1VQNP

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqnP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqnP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqnP02
3CCMP 1VQOP 1YJNP 1KD1Q 3CCVP 1VQ4P 1VQ7P 1VQNP 3CD6P 2QEXP 1S72P 3CC2P 3CC4P 3CMAP 3I56P 3CCQP 1VQ9P 1Q7YQ 1VQKP 3I55P 3CCEP 1QVFO 3CCLP 1JJ2O 1KQSO 3CMEP 1Q82Q 2QA4P 3CCSP 3G6EP 2OTJP 1M1KQ 3OW2O 1N8RQ 1KC8Q 3CC7P 1K8AQ 1VQ6P 3CCJP 1W2BO 3CXCO 1YI2P 1QVGO 3G4SP 1K73Q 1VQ5P 3G71P 1VQMP 3CCUP 2OTLP 1YIJP 3CPWO 1YJ9P 1K9MQ 1Q81Q 1VQPP 1YITP 1M90Q 3CCRP 1Q86Q 1YHQP 1YJWP 1VQLP 1VQ8P 1NJIQ
chains in the Genus database with same CATH superfamily
2ZJSE 3TNUA 2Q6QA 3CWBD 2YIUB 1N73A 2IX7C 2ERHA 2ZAEB 4W80A 1N7LA 5GTIE 3CI9A 2YMKA 4NPFX 1HJBA 1OX3A 3S9OA 1HF9A 5F2NA 3H1LD 2OYIC 1K9MQ 2PP6A 2VRSA 5CCHD 2MVUA 2OTKE 1DEEG 4PXHB 3GF7A 2XT1A 2FYUG 1A8OA 4D6TD 4BWNA 2R3CA 4DG9A 3BCCJ 1LTJC 2X2BA 2OTLP 3AEGC 3B5NC 4PV1B 1LWUA 2WTYA 4CA3A 4YTPC 1NTKJ 3JCUE 3H0DA 2HPCA 1IFDA 3MHVA 1IFJA 2O1JA 3H1HE 1OXZA 4HYTB 1KQFB 5M1BA 1EIAA 2FQ2A 1S5LE 1N7SC 4BPHA 1YHQP 2N6YA 2JAZA 1JMBA 1IZNB 5APYA 5CBOA 2VLQA 2N1TC 1QX8A 3EFFK 3N7NA 1FOSF 2K5XA 1KILB 3NTNA 3GKLC 2FFDA 1Z56A 3TK1A 2K37A 4L73A 1HBWA 1AYIA 1ZXGA 5AVUB 1GXHA 3L73J 1JM0A 2YMYA 3RG2A 1K30A 1S2EA 4AUWA 2A06D 2Q3EA 3VRLC 5B5EE 3G0VA 3BCCD 3CCJP 1YYCA 2W6AA 1VQMP 3RG6C 5CCGA 1KN7A 2WITA 3IFMA 1NTMK 1FJPA 1N7SB 2FKWB 2LXBA 3HD7D 4KHXA 3USSA 3CWBG 4PD4E 2KOOA 2MY5A 1OVUA 1PP9G 5APTA 1GU4A 2N1TB 2KYVA 1KTMA 3AE6C 4KJMA 3TNUB 1NWQA 1IMPA 1JMMA 1SS1A 2Y0EA 4QMAA 2OYOA 5KP6B 1YITP 3U1CA 5KAIH 1NU1G 2KG6A 2ZVOB 3WUUA 5TJHA 1OW6A 2IFNA 1K04A 4IFMA 1EDLA 2BCCJ 1H89A 2CK3H 1KYOE 2P10A 1QL1A 4DJGA 3L73D 3TSIA 3D71A 3HE5A 3CD6P 4OGQD 1W2EA 3I56P 1QVFO 2WPVB 1AQ5A 1LWUB 4WBAA 1WT6A 4UHPB 3VMXA 2CNRA 3L72E 2HPCB 1UIXA 3U1AA 2FYNC 1SFCD 1SQVE 3V5BA 1BCCE 3SWYA 2W90A 3B8EB 5AVYB 1RY3A 3RK2B 3VOPA 1JY2P 1LTBC 5BU8B 1OR5A 3G71P 3R4YA 1CSBA 2E74C 2FVFA 1U7MA 1BSNA 3WUVA 3CCVP 5AW8B 1T2KD 2FFDB 2ZFCA 4OH8B 3OJAB 1QEXA 1UIIA 1EMVA 3V2NA 2C9NY 2BCCD 1BGYG 2IZ0A 4IFFA 1LTAC 4H44B 1ZR2A 2N9YB 3BCCG 3RK3D 3KZIH 2P2UA 2D2CB 2ZYAA 1NTKG 1AF8A 3M1MA 3H1KE 3L35A 2IBZD 1VF5C 2AFDA 3WU2E 2GUVA 1PPJG 2AEJA 2YXQB 2C0WA 1DH3A 4XA4A 1URQC 3NXSA 1L4AC 2RMZA 2E74B 1VQLP 5KTBA 1J1DC 1CI6A 4WVZA 1AFOA 2JDIH 1ZR4A 2QJPB 4GODA 2Z5IA 4K3AA 1SQQE 3FWNA 1M1JC 2AXTH 2H89C 1YIJP 2KS1A 2K9JA 3GHGC 2LKIA 3CCMP 1KD1Q 2QEXP 2HODA 2XZRA 2AEMA 4RO0A 1MFZA 3U59A 1M6NA 2YO2A 3HE5B 2HG5D 2DW3A 1ZRTE 2ZYGA 2NPSC 1OVRA 2ZXEB 3P8CE 1VQPP 1LT1A 2H43A 4DOJA 1L4AB 3G28A 1MKMA 4NPDA 3S4RA 4QNBA 3SSUA 2OYHA 5KJ7D 5AW1B 1J1DB 2ZT9C 1KQGB 2POHA 2LIUA 3CXHI 3FGAD 1SQXJ 1CZQA 1FZEA 4W7ZA 3H1LE 3MZWB 4RESB 2GM4A 1YBKA 2GYKA 4O9BA 1X79B 2W6JH 4OVNF 1ZP0C 3G3ZA 3H6PA 1VL2A 1VQ7P 1PGJA 2KR5A 5KKZC 2A45I 1X8YA 2KSJA 4D6TE 3F5HA 4H2WC 1UJZA 2FYUJ 3CC7P 2M8NA 3H1JJ 5BS1A 2ONTA 3FX0A 1L0LJ 4WWIA 5CJ0A 2XDJA 1OW8A 3L70G 4JYBA 3KPEA 2K1AA 1CW5A 1FZCC 1FU1A 2ZT9B 2M3BA 2Y9YA 1AUMA 2BEZF 4HB1A 1KB9H 1H8AA 2QNWA 2J59M 1HQBA 1EOQA 3H1IE 5KLIC 1X3OA 3GG2A 1SQXD 1EZVD 3CL3D 5C39A 3V2QA 3RL0g 5AVWB 1H0TA 4RJTA 5EJDA 1K73Q 1GL2D 4ASVA 1CI6B 1RF0A 5KP8B 1RO0A 3MUDC 5APVA 5APUA 1LT9C 2WT7A 2JBGA 2A06E 4HKGA 4IPYA 2KS1B 1K05A 4HKZH 2FYUD 2E1MA 2K9JB 5CMZA 4BRYA 3CCSP 2I1JA 4JPZB 3H1JD 1KB9D 2HODB 3EQ2A 1PGQA 4M0IA 3L37A 1FJKA 2E76D 5KLIB 4BPFA 1RNIA 1JTHB 2OYIA 1IK9A 3GW6A 1SLQA 1PP9J 4U0EA 2KODA 2PGDA 2RN0A 4Z1MH 2OYHB 2H88C 1UNKA 3DS1A 1SQQK 4PD4I 7CEIA 2FXOA 1NU1J 3HZQA 2H7HA 2FAEA 4U0DA 2QM7A 1SQPG 1LTJA 4H0LC 1JCCA 1JOCA 3B5NA 2IPPA 5AVTB 2ZVNB 2CGQA 2FACA 2K92A 1JNMA 3L73E 1PEQA 2R44A 2KOQA 2K2QA 1NJIQ 2K9YA 3C1LA 2JYLA 3CCLP 2QJKB 3AE5C 3EFGA 4WYMA 1HH0A 1Y8AA 5AVZB 5BU5A 1N7SA 1U7JA 4H13D 5H2FE 1T3JA 3S1KA 5E79H 1GW4A 2WSEJ 2PY8A 2QJYC 5HVCA 1FBMA 5CCHC 2N1TA 2YO3A 3OAKA 1PEMA 1FZGA 1SQXG 3M9HA 1EZVG 5HGOA 4H0LB 2CG5B 1PP9D 2LKMA 2MKVA 3NFQA 5F2OA 2SPZA 2WSEH 1SQBG 3A0BH 3FWLA 2PEJA 1NU1D 1EQ7A 1H0TB 2I8DA 1R5LA 1ZLLA 2BCCE 1OW7A 1AA0A 4PV1D 1JO5A 3RK3E 2O1KA 5AW3B 1BGYJ 3H1JG 1DIPA 3CXCO 2WT7B 1GMJA 1KV4A 1JCDA 2YKOA 1L0LG 2FYZA 4BRYB 1HGVA 2IBZE 3RBZA 4EYYQ 4I1LA 4EIJA 2L5GB 4COPA 1G2CA 3A3YB 5EFWB 3Q5PA 5DJTB 4XFZA 2N5IA 3DTJA 5EW5E 2OYIB 2IDBA 3DPHA 1DEBA 2Y0DA 3O8ZA 2GZGA 4PJ0H 3HUSC 2ZYDA 1KORA 2AFEA 2P9XA 2MD9A 1Q7YQ 1KILD 1FC2C 1P84H 1GPJA 3AECC 2N98A 3KXDA 4WY4D 4I2LC 3KZIE 3AE1C 1KFMA 1N86A 1NYHA 2YKPA 1PGOA 1J1EC 2M8PA 3CPWO 2KWLA 1YJ9P 1NTKK 1LTJB 2MF4A 1FE6A 3VYIA 3AEDC 3B5NB 1Z6MA 4A7PA 3VMYA 3HE4A 4N78D 1L0NJ 3HD7C 1NTZJ 1Q82Q 1BGYD 3UIAA 3L75G 2KOPA 3G29A 4U0BA 1YI2P 2UWJE 1MFTA 4YXWH 2O3JA 3MIWA 2QM8A 1NTKD 2PEOA 2JU2A 3H4EA 2JO0A 3BVHA 2GZFA 3A7OA 1P84D 1A43A 1RHZB 5HV8A 1PPJD 1DD3A 4AQRD 2AXTE 3E1RA 3MGEA 5AW5B 1MZ8A 1GW3A 2DGYA 3QH9A 3NMDA 3AEBC 4EOTA 3RL0D 1VQ8P 1X9VA 2B89A 4XROA 1VPCA 5GTHH 1S9KD 2GZIA 4OGQC 1KQLA 1BE3G 3KDPB 4TT3H 2R5BA 3E2DA 3TF5A 2YXRB 2VLNA 3WUTA 2LIWA 1YQ3C 4YPCA 5AW6B 1DX7A 3GZMA 1SFCC 2M8LA 1HTLC 1GZLA 1RQUA 3OA7A 1M57D 2FY8A 2GDYA 1OWAA 1HVVA 1JY2O 4GOFA 2P7JA 3L70J 1URQA 1L0ND 1ZOYC 3CX5H 4ZMDA 2P67A 4WB4A 1L4AA 1RE3C 2WPSA 1Q90D 3HTKA 2Q3IA 2LXCB 1YTZT 3BRTB 4QKOA 3PH0A 2A45H 1PL5A 3LW5J 5I4TG 1G2CB 2LPKA 2Q9IA 3RK2D 1BAJA 2OQQA 3P7KA 3FXEA 2BASA 3MTUE 4R4LA 2VSQA 2N6ZA 3CCQP 2W83C 1M1JA 1T2KC 5KP7B 2XXMA 2LF4A 1NVOA 2M3EA 3GHGA 2AVAA 1IFPA 3AE7C 3LRYA 1VDFA 4IFDK 3LW5H 3PLNA 1FOSE 3RK3C 3SFDC 4PWVB 4MN4C 3CC4P 2FYUE 4H44D 2E75D 3CX5D 2Z46A 3L71G 4YXDC 2D2CD 1KB9E 3M0AA 2LR2A 2K93A 2NPSA 1PV3A 1JUNA 1VQ6P 2CPSA 3PHLA 3VMZA 1VQ5P 1OVVA 3HE4B 1Q81Q 2FYNB 2BUOA 5F2KA 5CCGD 5B66H 5HGMA 3L70D 4U3FG 4IOIH 3CMEP 1SP4A 2Y9ZA 2O01N 3L74G 5KLVG 1GD2E 3IF4A 3B4QA 5AW4B 3TDKA 3CMAP 5AW9B 1T3UA 2QSIA 4N3YB 1SQPJ 2MJZA 3I5CA 4B86A 4L76A 4LC1A 4XRQA 1FZCA 1NTMG 2KK7A 2XZ0D 2QIWA 1NH4A 3AE2C 2KG9A 5KJ7C 2IYOA 1L0NG 1NTZG 4XFXA 1VF5B 2N9BA 1M56D 2JP3A 3MP7B 2L4BA 1URQB 1M7LA 2JJLA 1JTHA 1Q86Q 2C9LY 3B71A 2CWOA 3CWBE 4F37A 1SQPK 3HTKB 3EJDA 3TGUJ 2FADA 1KLPA 2WPRA 1EC5A 1PP9E 3DS0A 2BEQD 5CHXA 1M1KQ 1KC8Q 1H88A 2V4HA 1D1DA 3MUDA 2E5YA 3PTZA 1LT9A 3P05A 1NU1E 4C7RA 1KYOH 3V4QA 1M1JB 2KGEA 3GJNA 1SQBJ 3GHGB 2WPQA 1SQVJ 1SQPD 1USEA 1OFCX 3R2PA 4EI2A 1HY8A 3A5TA 5CJ4A 2Q1KA 2QG4A 5E79E 4U0FA 3CCUP 1VHNA 2GZEA 3JC22 1NAYA 3IAOA 2JU1A 1OZHA 2A45G 2NPSB 2ITAA 2WZ7A 1M74A 5AW0B 1SQXK 1FZAA 1VQ9P 2KXPB 1BDCA 2IFMA 3DS3A 2IBZI 4W7YA 1AJYA 2JGPA 2R32A 3A0BE 1SQBK 1KYOD 3B4SA 1GL2C 4R4MA 2G8YA 3SWFA 1Y9BA 4IZ6A 1YJNP 1KILE 2EIAA 3TGUD 2GDXA 1ZMEC 1WRGA 4DCKA 3BASA 2FYUK 2JEEA 5KKZB 1AV1A 1PGPA 1BXIA 3H1HG 3PP5A 1L0LK 2CPBA 4LGDE 5KAFH 2PEIA 3DS4A 2MR8A 3Q2YA 1SQBD 1W5CE 1S4XA 1FZFA 3SFEC 1SQVD 1HGZA 3HRNA 3L36A 4N78E 1VKUA 1QLED 2CQ8A 1BGYE 2E76C 4MRTC 1FZCB 2PEQA 3WBHA 3BCCE 3H47A 3L75J 5L8RJ 1E79H 5CCHA 2JQ4A 1NTKE 1L0LD 4CPGA 1E0HA 3ZDMA 1GL2B 4PJ0E 1NOHA 2FXMA 1KMIZ 4COCA 1P84E 5AVQB 1PPJE 1NGMB 3LMOA 3O6QA 1U57A 2KUBA 2WVRA 1JY3P 2PEKA 1G1IA 2KOGA 3H25A 3M9BA 2B88A 1T8ZA 1ZMBA 5CBNA 4U0CA 1S9KE 1L2PA 4LLHA 1LT9B 2W27A 3B5IA 3PJSK 1BE3J 2E76B 2Z44A 1S3JA 5DCKA 1RE4A 3G21A 1JB0J 2J5UA 4JYCA 3GMAA 3EJEA 5APXA 2NRGA 2N50A 4ASWA 4H13C 2KGDA 2BHVA 5TISH 2JKVA 2YKQA 3QWOC 3CCEP 2GZJA 3V6IA 1LNQA 2E5TA 1RF1C 3L75D 5JPAA 3DS5A 2XNDH 3VTPC 3G1GA 2GA1A 3ITKA 2K94A 5KAIE 3HUSA 1SVFA 3M0DC 1ZV8A 1NU1K 1YJWP 4IL6X 4GDOA 1VQ4P 1LTIC 3TGUG 5BS2A 2AXCA 1T6AA 1S1CX 3KYQA 3AE9C 1JY3N 1ACPA 3BATA 3T97B 1ZN5A 1GDTA 1QVGO 3Q20A 1PFIA 4PV1C 3GF3A 3L72G 1EZVI 2L91A 4ZNCA 2XV6A 4H13B 3HD7A 3P8CD 5AVVB 1R8EA 1SQVG 2I1KA 3CX5E 2K0DX 3CC2P 1BE3D 1BCCG 2LL8A 3H1IJ 3L71J 1RF1B 4GT1A 2KLUA 1X0TA 1LJ2A 3BRVB 2R5DA 4XE5B 2L0QA 4AYCA 1RE4C 3L70E 1IO4A 1GU5A 1KB9I 3HYBA 2QJYB 2GUSA 2LMLA 4U3FJ 2LTEA 1N2DC 3N4XA 2KLVA 2GDWA 3RBXA 1FDOA 1KILC 5HGNA 1K8AQ 2KORA 3L74J 4WY4C 5KLVJ 1ZW0A 3O6QB 4I7ZC 1E6JP 2PRRA 1HWTC 4JQ0D 1KFNA 4JF7A 3VP8A 2KGAA 1LGHB 1VQKP 3JSVC 1EDKA 3AEFC 3H1KG 4UB8H 4ZKUA 3M06A 1SFCA 3B5ND 1IC2A 3VN0A 2FBWC 3C9IA 2FVEA 1HUCA 3CE7A 1JEKA 5B66E 1A02J 1VQOP 1NTMJ 2EG5A 3K5BA 3AEAC 3W67A 1RE3A 3H32A 1M6EX 1PEUA 1XTGB 3H1ID 3L71D 3LIEA 2FQ0A 1NKNA 5AVRB 5KLVK 1N73C 4I6MC 1EDJA 1L0HA 1N7SD 2WSFJ 4WY4B 4IL6H 3AEEC 1NO4A 2EFJA 1SQQG 4UB6H 3FXDA 4Y28J 4I7ZB 4NEOA 3D6YA 2HYNA 4HJGH 4U3FD 3RL0C 2HLOA 1S5LX 2N1TD 2M5RA 3II6A 2HR3A 3HUSB 1RH5B 3Q5RA 3L74D 2AEFA 2PENA 5KLVD 2NZ2A 2WSFH 1FDMA 1J1EB 5AW2B 2KG8A 3D6ZA 1QGKB 1SQPE 1NKZB 3KHUA 1LWUC 1L0NK 1NTZK 2KSEA 3SWKA 5DJUB 2MR7A 1FZBA 1LP1A 5APSA 3A0HH 3HD7B 3G4SP 1N73B 4K35A 2W6BA 3H1LG 4U7JA 5H2FH 2XKMA 3CXHH 1NTMD 2M5AA 2KGCA 3E1IA 4GIFA 3V2PA 3Q5SA 1MV8A 5HGLA 3RK2C 1KZUB 3DS2A 2B87A 3RL0B 2KOSA 2KW2A 1GK4A 1HJ0A 1NTZD 1TU3F 4D6TG 1W2BO 5GTIH 2FQ1A 4XFJA 3TGUE 2R3SA 2Y0CA 1YQ4C 2FFDC 1SQXE 4M3LA 1EZVE 2XV5A 4H44C 2E75C 4TLFA 4OGQB 4GR6A 4XFYA 2D2CC 2K88A 3H1HJ 1SQBE 4OWFA 2O01J 3CXHD 1M90Q 3CCRP 5KJ7A 2WMMA 1BSHA 4PH0A 2L6EA 1SFCB 5CCGC 3JCUH 1IUQA 1GK6A 2OGUA 1E5WA 2L9FA 1JJ2O 3H1JE 3H1IG 1LTGC 1L0LE 2YNYA 3H32B 1IJDB 2O01H 3V2RA 3GLMA 3PRJA 1S5LH 2FHSC 4BXLA 4L74A 5BVZA 2QJPC 2B9BA 2XU6A 2A06G 2E75B 3F89A 3C8VA 5KAFE 2QE7H 3NTEA 2E74D 1P84I 5CZDB 2RH0A 2Q5UA 1QL2A 5K5GB 3RK3B 1IMQA 3TYYA 4JBZA 2K0YA 1S72P 2PNGA 3G1IA 2L22A 1Q2NA 2QVAA 1NQ4A 3H1HD 1NHLA 3A2AA 2W8ZA 5B5EH 1IFMA 1LP1B 3D70A 2AF8A 1VF5D 2Z45A 1JY2N 3L75E 2IYPA 2J58A 2Q7CA 2ZXXA 4PD4H 3GZLA 1URQD 3W68A 1GL2A 2WSSH 2M5AB 4Y99C 4R0MA 1L4AD 2KZJA 2V7QJ 1OMIA 2B87B 2E43A 2M0BA 2JWDA 1PZQA 3L73G 2WQYC 1WMKA 2BQ1E 2PFXA 2PEMA 3AE3C 1DV5A 2K3RA 2JR8A 2FVAA 3LIDA 3RGUA 1M8OB 4NPEA 1T8KA 2V7QH 1GTWA 2WWWA 5TISE 3L72J 2Z4EA 3U43A 1EXIA 1FAVA 1VQNP 3KQGA 4ZKPA 1BE3E 2WPTA 2KP8A 2XZ1C 1F80D 1BCCJ 4PD4D 1A02F 3OW2O 5AVXB 2KNCA 1LTTC 2N5HA 4Y99B 2NPSD 3VMAA 3CX5I 1FDIA 3Q3DA 1PIXA 1EXJA 2WSCJ 2ZT9D 2RKLA 3IR9A 1MZ9A 2KI7B 4C7NA 3M9QA 2M8RA 2FXPA 1LTSC 1R5SA 2BCCG 3P8MC 3CLQA 1BDDA 1FR2A 2WSCH 1SQVK 2DNWA 3T97A 1AVYA 2IBZG 3I55P 1CEIA 3WMM0 4GOEA 3E7KA 1IFIA 1RQVA 3H1KJ 2OARA 2P58A 4HH2A 2VLOA 5AVSB 3MGNA 3L72D 1USDA 3AE8C 1X22A 4RKUJ 2HFED 1PEOA 4BPGA 1RF1A 3IN6A 3L71E 1BCCD 1KQSO 1JY3O 2IZ1A 1YTZI 3M0DA 2OYHC 5APQA 2JYGA 3WU2H 2PAJA 2ROQA 1QRJA 2XNXA 2C0XA 1SQQJ 4U3FE 1EDIA 1Y47A 4UB8E 2JWAA 3ABVC 2EHSA 3L74E 2LOLA 5KLVE 2JB0A 4U0AA 1XTCC 4H2XC 1ZNVA 1L0IA 1AVOA 3P32A 4PH1A 4DZOA 3Q1MA 4N6JA 2QJKC 3CWBJ 3MD0A 1G1JA 3H1KD 1N8RQ 1MUUA 3V4WA 3L4FA 4IL6E 4EDFA 4UB6E 3G9RA 1NTME 3H1LJ 4H2YC 4KT0J 2MVVA 2KNCB 2YIUC 1DNYA 3NY7B 1FS0E 1KILA 1L0NE 1IFNA 1NTZE 1IK7A 1DD4A 4GKGA 2JO1A 2E42A 4WY4A 2QA4P 3G6EP 3VP9A 1NAFA 2P1JA 1AQTA 4D6TJ 4L75A 2KZIA 5APWA 1SQQD 4C7NB 4GR2A 2NO8A 5GTHE 4H0LD 1RF0C 1D7MA 4DT0A 1KYOI 3EJBA 2H8PD 2G3AA 2Z5HA 4C46A 3A0HE 1GXGA 5AW7B 2OTJP 3G26A 3M91A 2KIKA 1OIPA 2K0XA 1RO2A 3CXHE 3EWKA 2QRXA 2VLPA 2EHTA 3AE4C 1J2JB 1ZRTD 2KB7P
chains in the Genus database with same CATH topology
3CCMP 1KD1Q 1VQNP 1M74A 2QEXP 1EOQA 3CMAP 2JYLA 1VQ9P 2P9XA 1Q7YQ 3CCLP 1K30A 3B5IA 3DS3A 4WYMA 3VRLC 2Z44A 5DCKA 4U0AA 3OW2O 3G21A 5HGNA 1M6NA 3G0VA 1K8AQ 3CCJP 3G4SP 1K73Q 3NTEA 3G71P 1VQMP 5F2NA 3RG6C 2M8PA 4XRQA 3CPWO 1YJ9P 1K9MQ 5I4TG 1E6JP 2BHVA 1VQPP 1RO0A 1BAJA 2PY8A 3G28A 4PH1A 1YJNP 4QNBA 3CCVP 2EIAA 5HGLA 1S72P 4IPYA 1VQKP 3DS2A 3CCQP 3CCEP 1PEMA 3G1IA 2E1MA 2XT1A 4XFXA 1Q82Q 2XXMA 3CCSP 1A8OA 5HGOA 2LF4A 1N8RQ 3G29A 3LRYA 1W2BO 4U0BA 1YI2P 5JPAA 3DS5A 3G1GA 5F2OA 2OTLP 2PEIA 3DS4A 1YITP 2PEOA 1Q86Q 2PEJA 1YJWP 2CWOA 4M0IA 3H0DA 1VQOP 3M1MA 2EG5A 3H4EA 1VQ4P 1VQ7P 2Z45A 3CC4P 2JO0A 1M6EX 5BS2A 3I55P 1PEUA 2Z46A 1A43A 3DS0A 1RNIA 2OARA 2PEQA 3WBHA 2QA4P 3G6EP 1M1KQ 4GR6A 1KC8Q 3H47A 3CC7P 2M8NA 4XFYA 1VQ6P 4U0EA 1EIAA 2KODA 3CXCO 1QVGO 1D1DA 3MGEA 3Q20A 1VQ5P 5BS1A 3DS1A 2DGYA 2ONTA 3P05A 1Q81Q 1PEOA 2EFJA 2BUOA 2XV6A 1M90Q 5F2KA 3CCRP 1YHQP 4GR2A 1VQLP 1VQ8P 4PH0A 2L6EA 5HGMA 4XROA 4COCA 3CD6P 3HZQA 1IUQA 3CC2P 4U0DA 3I56P 1QVFO 2BQ1E 2PEMA 1JJ2O 4COPA 1KQSO 3CMEP 2OTJP 1AUMA 3E2DA 3G26A 2JYGA 2PEKA 2PENA 1RO2A 4XFZA 4U0FA 3CCUP 1QRJA 1YIJP 1PEQA 1ZMBA 3DTJA 2M8LA 3DPHA 4U0CA 1NJIQ 3HYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM P;  1VQO P;  1YJN P;  1KD1 Q;  3CCV P;  1VQ4 P;  1VQ7 P;  1VQN P;  3CD6 P;  2QEX P;  1S72 P;  3CC2 P;  3CC4 P;  3CMA P;  3I56 P;  3CCQ P;  1VQ9 P;  1Q7Y Q;  1VQK P;  3I55 P;  3CCE P;  1QVF O;  3CCL P;  1JJ2 O;  1KQS O;  3CME P;  1Q82 Q;  2QA4 P;  3CCS P;  3G6E P;  2OTJ P;  1M1K Q;  3OW2 O;  1N8R Q;  1KC8 Q;  3CC7 P;  1K8A Q;  1VQ6 P;  3CCJ P;  1W2B O;  3CXC O;  1YI2 P;  1QVG O;  3G4S P;  1K73 Q;  1VQ5 P;  3G71 P;  1VQM P;  3CCU P;  2OTL P;  1YIJ P;  3CPW O;  1YJ9 P;  1K9M Q;  1Q81 Q;  1VQP P;  1YIT P;  1M90 Q;  3CCR P;  1Q86 Q;  1YHQ P;  1YJW P;  1VQL P;  1VQ8 P;  1NJI Q; 
#chains in the Genus database with same CATH topology
 2ZJS E;  3TNU A;  2Q6Q A;  3CWB D;  2YIU B;  1N73 A;  2IX7 C;  2ERH A;  2ZAE B;  4W80 A;  1N7L A;  5GTI E;  3CI9 A;  2YMK A;  4NPF X;  1HJB A;  1OX3 A;  3S9O A;  1HF9 A;  5F2N A;  3H1L D;  2OYI C;  1K9M Q;  2PP6 A;  2VRS A;  5CCH D;  2MVU A;  2OTK E;  1DEE G;  4PXH B;  3GF7 A;  2XT1 A;  2FYU G;  1A8O A;  4D6T D;  4BWN A;  2R3C A;  4DG9 A;  3BCC J;  1LTJ C;  2X2B A;  2OTL P;  3AEG C;  3B5N C;  4PV1 B;  1LWU A;  2WTY A;  4CA3 A;  4YTP C;  1NTK J;  3JCU E;  3H0D A;  2HPC A;  1IFD A;  3MHV A;  1IFJ A;  2O1J A;  3H1H E;  1OXZ A;  4HYT B;  1KQF B;  5M1B A;  1EIA A;  2FQ2 A;  1S5L E;  1N7S C;  4BPH A;  1YHQ P;  2N6Y A;  2JAZ A;  1JMB A;  1IZN B;  5APY A;  5CBO A;  2VLQ A;  2N1T C;  1QX8 A;  3EFF K;  3N7N A;  1FOS F;  2K5X A;  1KIL B;  3NTN A;  3GKL C;  2FFD A;  1Z56 A;  3TK1 A;  2K37 A;  4L73 A;  1HBW A;  1AYI A;  1ZXG A;  5AVU B;  1GXH A;  3L73 J;  1JM0 A;  2YMY A;  3RG2 A;  1K30 A;  1S2E A;  4AUW A;  2A06 D;  2Q3E A;  3VRL C;  5B5E E;  3G0V A;  3BCC D;  3CCJ P;  1YYC A;  2W6A A;  1VQM P;  3RG6 C;  5CCG A;  1KN7 A;  2WIT A;  3IFM A;  1NTM K;  1FJP A;  1N7S B;  2FKW B;  2LXB A;  3HD7 D;  4KHX A;  3USS A;  3CWB G;  4PD4 E;  2KOO A;  2MY5 A;  1OVU A;  1PP9 G;  5APT A;  1GU4 A;  2N1T B;  2KYV A;  1KTM A;  3AE6 C;  4KJM A;  3TNU B;  1NWQ A;  1IMP A;  1JMM A;  1SS1 A;  2Y0E A;  4QMA A;  2OYO A;  5KP6 B;  1YIT P;  3U1C A;  5KAI H;  1NU1 G;  2KG6 A;  2ZVO B;  3WUU A;  5TJH A;  1OW6 A;  2IFN A;  1K04 A;  4IFM A;  1EDL A;  2BCC J;  1H89 A;  2CK3 H;  1KYO E;  2P10 A;  1QL1 A;  4DJG A;  3L73 D;  3TSI A;  3D71 A;  3HE5 A;  3CD6 P;  4OGQ D;  1W2E A;  3I56 P;  1QVF O;  2WPV B;  1AQ5 A;  1LWU B;  4WBA A;  1WT6 A;  4UHP B;  3VMX A;  2CNR A;  3L72 E;  2HPC B;  1UIX A;  3U1A A;  2FYN C;  1SFC D;  1SQV E;  3V5B A;  1BCC E;  3SWY A;  2W90 A;  3B8E B;  5AVY B;  1RY3 A;  3RK2 B;  3VOP A;  1JY2 P;  1LTB C;  5BU8 B;  1OR5 A;  3G71 P;  3R4Y A;  1CSB A;  2E74 C;  2FVF A;  1U7M A;  1BSN A;  3WUV A;  3CCV P;  5AW8 B;  1T2K D;  2FFD B;  2ZFC A;  4OH8 B;  3OJA B;  1QEX A;  1UII A;  1EMV A;  3V2N A;  2C9N Y;  2BCC D;  1BGY G;  2IZ0 A;  4IFF A;  1LTA C;  4H44 B;  1ZR2 A;  2N9Y B;  3BCC G;  3RK3 D;  3KZI H;  2P2U A;  2D2C B;  2ZYA A;  1NTK G;  1AF8 A;  3M1M A;  3H1K E;  3L35 A;  2IBZ D;  1VF5 C;  2AFD A;  3WU2 E;  2GUV A;  1PPJ G;  2AEJ A;  2YXQ B;  2C0W A;  1DH3 A;  4XA4 A;  1URQ C;  3NXS A;  1L4A C;  2RMZ A;  2E74 B;  1VQL P;  5KTB A;  1J1D C;  1CI6 A;  4WVZ A;  1AFO A;  2JDI H;  1ZR4 A;  2QJP B;  4GOD A;  2Z5I A;  4K3A A;  1SQQ E;  3FWN A;  1M1J C;  2AXT H;  2H89 C;  1YIJ P;  2KS1 A;  2K9J A;  3GHG C;  2LKI A;  3CCM P;  1KD1 Q;  2QEX P;  2HOD A;  2XZR A;  2AEM A;  4RO0 A;  1MFZ A;  3U59 A;  1M6N A;  2YO2 A;  3HE5 B;  2HG5 D;  2DW3 A;  1ZRT E;  2ZYG A;  2NPS C;  1OVR A;  2ZXE B;  3P8C E;  1VQP P;  1LT1 A;  2H43 A;  4DOJ A;  1L4A B;  3G28 A;  1MKM A;  4NPD A;  3S4R A;  4QNB A;  3SSU A;  2OYH A;  5KJ7 D;  5AW1 B;  1J1D B;  2ZT9 C;  1KQG B;  2POH A;  2LIU A;  3CXH I;  3FGA D;  1SQX J;  1CZQ A;  1FZE A;  4W7Z A;  3H1L E;  3MZW B;  4RES B;  2GM4 A;  1YBK A;  2GYK A;  4O9B A;  1X79 B;  2W6J H;  4OVN F;  1ZP0 C;  3G3Z A;  3H6P A;  1VL2 A;  1VQ7 P;  1PGJ A;  2KR5 A;  5KKZ C;  2A45 I;  1X8Y A;  2KSJ A;  4D6T E;  3F5H A;  4H2W C;  1UJZ A;  2FYU J;  3CC7 P;  2M8N A;  3H1J J;  5BS1 A;  2ONT A;  3FX0 A;  1L0L J;  4WWI A;  5CJ0 A;  2XDJ A;  1OW8 A;  3L70 G;  4JYB A;  3KPE A;  2K1A A;  1CW5 A;  1FZC C;  1FU1 A;  2ZT9 B;  2M3B A;  2Y9Y A;  1AUM A;  2BEZ F;  4HB1 A;  1KB9 H;  1H8A A;  2QNW A;  2J59 M;  1HQB A;  1EOQ A;  3H1I E;  5KLI C;  1X3O A;  3GG2 A;  1SQX D;  1EZV D;  3CL3 D;  5C39 A;  3V2Q A;  3RL0 g;  5AVW B;  1H0T A;  4RJT A;  5EJD A;  1K73 Q;  1GL2 D;  4ASV A;  1CI6 B;  1RF0 A;  5KP8 B;  1RO0 A;  3MUD C;  5APV A;  5APU A;  1LT9 C;  2WT7 A;  2JBG A;  2A06 E;  4HKG A;  4IPY A;  2KS1 B;  1K05 A;  4HKZ H;  2FYU D;  2E1M A;  2K9J B;  5CMZ A;  4BRY A;  3CCS P;  2I1J A;  4JPZ B;  3H1J D;  1KB9 D;  2HOD B;  3EQ2 A;  1PGQ A;  4M0I A;  3L37 A;  1FJK A;  2E76 D;  5KLI B;  4BPF A;  1RNI A;  1JTH B;  2OYI A;  1IK9 A;  3GW6 A;  1SLQ A;  1PP9 J;  4U0E A;  2KOD A;  2PGD A;  2RN0 A;  4Z1M H;  2OYH B;  2H88 C;  1UNK A;  3DS1 A;  1SQQ K;  4PD4 I;  7CEI A;  2FXO A;  1NU1 J;  3HZQ A;  2H7H A;  2FAE A;  4U0D A;  2QM7 A;  1SQP G;  1LTJ A;  4H0L C;  1JCC A;  1JOC A;  3B5N A;  2IPP A;  5AVT B;  2ZVN B;  2CGQ A;  2FAC A;  2K92 A;  1JNM A;  3L73 E;  1PEQ A;  2R44 A;  2KOQ A;  2K2Q A;  1NJI Q;  2K9Y A;  3C1L A;  2JYL A;  3CCL P;  2QJK B;  3AE5 C;  3EFG A;  4WYM A;  1HH0 A;  1Y8A A;  5AVZ B;  5BU5 A;  1N7S A;  1U7J A;  4H13 D;  5H2F E;  1T3J A;  3S1K A;  5E79 H;  1GW4 A;  2WSE J;  2PY8 A;  2QJY C;  5HVC A;  1FBM A;  5CCH C;  2N1T A;  2YO3 A;  3OAK A;  1PEM A;  1FZG A;  1SQX G;  3M9H A;  1EZV G;  5HGO A;  4H0L B;  2CG5 B;  1PP9 D;  2LKM A;  2MKV A;  3NFQ A;  5F2O A;  2SPZ A;  2WSE H;  1SQB G;  3A0B H;  3FWL A;  2PEJ A;  1NU1 D;  1EQ7 A;  1H0T B;  2I8D A;  1R5L A;  1ZLL A;  2BCC E;  1OW7 A;  1AA0 A;  4PV1 D;  1JO5 A;  3RK3 E;  2O1K A;  5AW3 B;  1BGY J;  3H1J G;  1DIP A;  3CXC O;  2WT7 B;  1GMJ A;  1KV4 A;  1JCD A;  2YKO A;  1L0L G;  2FYZ A;  4BRY B;  1HGV A;  2IBZ E;  3RBZ A;  4EYY Q;  4I1L A;  4EIJ A;  2L5G B;  4COP A;  1G2C A;  3A3Y B;  5EFW B;  3Q5P A;  5DJT B;  4XFZ A;  2N5I A;  3DTJ A;  5EW5 E;  2OYI B;  2IDB A;  3DPH A;  1DEB A;  2Y0D A;  3O8Z A;  2GZG A;  4PJ0 H;  3HUS C;  2ZYD A;  1KOR A;  2AFE A;  2P9X A;  2MD9 A;  1Q7Y Q;  1KIL D;  1FC2 C;  1P84 H;  1GPJ A;  3AEC C;  2N98 A;  3KXD A;  4WY4 D;  4I2L C;  3KZI E;  3AE1 C;  1KFM A;  1N86 A;  1NYH A;  2YKP A;  1PGO A;  1J1E C;  2M8P A;  3CPW O;  2KWL A;  1YJ9 P;  1NTK K;  1LTJ B;  2MF4 A;  1FE6 A;  3VYI A;  3AED C;  3B5N B;  1Z6M A;  4A7P A;  3VMY A;  3HE4 A;  4N78 D;  1L0N J;  3HD7 C;  1NTZ J;  1Q82 Q;  1BGY D;  3UIA A;  3L75 G;  2KOP A;  3G29 A;  4U0B A;  1YI2 P;  2UWJ E;  1MFT A;  4YXW H;  2O3J A;  3MIW A;  2QM8 A;  1NTK D;  2PEO A;  2JU2 A;  3H4E A;  2JO0 A;  3BVH A;  2GZF A;  3A7O A;  1P84 D;  1A43 A;  1RHZ B;  5HV8 A;  1PPJ D;  1DD3 A;  4AQR D;  2AXT E;  3E1R A;  3MGE A;  5AW5 B;  1MZ8 A;  1GW3 A;  2DGY A;  3QH9 A;  3NMD A;  3AEB C;  4EOT A;  3RL0 D;  1VQ8 P;  1X9V A;  2B89 A;  4XRO A;  1VPC A;  5GTH H;  1S9K D;  2GZI A;  4OGQ C;  1KQL A;  1BE3 G;  3KDP B;  4TT3 H;  2R5B A;  3E2D A;  3TF5 A;  2YXR B;  2VLN A;  3WUT A;  2LIW A;  1YQ3 C;  4YPC A;  5AW6 B;  1DX7 A;  3GZM A;  1SFC C;  2M8L A;  1HTL C;  1GZL A;  1RQU A;  3OA7 A;  1M57 D;  2FY8 A;  2GDY A;  1OWA A;  1HVV A;  1JY2 O;  4GOF A;  2P7J A;  3L70 J;  1URQ A;  1L0N D;  1ZOY C;  3CX5 H;  4ZMD A;  2P67 A;  4WB4 A;  1L4A A;  1RE3 C;  2WPS A;  1Q90 D;  3HTK A;  2Q3I A;  2LXC B;  1YTZ T;  3BRT B;  4QKO A;  3PH0 A;  2A45 H;  1PL5 A;  3LW5 J;  5I4T G;  1G2C B;  2LPK A;  2Q9I A;  3RK2 D;  1BAJ A;  2OQQ A;  3P7K A;  3FXE A;  2BAS A;  3MTU E;  4R4L A;  2VSQ A;  2N6Z A;  3CCQ P;  2W83 C;  1M1J A;  1T2K C;  5KP7 B;  2XXM A;  2LF4 A;  1NVO A;  2M3E A;  3GHG A;  2AVA A;  1IFP A;  3AE7 C;  3LRY A;  1VDF A;  4IFD K;  3LW5 H;  3PLN A;  1FOS E;  3RK3 C;  3SFD C;  4PWV B;  4MN4 C;  3CC4 P;  2FYU E;  4H44 D;  2E75 D;  3CX5 D;  2Z46 A;  3L71 G;  4YXD C;  2D2C D;  1KB9 E;  3M0A A;  2LR2 A;  2K93 A;  2NPS A;  1PV3 A;  1JUN A;  1VQ6 P;  2CPS A;  3PHL A;  3VMZ A;  1VQ5 P;  1OVV A;  3HE4 B;  1Q81 Q;  2FYN B;  2BUO A;  5F2K A;  5CCG D;  5B66 H;  5HGM A;  3L70 D;  4U3F G;  4IOI H;  3CME P;  1SP4 A;  2Y9Z A;  2O01 N;  3L74 G;  5KLV G;  1GD2 E;  3IF4 A;  3B4Q A;  5AW4 B;  3TDK A;  3CMA P;  5AW9 B;  1T3U A;  2QSI A;  4N3Y B;  1SQP J;  2MJZ A;  3I5C A;  4B86 A;  4L76 A;  4LC1 A;  4XRQ A;  1FZC A;  1NTM G;  2KK7 A;  2XZ0 D;  2QIW A;  1NH4 A;  3AE2 C;  2KG9 A;  5KJ7 C;  2IYO A;  1L0N G;  1NTZ G;  4XFX A;  1VF5 B;  2N9B A;  1M56 D;  2JP3 A;  3MP7 B;  2L4B A;  1URQ B;  1M7L A;  2JJL A;  1JTH A;  1Q86 Q;  2C9L Y;  3B71 A;  2CWO A;  3CWB E;  4F37 A;  1SQP K;  3HTK B;  3EJD A;  3TGU J;  2FAD A;  1KLP A;  2WPR A;  1EC5 A;  1PP9 E;  3DS0 A;  2BEQ D;  5CHX A;  1M1K Q;  1KC8 Q;  1H88 A;  2V4H A;  1D1D A;  3MUD A;  2E5Y A;  3PTZ A;  1LT9 A;  3P05 A;  1NU1 E;  4C7R A;  1KYO H;  3V4Q A;  1M1J B;  2KGE A;  3GJN A;  1SQB J;  3GHG B;  2WPQ A;  1SQV J;  1SQP D;  1USE A;  1OFC X;  3R2P A;  4EI2 A;  1HY8 A;  3A5T A;  5CJ4 A;  2Q1K A;  2QG4 A;  5E79 E;  4U0F A;  3CCU P;  1VHN A;  2GZE A;  3JC2 2;  1NAY A;  3IAO A;  2JU1 A;  1OZH A;  2A45 G;  2NPS B;  2ITA A;  2WZ7 A;  1M74 A;  5AW0 B;  1SQX K;  1FZA A;  1VQ9 P;  2KXP B;  1BDC A;  2IFM A;  3DS3 A;  2IBZ I;  4W7Y A;  1AJY A;  2JGP A;  2R32 A;  3A0B E;  1SQB K;  1KYO D;  3B4S A;  1GL2 C;  4R4M A;  2G8Y A;  3SWF A;  1Y9B A;  4IZ6 A;  1YJN P;  1KIL E;  2EIA A;  3TGU D;  2GDX A;  1ZME C;  1WRG A;  4DCK A;  3BAS A;  2FYU K;  2JEE A;  5KKZ B;  1AV1 A;  1PGP A;  1BXI A;  3H1H G;  3PP5 A;  1L0L K;  2CPB A;  4LGD E;  5KAF H;  2PEI A;  3DS4 A;  2MR8 A;  3Q2Y A;  1SQB D;  1W5C E;  1S4X A;  1FZF A;  3SFE C;  1SQV D;  1HGZ A;  3HRN A;  3L36 A;  4N78 E;  1VKU A;  1QLE D;  2CQ8 A;  1BGY E;  2E76 C;  4MRT C;  1FZC B;  2PEQ A;  3WBH A;  3BCC E;  3H47 A;  3L75 J;  5L8R J;  1E79 H;  5CCH A;  2JQ4 A;  1NTK E;  1L0L D;  4CPG A;  1E0H A;  3ZDM A;  1GL2 B;  4PJ0 E;  1NOH A;  2FXM A;  1KMI Z;  4COC A;  1P84 E;  5AVQ B;  1PPJ E;  1NGM B;  3LMO A;  3O6Q A;  1U57 A;  2KUB A;  2WVR A;  1JY3 P;  2PEK A;  1G1I A;  2KOG A;  3H25 A;  3M9B A;  2B88 A;  1T8Z A;  1ZMB A;  5CBN A;  4U0C A;  1S9K E;  1L2P A;  4LLH A;  1LT9 B;  2W27 A;  3B5I A;  3PJS K;  1BE3 J;  2E76 B;  2Z44 A;  1S3J A;  5DCK A;  1RE4 A;  3G21 A;  1JB0 J;  2J5U A;  4JYC A;  3GMA A;  3EJE A;  5APX A;  2NRG A;  2N50 A;  4ASW A;  4H13 C;  2KGD A;  2BHV A;  5TIS H;  2JKV A;  2YKQ A;  3QWO C;  3CCE P;  2GZJ A;  3V6I A;  1LNQ A;  2E5T A;  1RF1 C;  3L75 D;  5JPA A;  3DS5 A;  2XND H;  3VTP C;  3G1G A;  2GA1 A;  3ITK A;  2K94 A;  5KAI E;  3HUS A;  1SVF A;  3M0D C;  1ZV8 A;  1NU1 K;  1YJW P;  4IL6 X;  4GDO A;  1VQ4 P;  1LTI C;  3TGU G;  5BS2 A;  2AXC A;  1T6A A;  1S1C X;  3KYQ A;  3AE9 C;  1JY3 N;  1ACP A;  3BAT A;  3T97 B;  1ZN5 A;  1GDT A;  1QVG O;  3Q20 A;  1PFI A;  4PV1 C;  3GF3 A;  3L72 G;  1EZV I;  2L91 A;  4ZNC A;  2XV6 A;  4H13 B;  3HD7 A;  3P8C D;  5AVV B;  1R8E A;  1SQV G;  2I1K A;  3CX5 E;  2K0D X;  3CC2 P;  1BE3 D;  1BCC G;  2LL8 A;  3H1I J;  3L71 J;  1RF1 B;  4GT1 A;  2KLU A;  1X0T A;  1LJ2 A;  3BRV B;  2R5D A;  4XE5 B;  2L0Q A;  4AYC A;  1RE4 C;  3L70 E;  1IO4 A;  1GU5 A;  1KB9 I;  3HYB A;  2QJY B;  2GUS A;  2LML A;  4U3F J;  2LTE A;  1N2D C;  3N4X A;  2KLV A;  2GDW A;  3RBX A;  1FDO A;  1KIL C;  5HGN A;  1K8A Q;  2KOR A;  3L74 J;  4WY4 C;  5KLV J;  1ZW0 A;  3O6Q B;  4I7Z C;  1E6J P;  2PRR A;  1HWT C;  4JQ0 D;  1KFN A;  4JF7 A;  3VP8 A;  2KGA A;  1LGH B;  1VQK P;  3JSV C;  1EDK A;  3AEF C;  3H1K G;  4UB8 H;  4ZKU A;  3M06 A;  1SFC A;  3B5N D;  1IC2 A;  3VN0 A;  2FBW C;  3C9I A;  2FVE A;  1HUC A;  3CE7 A;  1JEK A;  5B66 E;  1A02 J;  1VQO P;  1NTM J;  2EG5 A;  3K5B A;  3AEA C;  3W67 A;  1RE3 A;  3H32 A;  1M6E X;  1PEU A;  1XTG B;  3H1I D;  3L71 D;  3LIE A;  2FQ0 A;  1NKN A;  5AVR B;  5KLV K;  1N73 C;  4I6M C;  1EDJ A;  1L0H A;  1N7S D;  2WSF J;  4WY4 B;  4IL6 H;  3AEE C;  1NO4 A;  2EFJ A;  1SQQ G;  4UB6 H;  3FXD A;  4Y28 J;  4I7Z B;  4NEO A;  3D6Y A;  2HYN A;  4HJG H;  4U3F D;  3RL0 C;  2HLO A;  1S5L X;  2N1T D;  2M5R A;  3II6 A;  2HR3 A;  3HUS B;  1RH5 B;  3Q5R A;  3L74 D;  2AEF A;  2PEN A;  5KLV D;  2NZ2 A;  2WSF H;  1FDM A;  1J1E B;  5AW2 B;  2KG8 A;  3D6Z A;  1QGK B;  1SQP E;  1NKZ B;  3KHU A;  1LWU C;  1L0N K;  1NTZ K;  2KSE A;  3SWK A;  5DJU B;  2MR7 A;  1FZB A;  1LP1 A;  5APS A;  3A0H H;  3HD7 B;  3G4S P;  1N73 B;  4K35 A;  2W6B A;  3H1L G;  4U7J A;  5H2F H;  2XKM A;  3CXH H;  1NTM D;  2M5A A;  2KGC A;  3E1I A;  4GIF A;  3V2P A;  3Q5S A;  1MV8 A;  5HGL A;  3RK2 C;  1KZU B;  3DS2 A;  2B87 A;  3RL0 B;  2KOS A;  2KW2 A;  1GK4 A;  1HJ0 A;  1NTZ D;  1TU3 F;  4D6T G;  1W2B O;  5GTI H;  2FQ1 A;  4XFJ A;  3TGU E;  2R3S A;  2Y0C A;  1YQ4 C;  2FFD C;  1SQX E;  4M3L A;  1EZV E;  2XV5 A;  4H44 C;  2E75 C;  4TLF A;  4OGQ B;  4GR6 A;  4XFY A;  2D2C C;  2K88 A;  3H1H J;  1SQB E;  4OWF A;  2O01 J;  3CXH D;  1M90 Q;  3CCR P;  5KJ7 A;  2WMM A;  1BSH A;  4PH0 A;  2L6E A;  1SFC B;  5CCG C;  3JCU H;  1IUQ A;  1GK6 A;  2OGU A;  1E5W A;  2L9F A;  1JJ2 O;  3H1J E;  3H1I G;  1LTG C;  1L0L E;  2YNY A;  3H32 B;  1IJD B;  2O01 H;  3V2R A;  3GLM A;  3PRJ A;  1S5L H;  2FHS C;  4BXL A;  4L74 A;  5BVZ A;  2QJP C;  2B9B A;  2XU6 A;  2A06 G;  2E75 B;  3F89 A;  3C8V A;  5KAF E;  2QE7 H;  3NTE A;  2E74 D;  1P84 I;  5CZD B;  2RH0 A;  2Q5U A;  1QL2 A;  5K5G B;  3RK3 B;  1IMQ A;  3TYY A;  4JBZ A;  2K0Y A;  1S72 P;  2PNG A;  3G1I A;  2L22 A;  1Q2N A;  2QVA A;  1NQ4 A;  3H1H D;  1NHL A;  3A2A A;  2W8Z A;  5B5E H;  1IFM A;  1LP1 B;  3D70 A;  2AF8 A;  1VF5 D;  2Z45 A;  1JY2 N;  3L75 E;  2IYP A;  2J58 A;  2Q7C A;  2ZXX A;  4PD4 H;  3GZL A;  1URQ D;  3W68 A;  1GL2 A;  2WSS H;  2M5A B;  4Y99 C;  4R0M A;  1L4A D;  2KZJ A;  2V7Q J;  1OMI A;  2B87 B;  2E43 A;  2M0B A;  2JWD A;  1PZQ A;  3L73 G;  2WQY C;  1WMK A;  2BQ1 E;  2PFX A;  2PEM A;  3AE3 C;  1DV5 A;  2K3R A;  2JR8 A;  2FVA A;  3LID A;  3RGU A;  1M8O B;  4NPE A;  1T8K A;  2V7Q H;  1GTW A;  2WWW A;  5TIS E;  3L72 J;  2Z4E A;  3U43 A;  1EXI A;  1FAV A;  1VQN P;  3KQG A;  4ZKP A;  1BE3 E;  2WPT A;  2KP8 A;  2XZ1 C;  1F80 D;  1BCC J;  4PD4 D;  1A02 F;  3OW2 O;  5AVX B;  2KNC A;  1LTT C;  2N5H A;  4Y99 B;  2NPS D;  3VMA A;  3CX5 I;  1FDI A;  3Q3D A;  1PIX A;  1EXJ A;  2WSC J;  2ZT9 D;  2RKL A;  3IR9 A;  1MZ9 A;  2KI7 B;  4C7N A;  3M9Q A;  2M8R A;  2FXP A;  1LTS C;  1R5S A;  2BCC G;  3P8M C;  3CLQ A;  1BDD A;  1FR2 A;  2WSC H;  1SQV K;  2DNW A;  3T97 A;  1AVY A;  2IBZ G;  3I55 P;  1CEI A;  3WMM 0;  4GOE A;  3E7K A;  1IFI A;  1RQV A;  3H1K J;  2OAR A;  2P58 A;  4HH2 A;  2VLO A;  5AVS B;  3MGN A;  3L72 D;  1USD A;  3AE8 C;  1X22 A;  4RKU J;  2HFE D;  1PEO A;  4BPG A;  1RF1 A;  3IN6 A;  3L71 E;  1BCC D;  1KQS O;  1JY3 O;  2IZ1 A;  1YTZ I;  3M0D A;  2OYH C;  5APQ A;  2JYG A;  3WU2 H;  2PAJ A;  2ROQ A;  1QRJ A;  2XNX A;  2C0X A;  1SQQ J;  4U3F E;  1EDI A;  1Y47 A;  4UB8 E;  2JWA A;  3ABV C;  2EHS A;  3L74 E;  2LOL A;  5KLV E;  2JB0 A;  4U0A A;  1XTC C;  4H2X C;  1ZNV A;  1L0I A;  1AVO A;  3P32 A;  4PH1 A;  4DZO A;  3Q1M A;  4N6J A;  2QJK C;  3CWB J;  3MD0 A;  1G1J A;  3H1K D;  1N8R Q;  1MUU A;  3V4W A;  3L4F A;  4IL6 E;  4EDF A;  4UB6 E;  3G9R A;  1NTM E;  3H1L J;  4H2Y C;  4KT0 J;  2MVV A;  2KNC B;  2YIU C;  1DNY A;  3NY7 B;  1FS0 E;  1KIL A;  1L0N E;  1IFN A;  1NTZ E;  1IK7 A;  1DD4 A;  4GKG A;  2JO1 A;  2E42 A;  4WY4 A;  2QA4 P;  3G6E P;  3VP9 A;  1NAF A;  2P1J A;  1AQT A;  4D6T J;  4L75 A;  2KZI A;  5APW A;  1SQQ D;  4C7N B;  4GR2 A;  2NO8 A;  5GTH E;  4H0L D;  1RF0 C;  1D7M A;  4DT0 A;  1KYO I;  3EJB A;  2H8P D;  2G3A A;  2Z5H A;  4C46 A;  3A0H E;  1GXG A;  5AW7 B;  2OTJ P;  3G26 A;  3M91 A;  2KIK A;  1OIP A;  2K0X A;  1RO2 A;  3CXH E;  3EWK A;  2QRX A;  2VLP A;  2EHT A;  3AE4 C;  1J2J B;  1ZRT D;  2KB7 P; 
#chains in the Genus database with same CATH homology
 3CCM P;  1KD1 Q;  1VQN P;  1M74 A;  2QEX P;  1EOQ A;  3CMA P;  2JYL A;  1VQ9 P;  2P9X A;  1Q7Y Q;  3CCL P;  1K30 A;  3B5I A;  3DS3 A;  4WYM A;  3VRL C;  2Z44 A;  5DCK A;  4U0A A;  3OW2 O;  3G21 A;  5HGN A;  1M6N A;  3G0V A;  1K8A Q;  3CCJ P;  3G4S P;  1K73 Q;  3NTE A;  3G71 P;  1VQM P;  5F2N A;  3RG6 C;  2M8P A;  4XRQ A;  3CPW O;  1YJ9 P;  1K9M Q;  5I4T G;  1E6J P;  2BHV A;  1VQP P;  1RO0 A;  1BAJ A;  2PY8 A;  3G28 A;  4PH1 A;  1YJN P;  4QNB A;  3CCV P;  2EIA A;  5HGL A;  1S72 P;  4IPY A;  1VQK P;  3DS2 A;  3CCQ P;  3CCE P;  1PEM A;  3G1I A;  2E1M A;  2XT1 A;  4XFX A;  1Q82 Q;  2XXM A;  3CCS P;  1A8O A;  5HGO A;  2LF4 A;  1N8R Q;  3G29 A;  3LRY A;  1W2B O;  4U0B A;  1YI2 P;  5JPA A;  3DS5 A;  3G1G A;  5F2O A;  2OTL P;  2PEI A;  3DS4 A;  1YIT P;  2PEO A;  1Q86 Q;  2PEJ A;  1YJW P;  2CWO A;  4M0I A;  3H0D A;  1VQO P;  3M1M A;  2EG5 A;  3H4E A;  1VQ4 P;  1VQ7 P;  2Z45 A;  3CC4 P;  2JO0 A;  1M6E X;  5BS2 A;  3I55 P;  1PEU A;  2Z46 A;  1A43 A;  3DS0 A;  1RNI A;  2OAR A;  2PEQ A;  3WBH A;  2QA4 P;  3G6E P;  1M1K Q;  4GR6 A;  1KC8 Q;  3H47 A;  3CC7 P;  2M8N A;  4XFY A;  1VQ6 P;  4U0E A;  1EIA A;  2KOD A;  3CXC O;  1QVG O;  1D1D A;  3MGE A;  3Q20 A;  1VQ5 P;  5BS1 A;  3DS1 A;  2DGY A;  2ONT A;  3P05 A;  1Q81 Q;  1PEO A;  2EFJ A;  2BUO A;  2XV6 A;  1M90 Q;  5F2K A;  3CCR P;  1YHQ P;  4GR2 A;  1VQL P;  1VQ8 P;  4PH0 A;  2L6E A;  5HGM A;  4XRO A;  4COC A;  3CD6 P;  3HZQ A;  1IUQ A;  3CC2 P;  4U0D A;  3I56 P;  1QVF O;  2BQ1 E;  2PEM A;  1JJ2 O;  4COP A;  1KQS O;  3CME P;  2OTJ P;  1AUM A;  3E2D A;  3G26 A;  2JYG A;  2PEK A;  2PEN A;  1RO2 A;  4XFZ A;  4U0F A;  3CCU P;  1QRJ A;  1YIJ P;  1PEQ A;  1ZMB A;  3DTJ A;  2M8L A;  3DPH A;  4U0C A;  1NJI Q;  3HYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...