H;  3G9R A;  4MN4 C;  4AUW A;  5HVC A;  1FZG A;  1NTZ J;  1J1E C;  2M8P A;  1FAV A;  1L0N J;  1LWU A;  4WVZ A;  3CCS P;  4BPH A;  1DH3 A;  1K04 A;  1KB9 D;  1NHL A;  3VN0 A;  4BXL A;  4Y28 J;  3AE9 C;  2P10 A;  3A0B E;  4L74 A;  3JSV C;  2JO1 A;  5GTI E;  1FBM A;  1CZQ A;  1FZA A;  2Q1K A;  1NKN A;  3ITK A;  3KHU A;  2V7Q H;  1Z56 A;  3BRT B;  3H0D A;  3TF5 A;  3L73 D;  3AEA C;  5KJ7 C;  1CSB A;  4UB8 E;  1SQB D;  1G2C B;  1VF5 C;  1T8Z A;  1N73 C;  4IFM A;  4QKO A;  1OVR A;  3EJB A;  2OYH B;  2ROQ A;  2A45 G;  3G1G A;  4PD4 D;  1HTL C;  1M6E X;  3U1A A;  4H0L D;  4OVN F;  4MRT C;  5B66 E;  2QIW A;  2MR7 A;  5KP7 B;  5BVZ A;  2HG5 D;  2J59 M;  4ASV A;  4KT0 J;  3L37 A;  1RE4 A;  2OYI A;  2ZYD A;  1HF9 A;  4O9B A;  4NPD A;  4EIJ A;  3N4X A;  2ZYG A;  3PTZ A;  1PP9 D;  3CC7 P;  1QLE D;  3RK2 D;  2JWA A;  2X2B A;  2LXC B;  2FQ0 A;  3A0H E;  1ZNV A;  3JC2 2;  2EFJ A;  1OVV A;  5APQ A;  1OW8 A;  5L8R J;  2RMZ A;  1NAF A;  2QM7 A;  4IPY A;  1MKM A;  4W80 A;  3HUS B;  1YIJ P;  5H2F H;  1SS1 A;  2KOP A;  1ZRT D;  2KIK A;  1FOS E;  1NTM G;  2Y9Z A;  4W7Z A;  1FE6 A;  1VQ7 P;  1OVU A;  1NYH A;  1FZC A;  4DT0 A;  3G28 A;  3O6Q B;  1KYO H;  2HPC A;  3Q3D A;  1BAJ A;  3CD6 P;  1SQQ K;  1PIX A;  2N9Y B;  2EHT A;  1N7S C;  1FZB A;  2CQ8 A;  5E79 H;  2R3S A;  1JNM A;  2FVE A;  1SQV K;  1D7M A;  4TLF A;  1QGK B;  2AFD A;  2IDB A;  2BCC E;  2FYU J;  5APX A;  2JU1 A;  3GZM A;  3CC2 P;  1BE3 G;  3NFQ A;  3VYI A;  1JJ2 O;  5AVV B;  4PJ0 H;  4U0F A;  2CPS A;  1MV8 A;  2N1T C;  3OAK A;  2HR3 A;  1WRG A;  2NZ2 A;  3L70 E;  1RF1 A;  4DZO A;  2K3R A;  2FYZ A;  4I7Z C;  3EWK A;  1SQB K;  3I5C A;  2Z44 A;  1VF5 D;  1KQF B;  2QNW A;  1LP1 B;  2AEF A;  3G0V A;  3MHV A;  1OW6 A;  2WSF H;  2KUB A;  3WBH A;  2OQQ A;  5AVX B;  2DGY A;  4U3F G;  2PEJ A;  3HE4 A;  1HQB A;  1JOC A;  1NU1 G;  1FJP A;  1YTZ T;  1YYC A;  4PD4 E;  2K92 A;  2AXC A;  3U1C A;  2N98 A;  2WWW A;  3V2P A;  5AW9 B;  5AW2 B;  3H1H G;  4GR6 A;  5AVY B;  3AED C;  3CXH I;  2W27 A;  2K93 A;  1SLQ A;  2YXQ B;  1PP9 E;  1URQ B;  1EDI A;  1BXI A;  1GTW A;  4F37 A;  5HGO A;  3G29 A;  3L74 D;  1SQX K;  1ZOY C;  3AE3 C;  4YTP C;  1NOH A;  3DTJ A;  1Z6M A;  2B87 A;  2K9Y A;  5DJU B;  4D6T J;  1ZRT E;  4PH0 A;  3G26 A;  3GHG A;  3QWO C;  1T3U A;  2Z4E A;  2HYN A;  1EZV G;  3BCC D;  1N7S D;  4C7N B;  2JEE A;  4L76 A;  2WT7 B;  1RE3 A;  1NJI Q;  5BS2 A;  1ZW0 A;  1AA0 A;  5AW3 B;  5B5E E;  2WSC H;  3GZL A;  3CX5 H;  3LIE A;  2KWL A;  3OJA B;  5GTH H;  1PZQ A;  4I6M C;  2M0B A;  1YIT P;  2V7Q J;  4Y99 C;  2OTL P;  2R5B A;  2ZYA A;  3AE5 C;  2Q3E A;  2KZI A;  3P8M C;  2KLV A;  4R4L A;  1SQQ J;  1PGJ A;  3DS5 A;  1VPC A;  3CXC O;  2JO0 A;  2N1T D;  3T97 B;  1K05 A;  3WU2 E;  4U3F J;  3AE8 C;  3JCU E;  1NU1 J;  2GYK A;  4H0L B;  3M0A A;  1KQL A;  1SQV J;  1LTJ B;  3G71 P;  2K5X A;  1FC2 C;  1IFM A;  2C0W A;  4BPG A;  1S4X A;  1OFC X;  2Q5U A;  5AVR B;  1JY3 O;  4DOJ A;  1H8A A;  1SQP G;  2ONT A;  4XE5 B;  3RK2 B;  2L22 A;  5KKZ B;  4WBA A;  2GZI A;  3L4F A;  4PXH B;  4IFF A;  1KYO I;  2GZF A;  1N86 A;  1IC2 A;  1NTK D;  3TK1 A;  2YIU C;  2JDI H;  3S1K A;  1R8E A;  3U43 A;  4CPG A;  2KOS A;  2H8P D;  1R5S A;  3HYB A;  1Y47 A;  5KJ7 A;  2FXM A;  2D2C D;  2Q6Q A;  3H32 B;  1FZE A;  5CCH C;  1L0L D;  3TGU G;  1LT9 A;  2Q3I A;  1E79 H;  4GOF A;  1EC5 A;  1K9M Q;  2JKV A;  3KZI E;  1GU4 A;  1J1E B;  4KHX A;  2KP8 A;  1M1J C;  1NTZ E;  4IL6 E;  1EDJ A;  4HB1 A;  1L0N E;  2M8R A;  2R32 A;  2GUS A;  1JTH A;  2MR8 A;  2P67 A;  4WY4 A;  1ZN5 A;  2VLO A;  1LJ2 A;  1H0T B;  5CJ4 A;  2FBW C;  1LTB C;  2E1M A;  3BAS A;  5APU A;  1W2B O;  1KV4 A;  3AE6 C;  2FAC A;  1S1C X;  3H1J J;  2E5Y A;  3P8C D;  3GG2 A;  1JUN A;  1SQX J;  3H1K J;  3TNU A;  1X9V A;  3E2D A;  3RGU A;  4H13 C;  1KC8 Q;  3N7N A;  3EQ2 A;  1N73 B;  1SFC A;  4JYC A;  2K0X A;  1AJY A;  2C9L Y;  1LNQ A;  4YPC A;  2W8Z A;  4KJM A;  1KN7 A;  4JQ0 D;  4A7P A;  1RO0 A;  2O1J A;  1RH5 B;  4XRQ A;  3I55 P;  2AXT E;  2PFX A;  3F89 A;  1FDI A;  4BPF A;  3MUD C;  3A0B H;  3AE1 C;  5AW8 B;  2WSF J;  4EYY Q;  4ZKU A;  3RK3 C;  3WMM 0;  3HD7 B;  2LKM A;  2FYN B;  1GMJ A;  2Q9I A;  2O01 H;  2GA1 A;  1KIL A;  4U0B A;  2L4B A;  5BU8 B;  1NTM D;  4QNB A;  5KLV G;  1LTG C;  2JR8 A;  4N3Y B;  2IX7 C;  3M9H A;  2XND H;  4UB8 H;  2FAE A;  1JY2 N;  2QVA A;  1P84 D;  5HGM A;  4U7J A;  2P9X A;  2CPB A;  2AF8 A;  1GK4 A;  5KAI H;  1NTK E;  3L75 J;  4LC1 A;  3H1I G;  3RK2 C;  4OGQ D;  2FQ1 A;  2GZJ A;  3B5I A;  2POH A;  1YJ9 P;  4DCK A;  2I8D A;  1FDM A;  1L0L K;  1JCC A;  4EOT A;  1PEO A;  1TU3 F;  1VQO P;  3CX5 I;  2NRG A;  1L0I A;  3DS2 A;  2K9J B;  1N7S B;  3SWK A;  3NMD A;  1BE3 D;  2QJK B;  3G3Z A;  3V4Q A;  2WPT A;  1G2C A;  3FXE A;  2CGQ A;  1GL2 C;  2LOL A;  2YMY A;  3B5N A;  2KG6 A;  2N9B A;  4LLH A;  5KAF E;  5APT A;  3L72 J;  2OYH A;  2WMM A;  3VP9 A;  2BCC D;  1AYI A;  4EI2 A;  1BCC G;  1KZU B;  2P58 A;  2FQ2 A;  2FVF A;  2WSC J;  3GKL C;  2CK3 H;  2N1T B;  2KOD A;  2IBZ I;  2ZVO B;  4HKG A;  3P8C E;  5EW5 E;  2XT1 A;  2EG5 A;  1Q82 Q;  1OMI A;  2XU6 A;  3RBZ A;  4I7Z B;  1DNY A;  2PEI A;  4H13 D;  4IOI H;  2LPK A;  5HGL A;  1L0H A;  2FYU G;  2P1J A;  3L70 D;  2E43 A;  2KNC B;  2LL8 A;  3C8V A;  1A8O A;  2N50 A;  2NPS C;  3H1H D;  1NKZ B;  2JYL A;  2OTJ P;  2WSE H;  4U0A A;  2ZVN B;  3HUS A;  5KLV J;  2KYV A;  1KB9 H;  1OR5 A;  2KS1 B;  5CCG C;  3RK3 D;  3PHL A;  3RL0 B;  4HJG H;  2WIT A;  1DEE G;  5AVW B;  1PGO A;  3H1I J;  2D2C B;  4RES B;  1BSH A;  5APV A;  1NTM E;  4Z1M H;  3PH0 A;  3CME P;  4H2W C;  3HD7 C;  2FYN C;  3CCR P;  2IYP A;  1EZV D;  2WPR A;  1P84 E;  4NPF X;  5TJH A;  1VQ9 P;  4H2X C;  2HFE D;  1IMQ A;  1M7L A;  5F2O A;  1S5L E;  3B8E B;  1N7L A;  3ABV C;  3CWB G;  3NY7 B;  1M74 A;  4DG9 A;  3VMA A;  4GOE A;  3E7K A;  1U7M A;  1AUM A;  5AVU B;  4PD4 H;  2V4H A;  5AW0 B;  5I4T G;  2E74 C;  2GM4 A;  3Q2Y A;  2XXM A;  2QJY B;  1BCC J;  1YQ3 C;  1BE3 E;  1JY2 O;  1AQT A;  5AW6 B;  1GL2 D;  1IFD A;  1L4A C;  4NEO A;  3L71 D;  3AEG C;  1LP1 A;  4JYB A;  1MFZ A;  5K5G B;  3H1L D;  1A43 A;  3M0D A;  1KFN A;  3VOP A;  2QJK C;  1DEB A;  3KYQ A;  2PEK A;  3GJN A;  4Y99 B;  4D6T G;  3Q5P A;  4BWN A;  5KLI C;  2K88 A;  2YKO A;  2RKL A;  5AVT B;  3LW5 H;  4B86 A;  5CCH A;  1BGY J;  2YMK A;  4EDF A;  4GKG A;  5EJD A;  2GDW A;  1JY3 N;  1QL1 A;  1SQP D;  4UB6 E;  4U3F E;  3LRY A;  1FOS F;  1NU1 E;  2KLU A;  1T3J A;  1NQ4 A;  1URQ A;  2LIU A;  3SSU A;  2NPS D;  2K1A A;  2PY8 A;  4H44 B;  1DIP A;  3KXD A;  1LTS C;  1M57 D;  2IZ1 A;  2YKQ A;  1F80 D;  2FFD C;  3H1H E;  2R3C A;  2FAD A;  1SQQ G;  1IFN A;  4BRY B;  1X79 B;  2JU2 A;  3H6P A;  2O1K A;  3HE5 B;  3VRL C;  3TGU D;  1ACP A;  2UWJ E;  2PEM A;  1HH0 A;  2KOQ A;  2YIU B;  2GZG A;  5CCG D;  1RNI A;  4U0C A;  2O01 J;  1SQV G;  3RK3 E;  1XTC C;  4OGQ B;  1SP4 A;  1M90 Q;  3WU2 H;  3CWB J;  2WT7 A;  4R0M A;  2L5G B;  5AW5 B;  3RL0 C;  3HD7 D;  1JB0 J;  1X3O A;  1PEM A;  1MUU A;  1FDO A;  1VQL P;  2KOR A;  1M56 D;  2D2C C;  1EZV E;  3FXD A;  3HTK B;  3RL0 g;  1S3J A;  3CI9 A;  2JGP A;  1OXZ A;  2J5U A;  1M1J B;  3L73 G;  3I56 P;  2IPP A;  2R44 A;  1W5C E;  1LWU C;  1SQB G;  2XKM A;  1EQ7 A;  3T97 A;  2WZ7 A;  2B9B A;  1GU5 A;  1NTZ D;  2RN0 A;  4W7Y A;  1L0N D;  2E74 D;  1YI2 P;  4N78 D;  2QA4 P;  3V5B A;  3D6Z A;  1GK6 A;  1LTJ A;  1MFT A;  2N6Y A;  2Z46 A;  1L4A D;  2WTY A;  1EDL A;  1RF0 A;  4K35 A;  3F5H A;  5CZD B;  4AQR D;  3L71 E;  2M3E A;  4RO0 A;  3Q5R A;  2QJY C;  3H1L E;  4H13 B;  4L75 A;  3WUT A;  1KQS O;  3B4Q A;  1FJK A;  3HE4 B;  1KB9 I;  4PJ0 E;  1L2P A;  2KOG A;  3MGN A;  1OIP A;  1GXH A;  1Q2N A;  1PL5 A;  3H1J G;  3NTE A;  2QJP C;  3AEF C;  1SQP E;  2E75 C;  2RH0 A;  3K5B A;  3H32 A;  2KW2 A;  1G1I A;  1SQX G;  3LID A;  3H1K G;  4JPZ B;  5AVZ B;  3RK3 B;  2LKI A;  3IF4 A;  1EIA A;  2WSE J;  1RE4 C;  2OYI C;  1ZP0 C;  1N2D C;  2ERH A;  1ZXG A;  4WWI A;  1IFP A;  1D1D A;  2M5A B;  4ASW A;  1T6A A;  3R2P A;  3V6I A;  2A06 G;  3D6Y A;  3SWF A;  1U7J A;  4QMA A;  3TGU E;  4H44 C;  5KTB A;  3IAO A;  1KLP A;  4PD4 I;  2GDX A;  2FY8 A;  1H0T A;  4C46 A;  2QRX A;  3HZQ A;  2IZ0 A;  2QG4 A;  2XV5 A;  3C9I A;  2KGD A;  2OAR A;  3L73 J;  2AXT H;  1VQ5 P;  3RL0 D;  3IN6 A;  1FZC C;  1GXG A;  1SQB J;  4OGQ C;  2HLO A;  2OGU A;  2KXP B;  3H47 A;  1YBK A;  3A3Y B;  4OWF A;  1R5L A;  1DV5 A;  1GL2 B;  1N73 A;  4M0I A;  3L75 G;  3AEC C;  1YJN P;  1NTZ K;  1K30 A;  1L0N K;  1KOR A;  3GMA A;  2FYU D;  4NPE A;  4I1L A;  2KSE A;  2LR2 A;  4N78 E;  1SVF A;  1ZME C;  1KQG B;  2YO2 A;  5JPA A;  3CX5 E;  2BEZ F;  3CCL P;  1PP9 J;  1S72 P;  3CLQ A;  1RF1 C;  3G1I A;  2FVA A;  2XDJ A;  3LW5 J;  3AE4 C;  5F2K A;  3L72 G;  3IFM A;  3P7K A;  2NPS B;  2I1K A;  3V2N A;  3A7O A;  4TT3 H;  3USS A;  2L0Q A;  2BUO A;  5KAF H;  3CCU P;  1DD4 A;  1USD A;  2E75 D;  5KLV E;  1DD3 A;  2ZT9 C;  3SWY A;  3L74 G;  5TIS E;  3MZW B;  5APS A;  2L6E A;  1NGM B;  4YXW H;  4HKZ H;  1KIL E;  2XV6 A;  2K9J A;  1N7S A;  1PV3 A;  5C39 A;  1VQK P;  3H1I E;  5BS1 A;  2O01 N;  3GF3 A;  4XFY A;  5GTI H;  1CI6 B;  1YHQ P;  2A45 H;  3BCC G;  2FXO A;  4H44 D;  1JO5 A;  2VLQ A;  1VQ4 P;  3QH9 A;  3W67 A;  4N6J A;  5APY A;  2IBZ G;  1PPJ G;  2PGD A;  1PFI A;  2H89 C;  4PH1 A;  1DX7 A;  1RY3 A;  4PV1 B;  4RKU J;  2YKP A;  1NTK K;  3FWN A;  1RQU A;  3VMX A;  3L36 A;  2N1T A;  3CCE P;  1HUC A;  2HOD B;  3P05 A;  2E74 B;  4D6T D;  1M6N A;  1QVF O;  2BEQ D;  2H7H A;  1BCC E;  5M1B A;  4XFX A;  2YNY A;  3PJS K;  3IR9 A;  1L4A B;  2H88 C;  1VQ8 P;  1RE3 C;  2KNC A;  3CXH D;  2AEM A;  2JBG A;  4AYC A;  5B66 H;  4RJT A;  2W6J H;  3WUU A;  3U59 A;  1IFJ A;  3RG6 C;  1KMI Z;  2P7J A;  1BSN A;  2CG5 B;  5KLI B;  1JY2 P;  2YO3 A;  1BDD A;  1P84 H;  2FYU E;  2B89 A;  2KS1 A;  1HJ0 A;  1S5L H;  2MVV A;  2AVA A;  2K0D X;  3A0H H;  1IJD B;  1IK7 A;  5HV8 A;  2FXP A;  1SQQ D;  3EFF K;  3TYY A;  3E1R A;  2K37 A;  3A2A A;  2P2U A;  1NVO A;  1KIL B;  3O8Z A;  4U3F D;  1JCD A;  3L74 J;  3VMZ A;  5AW1 B;  1NU1 D;  1YQ4 C;  2JB0 A;  1SQV D;  2IFM A;  4C7R A;  7CEI A;  4U0D A;  1L0L G;  2FFD B;  2W83 C;  2ITA A;  3CMA P;  2L9F A;  3KPE A;  4LGD E;  1T8K A;  1RO2 A;  1VHN A;  5DJT B;  4YXD C;  4XFZ A;  3CCV P;  1HJB A;  2Y0C A;  1BGY G;  2DNW A;  2ZT9 D;  2KZJ A;  2N5I A;  3BCC J;  3MTU E;  2KB7 P;  2KK7 A;  2E76 C;  4GIF A;  1M1K Q;  1EXJ A;  1HVV A;  2DW3 A;  4GR2 A;  3O6Q A;  1ZMB A;  1GD2 E;  2LXB A;  3CWB E;  1AFO A;  1ZLL A;  4UB6 H;  3C1L A;  2XNX A;  5CMZ A;  1QX8 A; 
#chains in the Genus database with same CATH homology
 5F2O A;  3CCL P;  1QVF O;  1RNI A;  4U0C A;  3MGE A;  1KC8 Q;  1M74 A;  4XFX A;  1QVG O;  3DS1 A;  1EOQ A;  1S72 P;  1VQ8 P;  1VQN P;  2LF4 A;  3G1I A;  2PEN A;  1KD1 Q;  3Q20 A;  3H0D A;  3CCJ P;  1Q81 Q;  1AUM A;  1EIA A;  2ONT A;  2CWO A;  2JYG A;  1M90 Q;  1BAJ A;  3CD6 P;  5HGO A;  3G29 A;  3DPH A;  5F2K A;  1RO0 A;  3RG6 C;  5I4T G;  4XRQ A;  3I55 P;  2XXM A;  1D1D A;  2KOD A;  2BQ1 E;  3DTJ A;  1PEM A;  2XT1 A;  1VQ6 P;  1YJW P;  2EG5 A;  1Q82 Q;  1QRJ A;  1VQL P;  1Q7Y Q;  3DS3 A;  4PH0 A;  3HYB A;  2BUO A;  2PEI A;  3G26 A;  3CC2 P;  1IUQ A;  4WYM A;  3CCU P;  4COP A;  5HGL A;  1A43 A;  4U0E A;  2PEQ A;  3I56 P;  3H4E A;  1JJ2 O;  1N8R Q;  3G1G A;  1PEU A;  1A8O A;  2BHV A;  2PEK A;  1M6E X;  1K8A Q;  4U0F A;  1K73 Q;  3HZQ A;  4U0B A;  2L6E A;  2M8N A;  5F2N A;  4QNB A;  3G4S P;  2QEX P;  1VQP P;  2OAR A;  2XV6 A;  1E6J P;  1NJI Q;  2JYL A;  2OTJ P;  5BS2 A;  4U0A A;  1VQ5 P;  1YI2 P;  2M8L A;  2QA4 P;  1VQK P;  3CPW O;  5BS1 A;  5HGM A;  1K9M Q;  4XFY A;  3DS4 A;  2Z45 A;  3CCM P;  2Z44 A;  3CCQ P;  5HGN A;  2P9X A;  4U0D A;  3G6E P;  3CC4 P;  4COC A;  1YHQ P;  4XRO A;  2Z46 A;  2PEO A;  3H47 A;  3CMA P;  1YIT P;  3G21 A;  3LRY A;  3G0V A;  1RO2 A;  3CC7 P;  1Q86 Q;  4XFZ A;  3CCV P;  2OTL P;  3B5I A;  3WBH A;  2DGY A;  1YJ9 P;  1VQ4 P;  2PEJ A;  3DS5 A;  4M0I A;  3CXC O;  2E1M A;  1PEQ A;  1PEO A;  2JO0 A;  4PH1 A;  3M1M A;  1KQS O;  1VQO P;  1W2B O;  2EFJ A;  2PY8 A;  1YJN P;  3DS0 A;  1M1K Q;  3DS2 A;  1K30 A;  2M8P A;  4IPY A;  3CME P;  3CCS P;  4GR2 A;  1VQM P;  1YIJ P;  3CCR P;  3CCE P;  3OW2 O;  2EIA A;  1ZMB A;  3VRL C;  5DCK A;  3P05 A;  3G71 P;  1VQ7 P;  1VQ9 P;  2PEM A;  3G28 A;  3E2D A;  4GR6 A;  5JPA A;  3NTE A;  1M6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...