1VQNP

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqnP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqnP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqnP02
3CMEP 1Q86Q 3CCLP 1YHQP 1N8RQ 1QVGO 1KD1Q 1NJIQ 1Q82Q 3CXCO 3CCUP 1YI2P 3OW2O 1S72P 1K73Q 3CCEP 3CCRP 2QA4P 1Q7YQ 1W2BO 3CCQP 3CCJP 1VQ5P 3CC4P 1VQ4P 2OTLP 1M1KQ 1YJ9P 1VQ7P 1VQ8P 2QEXP 3I56P 1YIJP 1VQPP 1VQ6P 3G4SP 1YJWP 3CMAP 3G71P 3CCVP 1JJ2O 1VQNP 1VQKP 3CD6P 3CC2P 1KQSO 1YITP 1VQMP 1Q81Q 1M90Q 1VQOP 1VQ9P 1KC8Q 1VQLP 2OTJP 3CC7P 3CCSP 1QVFO 1YJNP 3G6EP 1K9MQ 3CPWO 3CCMP 1K8AQ 3I55P
chains in the Genus database with same CATH superfamily
1G2CA 4TLFA 2ZYGA 3PH0A 1J1DB 1FZBA 1KFNA 1Q82Q 3OW2O 1BCCD 1GXGA 3MGNA 2FQ0A 1KYOI 2YMKA 1VF5C 2N1TC 3G3ZA 2LMLA 2YKPA 2O1JA 1SS1A 2R5BA 4C46A 1EOQA 1KILC 5KJ7A 3U43A 1NQ4A 2KW2A 3D6YA 2B87A 1UJZA 4DG9A 1SQPJ 2N1TB 3OAKA 1FR2A 1ZW0A 3CXHI 1USEA 2YKQA 2KSJA 1J1DC 3M9QA 5HGOA 2KORA 1A02J 2ROQA 2Q7CA 5KLVK 1RE4C 4BXLA 3VOPA 5B5EE 4HJGH 3V5BA 1VQNP 3Q5PA 3M9BA 2EIAA 1SQXG 1QL1A 1MFTA 2OYHA 5CMZA 3CX5E 1IFPA 2KXPB 2YO2A 5KAFH 5H2FE 4PWVB 1LTGC 1SQVD 3HE5B 3EJEA 3DS5A 5CCGA 3B5NA 2BCCE 5H2FH 2IFNA 1SQVE 4U0BA 1FZAA 1Q2NA 1GL2A 3C9IA 2GDYA 3VMXA 2JEEA 2HG5D 1SFCC 1E5WA 1AVOA 2FACA 3HTKA 3TNUB 4I7ZB 3AEFC 3G1IA 2YO3A 3MUDA 3D6ZA 4H0LD 1L0IA 1N73A 3B4SA 2JU2A 1LWUC 2OTLP 1JY2N 5KP6B 1IFNA 3CD6P 1PPJD 2Q5UA 1KN7A 4KHXA 1L0LK 2M3EA 2J5UA 1Q86Q 1HJBA 1KYOD 1SQQD 2I8DA 5JPAA 3AE5C 2FYZA 2KZIA 2WT7B 2KI7B 3A5TA 1HWTC 1LTIC 1TU3F 1YITP 4OGQC 3M06A 2FYUJ 3L4FA 3A7OA 1RE3A 1FDMA 3RBXA 1GU4A 2XZRA 1NTME 1WMKA 2QM8A 4RESB 1FC2C 1CEIA 5AW9B 4RJTA 3IF4A 1KILD 3U1CA 3FX0A 1W2BO 3L74D 2C0XA 2JYGA 3V4QA 3CMAP 1NTMG 1N7SA 4IFFA 4WVZA 3CC7P 3CPWO 1AUMA 2YIUC 2VLNA 2POHA 3CX5D 4GOFA 2N1TD 2OGUA 2KYVA 1L0ND 3RK2D 2YNYA 1M6EX 3P32A 5KLIB 1D7MA 1T6AA 2IYPA 1FBMA 3L72G 2FVFA 2E5TA 2IPPA 2O01N 1OR5A 2FXOA 3GMAA 2P58A 2Q3EA 3AE9C 1ZV8A 2PENA 3RG2A 4I6MC 3AEGC 3L73G 1EZVE 3Q1MA 1FJPA 1OVVA 3M9HA 3L71E 2E74B 1KYOH 3HTKB 1RHZB 1IJDB 1K04A 1G1IA 2SPZA 3L71D 1NU1E 2PP6A 1L4AA 3H1JD 3CCRP 5B66E 2D2CC 1JY2P 2KZJA 3OJAB 1X8YA 2WWWA 1L0LJ 1S9KE 1M8OB 1CSBA 2CGQA 2K0XA 1KC8Q 3H25A 1EXIA 3E2DA 2Z46A 4HYTB 4EDFA 2BEZF 3EJBA 4DOJA 1OVUA 1PZQA 2M5AA 1A43A 3CXCO 2NPSD 4CA3A 3KDPB 3R4YA 2MKVA 3KZIE 3B5NB 5AW7B 3HYBA 2N9BA 1GL2D 2XNXA 3L75E 1RY3A 2NPSA 1M1JA 4H44B 3CWBD 3I5CA 2QE7H 4UB6E 2JDIH 1T3UA 2DW3A 2ZYDA 1PGJA 2JBGA 3NTEA 2QG4A 2ERHA 1L2PA 2FYNB 1EDJA 2JU1A 1BE3G 4N78E 4JQ0D 1H8AA 1AJYA 1LP1A 1JNMA 4K3AA 3QWOC 3H6PA 5M1BA 2FKWB 3D70A 2FVAA 1H88A 3F5HA 3Q20A 3H1JJ 2MD9A 1RE4A 5APXA 1XTGB 1JTHA 2GDWA 2IBZI 2WITA 1X9VA 5DJTB 1ZLLA 2Q9IA 1SQBD 2WT7A 2AFEA 1LGHB 4D6TE 1PP9D 2P10A 1AFOA 3AEDC 1RH5B 1BGYJ 2KLUA 3H1LJ 1LWUA 1ZMBA 1A02F 2FYNC 3G71P 2FY8A 1Y47A 1N7SB 3PTZA 1Z6MA 3E1IA 1FZGA 4AQRD 2E5YA 4W7YA 1X22A 1LTJC 3AEEC 2GZJA 1WT6A 5KLVJ 3KYQA 4KJMA 1UNKA 2E74D 5CJ4A 1IK7A 2K93A 1OW7A 2GYKA 2Z44A 1D1DA 1PGOA 4H2WC 4XFJA 4BPHA 1SQBK 3FWNA 3S1KA 4PV1B 1FZFA 2A06D 1L4AC 3H1JE 3P8MC 4IL6E 4OGQD 1FU1A 2KGAA 3BATA 3S4RA 3DS4A 1YTZT 2XT1A 3VYIA 2XDJA 3CCSP 1NTZE 3AE3C 1MZ8A 1CI6B 2Z45A 3B5ND 1NOHA 3GZMA 2VLQA 3EFFK 2K0DX 1L4AB 4WYMA 1PPJE 1VQ4P 2FFDA 1LTSC 1GW3A 1OWAA 3G21A 2Y9ZA 3MGEA 2IZ0A 3HUSA 4GKGA 1JY3N 1KB9I 1JOCA 3L71G 5TISH 5L8RJ 3CMEP 2FYUG 1RNIA 1KQGB 4GOEA 1HF9A 2M5AB 2W27A 3E1RA 2KWLA 1RE3C 1NVOA 3SFDC 1FDIA 2LIWA 3G4SP 1GXHA 2LXCB 1S5LE 3BCCD 2RMZA 4RKUJ 4BPFA 2N6YA 2YKOA 3H1IE 1SQBG 2V7QJ 2PGDA 2LPKA 2GZIA 1M1JB 1FZCC 1KZUB 3H1HE 5APSA 1VQKP 2PRRA 1Q81Q 4Y99C 3L75G 1IFIA 2M8LA 4C7NA 4O9BA 1N73C 3A0BH 5F2OA 3Q2YA 3CCLP 1USDA 1PEQA 3CWBJ 4JBZA 1DIPA 1NU1D 2W6BA 3BASA 3NMDA 1ZP0C 4OGQB 1DD4A 1HGZA 2KODA 1Z56A 4MN4C 4UB8H 3KQGA 1ZNVA 3GKLC 1PIXA 2KSEA 2XU6A 2Q6QA 4RO0A 1BGYE 4DCKA 3A3YB 2WMMA 1OW6A 3V2QA 3GZLA 1OW8A 4L73A 4WY4A 1OX3A 4H44C 1S72P 3W67A 2H7HA 3H1HD 1IO4A 4BPGA 1UIIA 4I2LC 1RF1B 2N5IA 3AEBC 1S5LH 4ZKUA 1MV8A 2A06G 2QJPB 2D2CD 3CX5H 5KP7B 3RK3E 2KGEA 3L73D 1PEMA 1EC5A 1LNQA 4I7ZC 4AUWA 1NTMJ 5B5EH 2WVRA 2JKVA 3CC2P 1PP9G 3CX5I 5HGMA 2L22A 1OXZA 2V7QH 3P8CD 3GJNA 1JY3P 4PD4I 2WPVB 1XTCC 3LIDA 1PGQA 3L74E 4H0LC 2EFJA 5KJ7C 2JGPA 1QX8A 3V2RA 4NPFX 5CCHD 3MIWA 4D6TG 4WWIA 4PV1C 2UWJE 3H1ID 1SQVG 1ZRTD 1JO5A 2FVEA 1QL2A 3V6IA 4L74A 5EFWB 2OTKE 5APTA 5KTBA 2KS1B 1KILA 3M91A 2RH0A 2YXQB 1QEXA 3RK3C 2P7JA 3VN0A 3H1HJ 2HODB 1SQPE 2IBZG 4YTPC 2K88A 2KIKA 3W68A 1HGVA 4ZNCA 3Q5RA 2IYOA 5C39A 1VQ9P 3L74J 3ZDMA 1NWQA 1GW4A 2FFDB 3IFMA 2H89C 3IAOA 1KLPA 2M0BA 4WB4A 2LL8A 2HR3A 2FXPA 3WU2E 4M0IA 3O8ZA 3G6EP 2VSQA 3DS1A 1W5CE 1JTHB 2GA1A 3TGUE 1CZQA 3MUDC 2LR2A 2H43A 4F37A 3RK3D 1P84D 3H1IJ 2PEIA 3H1JG 1QGKB 3O6QA 3RGUA 3L72E 1GPJA 2XZ1C 1VQMP 2KG8A 3L70E 2EG5A 1BGYD 1GU5A 3QH9A 1SQQG 3H1LD 1PEOA 5AVUB 5E79E 1T8KA 2WSFJ 2VLPA 2A45H 3H1KD 3BVHA 3H1LE 4HKZH 3WUUA 3B71A 2L91A 2QEXP 2H8PD 3B8EB 1BAJA 1N2DC 2V4HA 2J59M 2X2BA 3G0VA 3H32B 4U3FJ 2KGDA 3U59A 1E6JP 4LGDE 1AQ5A 4IZ6A 3H1IG 1YYCA 2QJPC 2WZ7A 1DEEG 1GK4A 1LT9C 2LKMA 2KLVA 1NKNA 2E1MA 4PD4E 1SQXK 1RF1C 3V4WA 5KLVE 4XFXA 4GDOA 1LTTC 1AV1A 2O01H 4N78D 3R2PA 4QNBA 2E75B 4KT0J 1GZLA 3CXHE 2DGYA 4XROA 4ZKPA 2XV5A 3MHVA 2JWDA 1HY8A 2PEOA 1SQBE 3G26A 2B87B 1VQ6P 3B5IA 1JCDA 1CI6A 2O1KA 3ABVC 1Q90D 4GODA 5AVTB 1GL2C 4H2XC 1M90Q 5KAIH 4PH1A 2N5HA 1ZXGA 3VTPC 2QVAA 1T3JA 1K8AQ 5GTHH 3I55P 4PV1D 3HD7C 3VRLC 2LIUA 1BGYG 1SQPK 3G29A 4BWNA 2M8PA 1L0NE 2KP8A 1N73B 3HD7A 3BCCE 2Y0CA 4Y99B 3AE1C 1S3JA 4NPDA 1KFMA 5AW6B 5BS2A 2NZ2A 4GIFA 2M8RA 1E0HA 2QJKC 1MKMA 3L37A 1M1JC 5B66H 5AW1B 1OIPA 3PRJA 2GZGA 1AF8A 2MJZA 3CI9A 2KS1A 1KILB 3DS2A 3A0HH 2JAZA 3P7KA 4L75A 2KOOA 3S9OA 4D6TJ 2QJKB 3O6QB 5HV8A 2LF4A 1DNYA 3VP9A 2WTYA 2JB0A 3RK3B 1PP9E 1R5SA 3TGUD 2W83C 1FE6A 3SWFA 1RQUA 2K1AA 4U0AA 3P05A 1LP1B 2LKIA 3CCJP 1F80D 2R5DA 3BRTB 1VQPP 2WSFH 1KQFB 5GTIH 2KUBA 3NY7B 2K9YA 1ZN5A 1FDOA 2XNDH 2K9JA 2AF8A 1G1JA 2FXMA 1BCCE 1KTMA 1NJIQ 1BCCJ 2IX7C 3RBZA 4Z1MH 2Z5IA 1SLQA 2P67A 4GT1A 2ZVOB 3PJSK 1NTKD 2PNGA 2HPCA 1HUCA 3RL0g 1LWUB 1UIXA 2NPSC 3CWBE 1IC2A 2HYNA 4TT3H 2GUSA 4D6TD 1NAFA 3A0HE 2AEMA 1SQQK 3CXHH 2E75D 2EHTA 1SQPD 1IMPA 5F2KA 1NTZG 1PEUA 5KJ7D 3SWYA 5KP8B 1HVVA 5AW2B 2CQ8A 1P84H 1HQBA 3FWLA 3M0DC 3H0DA 5DCKA 3H32A 3AE7C 1YJ9P 2FQ2A 4H2YC 2OYOA 4CPGA 2L5GB 4ASWA 4B86A 2AXCA 5APVA 2K5XA 3ITKA 4H44D 5CHXA 2GZEA 5KKZC 3BCCJ 1JMBA 2W90A 4W7ZA 1L0HA 1KD1Q 2OQQA 5APYA 3RG6C 2ZXEB 1OVRA 2QA4P 4WBAA 2M3BA 2K37A 2ZT9D 2Y9YA 3AECC 2XXMA 3HZQA 1KV4A 4U3FG 3KZIH 1FZCB 3SWKA 3HE4B 2HODA 1BE3J 2MR7A 3LIEA 2FYUE 4PXHB 3DS3A 3L70G 2MF4A 1RO0A 4IL6X 3JCUH 1URQA 1EZVD 1EIAA 3SSUA 1IFJA 2PEJA 4XE5B 4AYCA 2DNWA 4R4MA 1NU1J 1ZRTE 2VLOA 2KOSA 4JYCA 2LOLA 1YJNP 1G2CB 1QRJA 2WPSA 1P84E 3RL0D 4EI2A 2PAJA 3BCCG 4L76A 2JQ4A 1GDTA 1S9KD 2WSEH 3AE4C 1JY2O 2QJYC 1JMMA 2R32A 1JEKA 3N4XA 1KILE 1L0LG 2FYUD 2OYIA 3T97A 2E76D 3GHGA 5KLVG 1S4XA 2ZAEB 3WUTA 2K2QA 2PEKA 3GHGC 3I56P 1AQTA 3VMZA 4HH2A 2M8NA 3B4QA 4U7JA 2JP3A 2BQ1E 2BCCJ 4QMAA 1SVFA 5AVQB 4GR6A 1N86A 1SP4A 1BE3D 2PY8A 1YBKA 2K9JB 1ACPA 2GUVA 5AW4B 1VQ5P 2P2UA 1RO2A 4U0CA 1J1EC 2VRSA 2E76C 4HKGA 2MY5A 1JJ2O 2MVUA 1BDCA 1Y9BA 4XRQA 2QSIA 4UHPB 1SQXJ 2W6AA 1J2JB 1DD3A 2KR5A 3C1LA 3PP5A 2WSSH 2AXTH 1S5LX 1X79B 1R8EA 1LTJB 2E42A 5AVYB 2FADA 4JYBA 1S1CX 2CNRA 1JY3O 1YQ4C 5CBOA 1FZCA 4U0FA 5F2NA 2HLOA 2CWOA 2ZT9B 3CLQA 3L70J 1OZHA 4IFDK 1Y8AA 3D71A 1KB9E 2YIUB 2G8YA 3H47A 2ITAA 5EW5E 3RL0B 2P9XA 3V2NA 3U1AA 2M5RA 1NGMB 5TISE 3L72D 1H0TA 2JYLA 1NTZD 4HB1A 1YHQP 2ONTA 3VMAA 2GDXA 1OMIA 4JF7A 2CG5B 1NTMD 1SFCD 3CC4P 3M0DA 1GK6A 1GD2E 1EDKA 5K5GB 3CE7A 2JO1A 1KB9D 1L0NK 1LJ2A 2W8ZA 3GG2A 2JWAA 2OARA 3AE6C 2RKLA 3EWKA 3CWBG 1E79H 3HRNA 4LLHA 3IR9A 3WU2H 4R0MA 4GR2A 3H1KJ 3P8CE 3EFGA 3B5NC 2E76B 4U3FE 3LW5H 3L73J 1T8ZA 1JB0J 2OYIC 3RK2C 2WQYC 2I1JA 4EYYQ 3TF5A 4PD4D 1AVYA 2XZ0D 1BDDA 2HFED 4H0LB 5HGNA 2LTEA 2C9LY 3LW5J 3LMOA 4BRYB 3LRYA 3CCQP 1JCCA 1LT1A 7CEIA 5AVRB 5KAIE 1IMQA 3TDKA 1M74A 2QIWA 4WY4B 3EQ2A 1W2EA 2D2CB 3PLNA 2C0WA 1BXIA 3L72J 4OWFA 2E43A 2OYIB 2K3RA 1NU1G 2YMYA 1KORA 1K05A 1ZR4A 1PV3A 3GF7A 3FGAD 2KG6A 2JR8A 2IZ1A 2B88A 4ASVA 2EHSA 4U0DA 3G28A 4MRTC 3GW6A 2BHVA 2MR8A 5AVSB 1S2EA 2AFDA 2QM7A 1ZMEC 5CCGC 1SQVK 1X0TA 1L0LD 1M57D 2BCCD 2Y0DA 1NTKE 3CCMP 1HH0A 2B89A 2L0QA 3KPEA 1L0NG 1N8RQ 3L75D 1GMJA 2ZYAA 3USSA 1WRGA 2A06E 1FJKA 4K35A 2KNCA 2G3AA 1YIJP 4XFYA 3V2PA 4W80A 5KAFE 1VF5B 1VQOP 4JPZB 1M56D 5TJHA 1RF0C 3II6A 2N50A 2N6ZA 5CCGD 1FOSF 1LTAC 2WPRA 1RF0A 1P84I 1NTZJ 2Q1KA 2FHSC 2L4BA 1VPCA 3L74G 2ZXXA 3PHLA 2FAEA 4YPCA 2AEJA 2FYUK 1R5LA 2K0YA 2WSCH 1FZEA 2C9NY 3UIAA 3FXEA 1RQVA 3DTJA 4WY4D 3F89A 3A0BE 1BE3E 1NTKK 2N98A 1VDFA 2BASA 2MVVA 5APQA 1H89A 3WBHA 3TSIA 2WPTA 1J1EB 3DS0A 2BUOA 3IN6A 2JJLA 2NRGA 4DT0A 5BS1A 3KHUA 3MZWB 2CPSA 2QRXA 2CK3H 1YI2P 2K92A 2NPSB 2L9FA 1NTKJ 4WY4C 4C7RA 2RN0A 3MD0A 1KQSO 4PH0A 3TYYA 1NTMK 1DEBA 4EIJA 3HUSC 3JSVC 1NHLA 2R3CA 1URQC 1OFCX 1VKUA 5AVZB 3C8VA 3M0AA 4I1LA 2E74C 1ZOYC 3WUVA 1NYHA 1VQ8P 3JCUE 3JC22 1IK9A 1MUUA 4OVNF 2Q3IA 2KB7P 2I1KA 3CL3D 4BRYA 2OTJP 2B9BA 1KQLA 2JO0A 1EMVA 2IFMA 4LC1A 5AVVB 1VF5D 1IUQA 2J58A 5EJDA 5CCHC 1MZ9A 2HPCB 3CCEP 2O3JA 1U57A 3AE2C 5CJ0A 1N7SC 5AW8B 3BRVB 5CCHA 3L35A 5KLIC 1DH3A 3MTUE 4IOIH 3TGUG 5AW3B 1VQ7P 3G9RA 1YTZI 1QVGO 2KK7A 2PEQA 1EZVI 4N3YB 3L70D 3VP8A 3L73E 1EXJA 3L75J 5AW0B 3TGUJ 1MFZA 1AA0A 3NTNA 1N7SD 2GM4A 2PFXA 4U3FD 1K30A 1LTBC 1PFIA 2Z4EA 4M3LA 3HD7B 3EJDA 1LT9A 3Q5SA 5KKZB 1NH4A 1SQBJ 2ZT9C 1VL2A 5BVZA 1H0TB 5AVWB 1SQVJ 1EQ7A 2KG9A 2N9YB 3DPHA 4DJGA 1YQ3C 3FXDA 4COCA 4COPA 4H13D 4EOTA 1KYOE 4PJ0H 1BSNA 2ZJSE 3CCUP 4IFMA 5KLVD 4OH8B 1T2KC 3L71J 3CCVP 2AXTE 1VHNA 3TK1A 3E7KA 1U7JA 2Y0EA 1NTKG 4U0EA 1L4AD 2KGCA 3M1MA 3AE8C 1SFCB 2WSEJ 1KMIZ 5GTHE 1HJ0A 3AEAC 4NPEA 2GZFA 1URQD 1L0LE 2XV6A 2FBWC 1IFDA 2ZVNB 3RK2B 1NO4A 1SQXE 2ZFCA 5APWA 4DZOA 1RF1A 2QJYB 1YJWP 1T2KD 2P1JA 3MP7B 1X3OA 4H13C 2BCCG 5DJUB 3G1GA 2KOQA 4YXWH 2AEFA 3KXDA 4PJ0E 1PL5A 4C7NB 1CW5A 2A45I 2OYHC 1EDIA 3VMYA 1HBWA 2L6EA 5BU5A 5GTIE 4N6JA 4R4LA 1BSHA 2W6JH 1GTWA 5HGLA 2FFDC 2PEMA 1IZNB 4UB8E 5APUA 2KOGA 1BCCG 2LXBA 1N7LA 1NAYA 2YXRB 3HD7D 2OYHB 1LTJA 3RL0C 1L0NJ 2QNWA 1QVFO 4UB6H 2BEQD 3HE5A 2KNCB 1IFMA 4PD4H 3Q3DA 4QKOA 4ZMDA 1K73Q 1ZR2A 3HE4A 4Y28J 1DV5A 1M7LA 4H13B 3TNUA 2NO8A 2A45G 1GL2B 1PP9J 2WSCJ 4NEOA 2H88C 3GF3A 1PGPA 2N1TA 1U7MA 1VQLP 1NKZB 1SQPG 2IBZE 3WMM0 2FQ1A 4IL6H 1SQQJ 2E75C 3OA7A 1KB9H 1NU1K 1URQB 2IBZD 1PPJG 4XFZA 3HUSB 4YXDC 1M1KQ 3N7NA 3L36A 1M6NA 2R3SA 3K5BA 1AYIA 1LT9B 1HTLC 1JM0A 5I4TG 5E79H 5HVCA 3CXHD 4A7PA 5AVXB 3NFQA 3GLMA 5CBNA 1JUNA 1NTZK 2K94A 2WPQA 3H4EA 3SFEC 2R44A 2CPBA 2XKMA 3GHGB 2Z5HA 4XA4A 3T97B 1DX7A 1FOSE 1SQXD 1SQQE 5CZDB 1Q7YQ 1EDLA 3H1KG 5BU8B 1EZVG 1FAVA 1FS0E 3H1HG 2IDBA 3NXSA 1QLED 3H1LG 1A8OA 2KOPA 2AVAA 4IPYA 3A2AA 2O01J 5AW5B 1K9MQ 1SFCA 3H1KE
chains in the Genus database with same CATH topology
2Z45A 4QNBA 1IUQA 3DS3A 5HGNA 2DGYA 4XROA 1NJIQ 1RO0A 1Q82Q 4U0EA 1S72P 3OW2O 1K73Q 3CCEP 3Q20A 2PENA 4WYMA 1EIAA 2PEOA 3LRYA 3CCQP 3M1MA 2OTLP 1VQ4P 2PEJA 3G26A 1VQ6P 3B5IA 3G21A 3CD6P 1M74A 3MGEA 4U0FA 4M0IA 5F2NA 1M90Q 2CWOA 1VQLP 4PH1A 3G6EP 2XV6A 1YJNP 1EOQA 1K8AQ 1VQ7P 3I55P 3CMEP 1QRJA 3DS1A 1RNIA 3VRLC 1Q86Q 3DTJA 1QVGO 3G29A 1PEMA 5JPAA 2M8PA 3H47A 4XFZA 3CCRP 2PEQA 1ZMBA 1M1KQ 2P9XA 3WBHA 2PEIA 3G4SP 1YJWP 5BS2A 3G71P 1M6NA 3CC2P 5F2KA 1YITP 1VQMP 5HGMA 1PEUA 2EG5A 3DS0A 5I4TG 2BUOA 1KC8Q 1PEOA 1K30A 3E2DA 2Z46A 5BS1A 2JYLA 3G1GA 4U0DA 1YHQP 2EFJA 3G28A 2ONTA 5HGOA 1A43A 3CXCO 3H0DA 3DS2A 1YI2P 5DCKA 2BHVA 1W2BO 3CC4P 2PEKA 1YJ9P 3H4EA 2QEXP 3I56P 2JYGA 1BAJA 1VQNP 3CMAP 3HYBA 1VQKP 2EIAA 2M8NA 2Z44A 1KQSO 4PH0A 3DPHA 1Q81Q 1D1DA 2LF4A 2BQ1E 2L6EA 4COCA 4COPA 2M8LA 3G0VA 3CC7P 4GR6A 3CPWO 1AUMA 3CCMP 5F2OA 3CCLP 3DS5A 1N8RQ 1E6JP 1PEQA 2PY8A 1KD1Q 4U0AA 3P05A 2OARA 3CCUP 5HGLA 3RG6C 2QA4P 1Q7YQ 2PEMA 3CCJP 1VQ5P 1RO2A 3NTEA 4U0BA 1M6EX 4U0CA 3DS4A 1VQ8P 2KODA 2XXMA 3HZQA 4GR2A 4XFYA 1VQPP 1YIJP 3CCVP 1JJ2O 2E1MA 2XT1A 1A8OA 1VQ9P 1VQOP 4XRQA 2OTJP 4IPYA 4XFXA 3CCSP 1QVFO 1K9MQ 2JO0A 3G1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CME P;  1Q86 Q;  3CCL P;  1YHQ P;  1N8R Q;  1QVG O;  1KD1 Q;  1NJI Q;  1Q82 Q;  3CXC O;  3CCU P;  1YI2 P;  3OW2 O;  1S72 P;  1K73 Q;  3CCE P;  3CCR P;  2QA4 P;  1Q7Y Q;  1W2B O;  3CCQ P;  3CCJ P;  1VQ5 P;  3CC4 P;  1VQ4 P;  2OTL P;  1M1K Q;  1YJ9 P;  1VQ7 P;  1VQ8 P;  2QEX P;  3I56 P;  1YIJ P;  1VQP P;  1VQ6 P;  3G4S P;  1YJW P;  3CMA P;  3G71 P;  3CCV P;  1JJ2 O;  1VQN P;  1VQK P;  3CD6 P;  3CC2 P;  1KQS O;  1YIT P;  1VQM P;  1Q81 Q;  1M90 Q;  1VQO P;  1VQ9 P;  1KC8 Q;  1VQL P;  2OTJ P;  3CC7 P;  3CCS P;  1QVF O;  1YJN P;  3G6E P;  1K9M Q;  3CPW O;  3CCM P;  1K8A Q;  3I55 P; 
#chains in the Genus database with same CATH topology
 1G2C A;  4TLF A;  2ZYG A;  3PH0 A;  1J1D B;  1FZB A;  1KFN A;  1Q82 Q;  3OW2 O;  1BCC D;  1GXG A;  3MGN A;  2FQ0 A;  1KYO I;  2YMK A;  1VF5 C;  2N1T C;  3G3Z A;  2LML A;  2YKP A;  2O1J A;  1SS1 A;  2R5B A;  4C46 A;  1EOQ A;  1KIL C;  5KJ7 A;  3U43 A;  1NQ4 A;  2KW2 A;  3D6Y A;  2B87 A;  1UJZ A;  4DG9 A;  1SQP J;  2N1T B;  3OAK A;  1FR2 A;  1ZW0 A;  3CXH I;  1USE A;  2YKQ A;  2KSJ A;  1J1D C;  3M9Q A;  5HGO A;  2KOR A;  1A02 J;  2ROQ A;  2Q7C A;  5KLV K;  1RE4 C;  4BXL A;  3VOP A;  5B5E E;  4HJG H;  3V5B A;  1VQN P;  3Q5P A;  3M9B A;  2EIA A;  1SQX G;  1QL1 A;  1MFT A;  2OYH A;  5CMZ A;  3CX5 E;  1IFP A;  2KXP B;  2YO2 A;  5KAF H;  5H2F E;  4PWV B;  1LTG C;  1SQV D;  3HE5 B;  3EJE A;  3DS5 A;  5CCG A;  3B5N A;  2BCC E;  5H2F H;  2IFN A;  1SQV E;  4U0B A;  1FZA A;  1Q2N A;  1GL2 A;  3C9I A;  2GDY A;  3VMX A;  2JEE A;  2HG5 D;  1SFC C;  1E5W A;  1AVO A;  2FAC A;  3HTK A;  3TNU B;  4I7Z B;  3AEF C;  3G1I A;  2YO3 A;  3MUD A;  3D6Z A;  4H0L D;  1L0I A;  1N73 A;  3B4S A;  2JU2 A;  1LWU C;  2OTL P;  1JY2 N;  5KP6 B;  1IFN A;  3CD6 P;  1PPJ D;  2Q5U A;  1KN7 A;  4KHX A;  1L0L K;  2M3E A;  2J5U A;  1Q86 Q;  1HJB A;  1KYO D;  1SQQ D;  2I8D A;  5JPA A;  3AE5 C;  2FYZ A;  2KZI A;  2WT7 B;  2KI7 B;  3A5T A;  1HWT C;  1LTI C;  1TU3 F;  1YIT P;  4OGQ C;  3M06 A;  2FYU J;  3L4F A;  3A7O A;  1RE3 A;  1FDM A;  3RBX A;  1GU4 A;  2XZR A;  1NTM E;  1WMK A;  2QM8 A;  4RES B;  1FC2 C;  1CEI A;  5AW9 B;  4RJT A;  3IF4 A;  1KIL D;  3U1C A;  3FX0 A;  1W2B O;  3L74 D;  2C0X A;  2JYG A;  3V4Q A;  3CMA P;  1NTM G;  1N7S A;  4IFF A;  4WVZ A;  3CC7 P;  3CPW O;  1AUM A;  2YIU C;  2VLN A;  2POH A;  3CX5 D;  4GOF A;  2N1T D;  2OGU A;  2KYV A;  1L0N D;  3RK2 D;  2YNY A;  1M6E X;  3P32 A;  5KLI B;  1D7M A;  1T6A A;  2IYP A;  1FBM A;  3L72 G;  2FVF A;  2E5T A;  2IPP A;  2O01 N;  1OR5 A;  2FXO A;  3GMA A;  2P58 A;  2Q3E A;  3AE9 C;  1ZV8 A;  2PEN A;  3RG2 A;  4I6M C;  3AEG C;  3L73 G;  1EZV E;  3Q1M A;  1FJP A;  1OVV A;  3M9H A;  3L71 E;  2E74 B;  1KYO H;  3HTK B;  1RHZ B;  1IJD B;  1K04 A;  1G1I A;  2SPZ A;  3L71 D;  1NU1 E;  2PP6 A;  1L4A A;  3H1J D;  3CCR P;  5B66 E;  2D2C C;  1JY2 P;  2KZJ A;  3OJA B;  1X8Y A;  2WWW A;  1L0L J;  1S9K E;  1M8O B;  1CSB A;  2CGQ A;  2K0X A;  1KC8 Q;  3H25 A;  1EXI A;  3E2D A;  2Z46 A;  4HYT B;  4EDF A;  2BEZ F;  3EJB A;  4DOJ A;  1OVU A;  1PZQ A;  2M5A A;  1A43 A;  3CXC O;  2NPS D;  4CA3 A;  3KDP B;  3R4Y A;  2MKV A;  3KZI E;  3B5N B;  5AW7 B;  3HYB A;  2N9B A;  1GL2 D;  2XNX A;  3L75 E;  1RY3 A;  2NPS A;  1M1J A;  4H44 B;  3CWB D;  3I5C A;  2QE7 H;  4UB6 E;  2JDI H;  1T3U A;  2DW3 A;  2ZYD A;  1PGJ A;  2JBG A;  3NTE A;  2QG4 A;  2ERH A;  1L2P A;  2FYN B;  1EDJ A;  2JU1 A;  1BE3 G;  4N78 E;  4JQ0 D;  1H8A A;  1AJY A;  1LP1 A;  1JNM A;  4K3A A;  3QWO C;  3H6P A;  5M1B A;  2FKW B;  3D70 A;  2FVA A;  1H88 A;  3F5H A;  3Q20 A;  3H1J J;  2MD9 A;  1RE4 A;  5APX A;  1XTG B;  1JTH A;  2GDW A;  2IBZ I;  2WIT A;  1X9V A;  5DJT B;  1ZLL A;  2Q9I A;  1SQB D;  2WT7 A;  2AFE A;  1LGH B;  4D6T E;  1PP9 D;  2P10 A;  1AFO A;  3AED C;  1RH5 B;  1BGY J;  2KLU A;  3H1L J;  1LWU A;  1ZMB A;  1A02 F;  2FYN C;  3G71 P;  2FY8 A;  1Y47 A;  1N7S B;  3PTZ A;  1Z6M A;  3E1I A;  1FZG A;  4AQR D;  2E5Y A;  4W7Y A;  1X22 A;  1LTJ C;  3AEE C;  2GZJ A;  1WT6 A;  5KLV J;  3KYQ A;  4KJM A;  1UNK A;  2E74 D;  5CJ4 A;  1IK7 A;  2K93 A;  1OW7 A;  2GYK A;  2Z44 A;  1D1D A;  1PGO A;  4H2W C;  4XFJ A;  4BPH A;  1SQB K;  3FWN A;  3S1K A;  4PV1 B;  1FZF A;  2A06 D;  1L4A C;  3H1J E;  3P8M C;  4IL6 E;  4OGQ D;  1FU1 A;  2KGA A;  3BAT A;  3S4R A;  3DS4 A;  1YTZ T;  2XT1 A;  3VYI A;  2XDJ A;  3CCS P;  1NTZ E;  3AE3 C;  1MZ8 A;  1CI6 B;  2Z45 A;  3B5N D;  1NOH A;  3GZM A;  2VLQ A;  3EFF K;  2K0D X;  1L4A B;  4WYM A;  1PPJ E;  1VQ4 P;  2FFD A;  1LTS C;  1GW3 A;  1OWA A;  3G21 A;  2Y9Z A;  3MGE A;  2IZ0 A;  3HUS A;  4GKG A;  1JY3 N;  1KB9 I;  1JOC A;  3L71 G;  5TIS H;  5L8R J;  3CME P;  2FYU G;  1RNI A;  1KQG B;  4GOE A;  1HF9 A;  2M5A B;  2W27 A;  3E1R A;  2KWL A;  1RE3 C;  1NVO A;  3SFD C;  1FDI A;  2LIW A;  3G4S P;  1GXH A;  2LXC B;  1S5L E;  3BCC D;  2RMZ A;  4RKU J;  4BPF A;  2N6Y A;  2YKO A;  3H1I E;  1SQB G;  2V7Q J;  2PGD A;  2LPK A;  2GZI A;  1M1J B;  1FZC C;  1KZU B;  3H1H E;  5APS A;  1VQK P;  2PRR A;  1Q81 Q;  4Y99 C;  3L75 G;  1IFI A;  2M8L A;  4C7N A;  4O9B A;  1N73 C;  3A0B H;  5F2O A;  3Q2Y A;  3CCL P;  1USD A;  1PEQ A;  3CWB J;  4JBZ A;  1DIP A;  1NU1 D;  2W6B A;  3BAS A;  3NMD A;  1ZP0 C;  4OGQ B;  1DD4 A;  1HGZ A;  2KOD A;  1Z56 A;  4MN4 C;  4UB8 H;  3KQG A;  1ZNV A;  3GKL C;  1PIX A;  2KSE A;  2XU6 A;  2Q6Q A;  4RO0 A;  1BGY E;  4DCK A;  3A3Y B;  2WMM A;  1OW6 A;  3V2Q A;  3GZL A;  1OW8 A;  4L73 A;  4WY4 A;  1OX3 A;  4H44 C;  1S72 P;  3W67 A;  2H7H A;  3H1H D;  1IO4 A;  4BPG A;  1UII A;  4I2L C;  1RF1 B;  2N5I A;  3AEB C;  1S5L H;  4ZKU A;  1MV8 A;  2A06 G;  2QJP B;  2D2C D;  3CX5 H;  5KP7 B;  3RK3 E;  2KGE A;  3L73 D;  1PEM A;  1EC5 A;  1LNQ A;  4I7Z C;  4AUW A;  1NTM J;  5B5E H;  2WVR A;  2JKV A;  3CC2 P;  1PP9 G;  3CX5 I;  5HGM A;  2L22 A;  1OXZ A;  2V7Q H;  3P8C D;  3GJN A;  1JY3 P;  4PD4 I;  2WPV B;  1XTC C;  3LID A;  1PGQ A;  3L74 E;  4H0L C;  2EFJ A;  5KJ7 C;  2JGP A;  1QX8 A;  3V2R A;  4NPF X;  5CCH D;  3MIW A;  4D6T G;  4WWI A;  4PV1 C;  2UWJ E;  3H1I D;  1SQV G;  1ZRT D;  1JO5 A;  2FVE A;  1QL2 A;  3V6I A;  4L74 A;  5EFW B;  2OTK E;  5APT A;  5KTB A;  2KS1 B;  1KIL A;  3M91 A;  2RH0 A;  2YXQ B;  1QEX A;  3RK3 C;  2P7J A;  3VN0 A;  3H1H J;  2HOD B;  1SQP E;  2IBZ G;  4YTP C;  2K88 A;  2KIK A;  3W68 A;  1HGV A;  4ZNC A;  3Q5R A;  2IYO A;  5C39 A;  1VQ9 P;  3L74 J;  3ZDM A;  1NWQ A;  1GW4 A;  2FFD B;  3IFM A;  2H89 C;  3IAO A;  1KLP A;  2M0B A;  4WB4 A;  2LL8 A;  2HR3 A;  2FXP A;  3WU2 E;  4M0I A;  3O8Z A;  3G6E P;  2VSQ A;  3DS1 A;  1W5C E;  1JTH B;  2GA1 A;  3TGU E;  1CZQ A;  3MUD C;  2LR2 A;  2H43 A;  4F37 A;  3RK3 D;  1P84 D;  3H1I J;  2PEI A;  3H1J G;  1QGK B;  3O6Q A;  3RGU A;  3L72 E;  1GPJ A;  2XZ1 C;  1VQM P;  2KG8 A;  3L70 E;  2EG5 A;  1BGY D;  1GU5 A;  3QH9 A;  1SQQ G;  3H1L D;  1PEO A;  5AVU B;  5E79 E;  1T8K A;  2WSF J;  2VLP A;  2A45 H;  3H1K D;  3BVH A;  3H1L E;  4HKZ H;  3WUU A;  3B71 A;  2L91 A;  2QEX P;  2H8P D;  3B8E B;  1BAJ A;  1N2D C;  2V4H A;  2J59 M;  2X2B A;  3G0V A;  3H32 B;  4U3F J;  2KGD A;  3U59 A;  1E6J P;  4LGD E;  1AQ5 A;  4IZ6 A;  3H1I G;  1YYC A;  2QJP C;  2WZ7 A;  1DEE G;  1GK4 A;  1LT9 C;  2LKM A;  2KLV A;  1NKN A;  2E1M A;  4PD4 E;  1SQX K;  1RF1 C;  3V4W A;  5KLV E;  4XFX A;  4GDO A;  1LTT C;  1AV1 A;  2O01 H;  4N78 D;  3R2P A;  4QNB A;  2E75 B;  4KT0 J;  1GZL A;  3CXH E;  2DGY A;  4XRO A;  4ZKP A;  2XV5 A;  3MHV A;  2JWD A;  1HY8 A;  2PEO A;  1SQB E;  3G26 A;  2B87 B;  1VQ6 P;  3B5I A;  1JCD A;  1CI6 A;  2O1K A;  3ABV C;  1Q90 D;  4GOD A;  5AVT B;  1GL2 C;  4H2X C;  1M90 Q;  5KAI H;  4PH1 A;  2N5H A;  1ZXG A;  3VTP C;  2QVA A;  1T3J A;  1K8A Q;  5GTH H;  3I55 P;  4PV1 D;  3HD7 C;  3VRL C;  2LIU A;  1BGY G;  1SQP K;  3G29 A;  4BWN A;  2M8P A;  1L0N E;  2KP8 A;  1N73 B;  3HD7 A;  3BCC E;  2Y0C A;  4Y99 B;  3AE1 C;  1S3J A;  4NPD A;  1KFM A;  5AW6 B;  5BS2 A;  2NZ2 A;  4GIF A;  2M8R A;  1E0H A;  2QJK C;  1MKM A;  3L37 A;  1M1J C;  5B66 H;  5AW1 B;  1OIP A;  3PRJ A;  2GZG A;  1AF8 A;  2MJZ A;  3CI9 A;  2KS1 A;  1KIL B;  3DS2 A;  3A0H H;  2JAZ A;  3P7K A;  4L75 A;  2KOO A;  3S9O A;  4D6T J;  2QJK B;  3O6Q B;  5HV8 A;  2LF4 A;  1DNY A;  3VP9 A;  2WTY A;  2JB0 A;  3RK3 B;  1PP9 E;  1R5S A;  3TGU D;  2W83 C;  1FE6 A;  3SWF A;  1RQU A;  2K1A A;  4U0A A;  3P05 A;  1LP1 B;  2LKI A;  3CCJ P;  1F80 D;  2R5D A;  3BRT B;  1VQP P;  2WSF H;  1KQF B;  5GTI H;  2KUB A;  3NY7 B;  2K9Y A;  1ZN5 A;  1FDO A;  2XND H;  2K9J A;  2AF8 A;  1G1J A;  2FXM A;  1BCC E;  1KTM A;  1NJI Q;  1BCC J;  2IX7 C;  3RBZ A;  4Z1M H;  2Z5I A;  1SLQ A;  2P67 A;  4GT1 A;  2ZVO B;  3PJS K;  1NTK D;  2PNG A;  2HPC A;  1HUC A;  3RL0 g;  1LWU B;  1UIX A;  2NPS C;  3CWB E;  1IC2 A;  2HYN A;  4TT3 H;  2GUS A;  4D6T D;  1NAF A;  3A0H E;  2AEM A;  1SQQ K;  3CXH H;  2E75 D;  2EHT A;  1SQP D;  1IMP A;  5F2K A;  1NTZ G;  1PEU A;  5KJ7 D;  3SWY A;  5KP8 B;  1HVV A;  5AW2 B;  2CQ8 A;  1P84 H;  1HQB A;  3FWL A;  3M0D C;  3H0D A;  5DCK A;  3H32 A;  3AE7 C;  1YJ9 P;  2FQ2 A;  4H2Y C;  2OYO A;  4CPG A;  2L5G B;  4ASW A;  4B86 A;  2AXC A;  5APV A;  2K5X A;  3ITK A;  4H44 D;  5CHX A;  2GZE A;  5KKZ C;  3BCC J;  1JMB A;  2W90 A;  4W7Z A;  1L0H A;  1KD1 Q;  2OQQ A;  5APY A;  3RG6 C;  2ZXE B;  1OVR A;  2QA4 P;  4WBA A;  2M3B A;  2K37 A;  2ZT9 D;  2Y9Y A;  3AEC C;  2XXM A;  3HZQ A;  1KV4 A;  4U3F G;  3KZI H;  1FZC B;  3SWK A;  3HE4 B;  2HOD A;  1BE3 J;  2MR7 A;  3LIE A;  2FYU E;  4PXH B;  3DS3 A;  3L70 G;  2MF4 A;  1RO0 A;  4IL6 X;  3JCU H;  1URQ A;  1EZV D;  1EIA A;  3SSU A;  1IFJ A;  2PEJ A;  4XE5 B;  4AYC A;  2DNW A;  4R4M A;  1NU1 J;  1ZRT E;  2VLO A;  2KOS A;  4JYC A;  2LOL A;  1YJN P;  1G2C B;  1QRJ A;  2WPS A;  1P84 E;  3RL0 D;  4EI2 A;  2PAJ A;  3BCC G;  4L76 A;  2JQ4 A;  1GDT A;  1S9K D;  2WSE H;  3AE4 C;  1JY2 O;  2QJY C;  1JMM A;  2R32 A;  1JEK A;  3N4X A;  1KIL E;  1L0L G;  2FYU D;  2OYI A;  3T97 A;  2E76 D;  3GHG A;  5KLV G;  1S4X A;  2ZAE B;  3WUT A;  2K2Q A;  2PEK A;  3GHG C;  3I56 P;  1AQT A;  3VMZ A;  4HH2 A;  2M8N A;  3B4Q A;  4U7J A;  2JP3 A;  2BQ1 E;  2BCC J;  4QMA A;  1SVF A;  5AVQ B;  4GR6 A;  1N86 A;  1SP4 A;  1BE3 D;  2PY8 A;  1YBK A;  2K9J B;  1ACP A;  2GUV A;  5AW4 B;  1VQ5 P;  2P2U A;  1RO2 A;  4U0C A;  1J1E C;  2VRS A;  2E76 C;  4HKG A;  2MY5 A;  1JJ2 O;  2MVU A;  1BDC A;  1Y9B A;  4XRQ A;  2QSI A;  4UHP B;  1SQX J;  2W6A A;  1J2J B;  1DD3 A;  2KR5 A;  3C1L A;  3PP5 A;  2WSS H;  2AXT H;  1S5L X;  1X79 B;  1R8E A;  1LTJ B;  2E42 A;  5AVY B;  2FAD A;  4JYB A;  1S1C X;  2CNR A;  1JY3 O;  1YQ4 C;  5CBO A;  1FZC A;  4U0F A;  5F2N A;  2HLO A;  2CWO A;  2ZT9 B;  3CLQ A;  3L70 J;  1OZH A;  4IFD K;  1Y8A A;  3D71 A;  1KB9 E;  2YIU B;  2G8Y A;  3H47 A;  2ITA A;  5EW5 E;  3RL0 B;  2P9X A;  3V2N A;  3U1A A;  2M5R A;  1NGM B;  5TIS E;  3L72 D;  1H0T A;  2JYL A;  1NTZ D;  4HB1 A;  1YHQ P;  2ONT A;  3VMA A;  2GDX A;  1OMI A;  4JF7 A;  2CG5 B;  1NTM D;  1SFC D;  3CC4 P;  3M0D A;  1GK6 A;  1GD2 E;  1EDK A;  5K5G B;  3CE7 A;  2JO1 A;  1KB9 D;  1L0N K;  1LJ2 A;  2W8Z A;  3GG2 A;  2JWA A;  2OAR A;  3AE6 C;  2RKL A;  3EWK A;  3CWB G;  1E79 H;  3HRN A;  4LLH A;  3IR9 A;  3WU2 H;  4R0M A;  4GR2 A;  3H1K J;  3P8C E;  3EFG A;  3B5N C;  2E76 B;  4U3F E;  3LW5 H;  3L73 J;  1T8Z A;  1JB0 J;  2OYI C;  3RK2 C;  2WQY C;  2I1J A;  4EYY Q;  3TF5 A;  4PD4 D;  1AVY A;  2XZ0 D;  1BDD A;  2HFE D;  4H0L B;  5HGN A;  2LTE A;  2C9L Y;  3LW5 J;  3LMO A;  4BRY B;  3LRY A;  3CCQ P;  1JCC A;  1LT1 A;  7CEI A;  5AVR B;  5KAI E;  1IMQ A;  3TDK A;  1M74 A;  2QIW A;  4WY4 B;  3EQ2 A;  1W2E A;  2D2C B;  3PLN A;  2C0W A;  1BXI A;  3L72 J;  4OWF A;  2E43 A;  2OYI B;  2K3R A;  1NU1 G;  2YMY A;  1KOR A;  1K05 A;  1ZR4 A;  1PV3 A;  3GF7 A;  3FGA D;  2KG6 A;  2JR8 A;  2IZ1 A;  2B88 A;  4ASV A;  2EHS A;  4U0D A;  3G28 A;  4MRT C;  3GW6 A;  2BHV A;  2MR8 A;  5AVS B;  1S2E A;  2AFD A;  2QM7 A;  1ZME C;  5CCG C;  1SQV K;  1X0T A;  1L0L D;  1M57 D;  2BCC D;  2Y0D A;  1NTK E;  3CCM P;  1HH0 A;  2B89 A;  2L0Q A;  3KPE A;  1L0N G;  1N8R Q;  3L75 D;  1GMJ A;  2ZYA A;  3USS A;  1WRG A;  2A06 E;  1FJK A;  4K35 A;  2KNC A;  2G3A A;  1YIJ P;  4XFY A;  3V2P A;  4W80 A;  5KAF E;  1VF5 B;  1VQO P;  4JPZ B;  1M56 D;  5TJH A;  1RF0 C;  3II6 A;  2N50 A;  2N6Z A;  5CCG D;  1FOS F;  1LTA C;  2WPR A;  1RF0 A;  1P84 I;  1NTZ J;  2Q1K A;  2FHS C;  2L4B A;  1VPC A;  3L74 G;  2ZXX A;  3PHL A;  2FAE A;  4YPC A;  2AEJ A;  2FYU K;  1R5L A;  2K0Y A;  2WSC H;  1FZE A;  2C9N Y;  3UIA A;  3FXE A;  1RQV A;  3DTJ A;  4WY4 D;  3F89 A;  3A0B E;  1BE3 E;  1NTK K;  2N98 A;  1VDF A;  2BAS A;  2MVV A;  5APQ A;  1H89 A;  3WBH A;  3TSI A;  2WPT A;  1J1E B;  3DS0 A;  2BUO A;  3IN6 A;  2JJL A;  2NRG A;  4DT0 A;  5BS1 A;  3KHU A;  3MZW B;  2CPS A;  2QRX A;  2CK3 H;  1YI2 P;  2K92 A;  2NPS B;  2L9F A;  1NTK J;  4WY4 C;  4C7R A;  2RN0 A;  3MD0 A;  1KQS O;  4PH0 A;  3TYY A;  1NTM K;  1DEB A;  4EIJ A;  3HUS C;  3JSV C;  1NHL A;  2R3C A;  1URQ C;  1OFC X;  1VKU A;  5AVZ B;  3C8V A;  3M0A A;  4I1L A;  2E74 C;  1ZOY C;  3WUV A;  1NYH A;  1VQ8 P;  3JCU E;  3JC2 2;  1IK9 A;  1MUU A;  4OVN F;  2Q3I A;  2KB7 P;  2I1K A;  3CL3 D;  4BRY A;  2OTJ P;  2B9B A;  1KQL A;  2JO0 A;  1EMV A;  2IFM A;  4LC1 A;  5AVV B;  1VF5 D;  1IUQ A;  2J58 A;  5EJD A;  5CCH C;  1MZ9 A;  2HPC B;  3CCE P;  2O3J A;  1U57 A;  3AE2 C;  5CJ0 A;  1N7S C;  5AW8 B;  3BRV B;  5CCH A;  3L35 A;  5KLI C;  1DH3 A;  3MTU E;  4IOI H;  3TGU G;  5AW3 B;  1VQ7 P;  3G9R A;  1YTZ I;  1QVG O;  2KK7 A;  2PEQ A;  1EZV I;  4N3Y B;  3L70 D;  3VP8 A;  3L73 E;  1EXJ A;  3L75 J;  5AW0 B;  3TGU J;  1MFZ A;  1AA0 A;  3NTN A;  1N7S D;  2GM4 A;  2PFX A;  4U3F D;  1K30 A;  1LTB C;  1PFI A;  2Z4E A;  4M3L A;  3HD7 B;  3EJD A;  1LT9 A;  3Q5S A;  5KKZ B;  1NH4 A;  1SQB J;  2ZT9 C;  1VL2 A;  5BVZ A;  1H0T B;  5AVW B;  1SQV J;  1EQ7 A;  2KG9 A;  2N9Y B;  3DPH A;  4DJG A;  1YQ3 C;  3FXD A;  4COC A;  4COP A;  4H13 D;  4EOT A;  1KYO E;  4PJ0 H;  1BSN A;  2ZJS E;  3CCU P;  4IFM A;  5KLV D;  4OH8 B;  1T2K C;  3L71 J;  3CCV P;  2AXT E;  1VHN A;  3TK1 A;  3E7K A;  1U7J A;  2Y0E A;  1NTK G;  4U0E A;  1L4A D;  2KGC A;  3M1M A;  3AE8 C;  1SFC B;  2WSE J;  1KMI Z;  5GTH E;  1HJ0 A;  3AEA C;  4NPE A;  2GZF A;  1URQ D;  1L0L E;  2XV6 A;  2FBW C;  1IFD A;  2ZVN B;  3RK2 B;  1NO4 A;  1SQX E;  2ZFC A;  5APW A;  4DZO A;  1RF1 A;  2QJY B;  1YJW P;  1T2K D;  2P1J A;  3MP7 B;  1X3O A;  4H13 C;  2BCC G;  5DJU B;  3G1G A;  2KOQ A;  4YXW H;  2AEF A;  3KXD A;  4PJ0 E;  1PL5 A;  4C7N B;  1CW5 A;  2A45 I;  2OYH C;  1EDI A;  3VMY A;  1HBW A;  2L6E A;  5BU5 A;  5GTI E;  4N6J A;  4R4L A;  1BSH A;  2W6J H;  1GTW A;  5HGL A;  2FFD C;  2PEM A;  1IZN B;  4UB8 E;  5APU A;  2KOG A;  1BCC G;  2LXB A;  1N7L A;  1NAY A;  2YXR B;  3HD7 D;  2OYH B;  1LTJ A;  3RL0 C;  1L0N J;  2QNW A;  1QVF O;  4UB6 H;  2BEQ D;  3HE5 A;  2KNC B;  1IFM A;  4PD4 H;  3Q3D A;  4QKO A;  4ZMD A;  1K73 Q;  1ZR2 A;  3HE4 A;  4Y28 J;  1DV5 A;  1M7L A;  4H13 B;  3TNU A;  2NO8 A;  2A45 G;  1GL2 B;  1PP9 J;  2WSC J;  4NEO A;  2H88 C;  3GF3 A;  1PGP A;  2N1T A;  1U7M A;  1VQL P;  1NKZ B;  1SQP G;  2IBZ E;  3WMM 0;  2FQ1 A;  4IL6 H;  1SQQ J;  2E75 C;  3OA7 A;  1KB9 H;  1NU1 K;  1URQ B;  2IBZ D;  1PPJ G;  4XFZ A;  3HUS B;  4YXD C;  1M1K Q;  3N7N A;  3L36 A;  1M6N A;  2R3S A;  3K5B A;  1AYI A;  1LT9 B;  1HTL C;  1JM0 A;  5I4T G;  5E79 H;  5HVC A;  3CXH D;  4A7P A;  5AVX B;  3NFQ A;  3GLM A;  5CBN A;  1JUN A;  1NTZ K;  2K94 A;  2WPQ A;  3H4E A;  3SFE C;  2R44 A;  2CPB A;  2XKM A;  3GHG B;  2Z5H A;  4XA4 A;  3T97 B;  1DX7 A;  1FOS E;  1SQX D;  1SQQ E;  5CZD B;  1Q7Y Q;  1EDL A;  3H1K G;  5BU8 B;  1EZV G;  1FAV A;  1FS0 E;  3H1H G;  2IDB A;  3NXS A;  1QLE D;  3H1L G;  1A8O A;  2KOP A;  2AVA A;  4IPY A;  3A2A A;  2O01 J;  5AW5 B;  1K9M Q;  1SFC A;  3H1K E; 
#chains in the Genus database with same CATH homology
 2Z45 A;  4QNB A;  1IUQ A;  3DS3 A;  5HGN A;  2DGY A;  4XRO A;  1NJI Q;  1RO0 A;  1Q82 Q;  4U0E A;  1S72 P;  3OW2 O;  1K73 Q;  3CCE P;  3Q20 A;  2PEN A;  4WYM A;  1EIA A;  2PEO A;  3LRY A;  3CCQ P;  3M1M A;  2OTL P;  1VQ4 P;  2PEJ A;  3G26 A;  1VQ6 P;  3B5I A;  3G21 A;  3CD6 P;  1M74 A;  3MGE A;  4U0F A;  4M0I A;  5F2N A;  1M90 Q;  2CWO A;  1VQL P;  4PH1 A;  3G6E P;  2XV6 A;  1YJN P;  1EOQ A;  1K8A Q;  1VQ7 P;  3I55 P;  3CME P;  1QRJ A;  3DS1 A;  1RNI A;  3VRL C;  1Q86 Q;  3DTJ A;  1QVG O;  3G29 A;  1PEM A;  5JPA A;  2M8P A;  3H47 A;  4XFZ A;  3CCR P;  2PEQ A;  1ZMB A;  1M1K Q;  2P9X A;  3WBH A;  2PEI A;  3G4S P;  1YJW P;  5BS2 A;  3G71 P;  1M6N A;  3CC2 P;  5F2K A;  1YIT P;  1VQM P;  5HGM A;  1PEU A;  2EG5 A;  3DS0 A;  5I4T G;  2BUO A;  1KC8 Q;  1PEO A;  1K30 A;  3E2D A;  2Z46 A;  5BS1 A;  2JYL A;  3G1G A;  4U0D A;  1YHQ P;  2EFJ A;  3G28 A;  2ONT A;  5HGO A;  1A43 A;  3CXC O;  3H0D A;  3DS2 A;  1YI2 P;  5DCK A;  2BHV A;  1W2B O;  3CC4 P;  2PEK A;  1YJ9 P;  3H4E A;  2QEX P;  3I56 P;  2JYG A;  1BAJ A;  1VQN P;  3CMA P;  3HYB A;  1VQK P;  2EIA A;  2M8N A;  2Z44 A;  1KQS O;  4PH0 A;  3DPH A;  1Q81 Q;  1D1D A;  2LF4 A;  2BQ1 E;  2L6E A;  4COC A;  4COP A;  2M8L A;  3G0V A;  3CC7 P;  4GR6 A;  3CPW O;  1AUM A;  3CCM P;  5F2O A;  3CCL P;  3DS5 A;  1N8R Q;  1E6J P;  1PEQ A;  2PY8 A;  1KD1 Q;  4U0A A;  3P05 A;  2OAR A;  3CCU P;  5HGL A;  3RG6 C;  2QA4 P;  1Q7Y Q;  2PEM A;  3CCJ P;  1VQ5 P;  1RO2 A;  3NTE A;  4U0B A;  1M6E X;  4U0C A;  3DS4 A;  1VQ8 P;  2KOD A;  2XXM A;  3HZQ A;  4GR2 A;  4XFY A;  1VQP P;  1YIJ P;  3CCV P;  1JJ2 O;  2E1M A;  2XT1 A;  1A8O A;  1VQ9 P;  1VQO P;  4XRQ A;  2OTJ P;  4IPY A;  4XFX A;  3CCS P;  1QVF O;  1K9M Q;  2JO0 A;  3G1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...