1VQNP

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqnP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqnP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqnP02
1QVGO 3CCQP 1JJ2O 1YJWP 1Q81Q 1YIJP 1VQ4P 1VQKP 3CCLP 1VQOP 1YJ9P 1K9MQ 1VQ9P 3G6EP 1YHQP 1KD1Q 1VQ8P 1VQLP 3CCVP 3CC2P 3CMAP 1Q82Q 1VQNP 3CC4P 2QA4P 3CMEP 1K8AQ 3CCUP 1YJNP 1NJIQ 1Q86Q 1VQ5P 1M1KQ 1YITP 3OW2O 3CCMP 3G71P 3G4SP 1QVFO 1VQMP 1K73Q 1KC8Q 1VQ7P 1Q7YQ 1VQ6P 3CCEP 1VQPP 3I55P 1W2BO 3CC7P 3CD6P 1S72P 3CPWO 3CCRP 3CCSP 3CXCO 3I56P 2OTJP 1KQSO 2OTLP 1YI2P 1N8RQ 1M90Q 2QEXP 3CCJP
chains in the Genus database with same CATH superfamily
3NXSA 2BCCE 1FDIA 2N50A 1FOSF 3HD7D 2Q3EA 3DS1A 5BS1A 2RH0A 3NFQA 3B5IA 3D71A 1LTGC 1EMVA 2KNCB 2PAJA 3O6QA 3A0HE 2LKIA 2RKLA 1IMQA 2KLUA 4JF7A 1D1DA 3P32A 3BRTB 3C1LA 1QVGO 5KP8B 1AF8A 1OVUA 2JYGA 2E75B 4HH2A 3V5BA 4XFJA 1IFDA 2K0XA 2WPQA 3DS3A 3CMEP 5TJHA 2WITA 1QVFO 2Q5UA 2K3RA 2KYVA 2IBZD 2FVFA 2WSFJ 1FU1A 2XU6A 2QM7A 2GDXA 2ROQA 3QWOC 1M7LA 2FYUE 1VQKP 2KS1A 3A0BH 3AE9C 4N78E 2QM8A 3JC22 3RK3B 1JUNA 1LTJA 4GKGA 1E79H 4XFYA 2Q1KA 4WY4B 1VQ7P 4L76A 3O8ZA 1KQGB 1URQA 1J2JB 1FZAA 1OW8A 5KLVG 3TGUJ 2KOOA 1IFMA 4H2XC 1RF1B 4D6TJ 4Y99B 4PH1A 3G3ZA 4ASVA 4ASWA 3B71A 3P8MC 1SFCA 1FBMA 2VLPA 3JSVC 2Q6QA 2FHSC 3AE7C 3G71P 3GHGA 2Q7CA 3HE5B 1KC8Q 2QG4A 3HTKA 1Q7YQ 5CJ4A 1H0TB 3A7OA 4U7JA 1JO5A 1G2CA 1KILE 1SQVK 2KGEA 1WMKA 2M8PA 1PP9D 5GTIH 2HLOA 4H0LD 3L73G 2M8RA 2FQ1A 5AW5B 1FZGA 2V7QH 4H2WC 3VMAA 2OYHA 1ZNVA 1ZRTE 3DS4A 4GT1A 4OVNF 4C46A 5BU8B 2NZ2A 1GXHA 4DT0A 5KLVK 3LIEA 3BCCD 4U0DA 1N8RQ 1RF0A 3WU2E 3QH9A 3L35A 1ZMEC 1NTMD 3H0DA 3VOPA 5B66H 4W7YA 1Q82Q 2JKVA 2O3JA 3N7NA 1KQFB 4HB1A 3H1HD 1Q86Q 3CWBE 1YITP 3LW5J 1T6AA 1VF5B 2LR2A 3L70G 4L75A 2EHTA 1BXIA 3EFFK 2QJYB 2MVUA 1NTKK 2M3EA 2NPSA 1SQQG 2YKOA 3CCLP 1NO4A 1KN7A 2N6YA 2LXBA 5EW5E 1KILC 1U7JA 4LLHA 2IBZI 1HTLC 1T3UA 4ZKPA 3PJSK 4KT0J 1CSBA 4AUWA 1FDMA 2PEQA 2QJPB 3H25A 3N4XA 2KGCA 1JTHB 4BPGA 4N3YB 2YMYA 5EFWB 1NGMB 1ZMBA 2WT7B 1EDLA 1PGOA 3H4EA 1SQXG 2IX7C 1OWAA 4I1LA 2D2CC 1L0IA 1VHNA 2KR5A 2E76C 1PP9J 1N73B 3CXCO 4Y28J 2QSIA 2KW2A 3L75E 3H1JD 2PENA 1K9MQ 3Q5SA 4H13D 1SQQK 4XFXA 3MUDC 2B9BA 3VP9A 3LMOA 1NTMJ 2XXMA 1OW6A 3B5ND 5TISE 1HF9A 2JO1A 2M5AA 2AEMA 4IFMA 1GL2B 5GTIE 3EJDA 1L4AD 2KSEA 2GZJA 1ZW0A 1VQ4P 1GD2E 1L0LD 2PNGA 1YJNP 3L73E 1NOHA 1SQXK 3G29A 1LT9C 3PP5A 1NU1D 1M8OB 2RMZA 3HUSB 1E0HA 3MGEA 2KOQA 3KQGA 4JPZB 1RF1A 2JU1A 1DIPA 5AVQB 1LGHB 1H89A 3P7KA 2Y0EA 1MFTA 5E79E 4ZKUA 1X0TA 3CMAP 2R32A 5HV8A 3T97B 3PLNA 2I1JA 3GMAA 2YIUB 3CCEP 1VL2A 2JU2A 1NTZK 2UWJE 3SFEC 2LMLA 4XFZA 3PRJA 2P67A 1MZ8A 3L70E 1R8EA 5AW6B 3M0AA 1R5SA 2QA4P 2K9YA 2Z5HA 1GK4A 3HD7A 1PGPA 4U0FA 3DS0A 1KYOH 2KODA 5KAIH 3H1JJ 2WSSH 3CC7P 1N7SB 2N1TC 1AQ5A 1BE3E 4COCA 1X3OA 1FZCB 3CCJP 3VYIA 1VQOP 2J58A 3FX0A 2K1AA 4WBAA 2OGUA 2IDBA 2WSFH 1BSHA 4RKUJ 2L0QA 1USDA 3A5TA 2GYKA 3H32B 1L0LJ 5APXA 4WVZA 3Q5RA 1G1IA 1YHQP 4HKZH 3H1LG 2ZFCA 1DV5A 2LL8A 1NU1J 1CI6B 2FXMA 3S1KA 5H2FE 3I55P 4C7NB 4MN4C 2FFDC 3NMDA 1HUCA 3B4QA 3L74E 1PPJE 4IZ6A 1AVOA 3DPHA 1KB9H 4PWVB 1Y8AA 4DZOA 2ZT9C 3CX5E 1SQPE 1U7MA 1SQBG 2QJKB 1QL2A 2GZFA 4PV1B 2XV6A 2AXCA 2KORA 4JYBA 3IN6A 2FAEA 3WUTA 2Z45A 1H8AA 1S3JA 2YNYA 3SWYA 2CG5B 5AVTB 2E74D 5CCHD 2WVRA 5BS2A 4IL6E 3VMZA 2KS1B 4EIJA 3P8CE 2L6EA 4GR6A 2MD9A 5B5EE 1MFZA 1QL1A 1LTJB 3RL0B 2IBZG 3L71E 3HRNA 2XNXA 1RF0C 1NJIQ 3EJBA 1URQB 1BGYD 1KTMA 4OGQC 2QVAA 3SWFA 1IK7A 4RESB 1A02F 1QGKB 1S2EA 1SQBK 2L4BA 1SFCB 3A0HH 3M0DA 5CCGC 3RK2B 2Z46A 1M1JA 4YPCA 3GHGB 1BE3J 2L22A 1W5CE 3HTKB 2P1JA 4U3FE 2WSCJ 1Z56A 3G9RA 1KQLA 2XZ1C 1RE3C 1OXZA 2N5HA 1ZLLA 2KOSA 2ZXXA 2YKQA 1JJ2O 3R2PA 4CPGA 1KYOD 2ZVNB 2W83C 1LTAC 4TLFA 4HYTB 2OYHB 2JWDA 1KLPA 3RK3E 3NTNA 3G1IA 2POHA 4EDFA 1FJPA 2CPSA 5AW8B 3KZIE 2HG5D 1EXIA 5C39A 4U3FD 1EIAA 2EHSA 3IAOA 3BCCG 2VLNA 1FDOA 3L74J 1W2BO 1S72P 1HJ0A 1PGQA 1QLED 2A06D 3B5NA 2NPSB 3TSIA 2QEXP 3H1HG 1FOSE 1MKMA 4H44B 1L4AA 1DEBA 2H7HA 1SQBE 3H1KD 1BGYJ 1LTBC 2MR8A 2B89A 2LKMA 3GZMA 2LTEA 3CE7A 2KK7A 1KB9D 2FXOA 2KUBA 3RK3C 2OYIA 4U0CA 4WY4C 3GLMA 3WU2H 1S5LX 2KB7P 1RF1C 4Y99C 4EYYQ 2G3AA 3MGNA 1ACPA 3CPWO 1IFJA 1NTMK 2FADA 3L71J 1ZR4A 4UHPB 2GM4A 3M9HA 3EJEA 3M9BA 1D7MA 3H1JG 1A43A 2CWOA 1JY3P 4RJTA 4RO0A 2EIAA 2M5AB 5APQA 1SQVG 2O1KA 3AECC 2BCCD 1N2DC 2XDJA 1KYOI 2I8DA 4U3FJ 1L0NE 1JMBA 1AV1A 3L72G 3VMXA 2XZ0D 2WWWA 1SS1A 1BCCE 3U1CA 2MVVA 1EQ7A 2WPRA 4AQRD 2JGPA 3L4FA 4TT3H 1S9KE 3D6YA 2Q3IA 1GZLA 2CQ8A 2OTJP 2A45H 3H1KJ 1NAFA 2K9JA 2ZYDA 3NTEA 4OH8B 2I1KA 3GW6A 3VRLC 1VF5C 1AYIA 3RBZA 3TNUA 2YO2A 2KXPB 1J1DB 2PEMA 1FZBA 1LTIC 2QJYC 4I2LC 4WB4A 1JY3N 3G28A 3H1IG 5F2KA 1NH4A 1L0ND 1YTZI 1QX8A 1IZNB 1NTKG 2FYUD 4PXHB 3CLQA 5TISH 2FXPA 4N78D 1PFIA 4GOFA 4PD4E 3HD7B 4IOIH 2JYLA 2O01H 1NWQA 2P9XA 1KB9I 2QJPC 2V4HA 1JY2O 2JDIH 1OVRA 3FXEA 1L0LK 1K30A 4WYMA 5AVZB 1BAJA 2KZJA 1AA0A 1RH5B 1USEA 3U1AA 2Y9ZA 1EZVE 3SSUA 5E79H 1N73C 2BCCJ 5AVUB 2AF8A 2H89C 3IFMA 1KILD 3CI9A 1KFMA 4ZNCA 2VLOA 1VQLP 2BASA 3OJAB 3A2AA 1ZRTD 4JBZA 1FJKA 7CEIA 2KSJA 1GL2C 2LIWA 3D6ZA 3VMYA 2W6AA 3GJNA 3BRVB 1HQBA 1GU5A 1UIIA 3AEFC 2ZYGA 1RQUA 1EZVD 2E76D 2PFXA 1ZV8A 2WPSA 1SQVE 2WSCH 3CWBD 2MKVA 4M0IA 3M0DC 1FE6A 1ZOYC 1L0NJ 3L72E 3HUSC 2FYUJ 2WQYC 2O1JA 2GUSA 1YTZT 5F2OA 1BCCJ 2Y0CA 3TF5A 1HVVA 4H0LB 3LIDA 3KPEA 5KLVE 2HPCA 2YIUC 4UB6E 2JWAA 2W8ZA 1HY8A 1VKUA 5AW9B 1NTZG 4B86A 3RG2A 2CPBA 5AVVB 5H2FH 4K3AA 4U0AA 4WWIA 3L37A 3H1IE 1FR2A 3CCVP 2AFDA 1NTKE 1N7SC 3G0VA 2IZ0A 1RO0A 2JB0A 5DJTB 1FZCC 2Q9IA 1OX3A 3CX5H 1MZ9A 1LWUB 1XTCC 5BVZA 3L75D 1LNQA 5KP6B 1M56D 4KHXA 1M1JB 2E5TA 2GZGA 1LP1A 5KLVD 1A8OA 3D70A 1G1JA 2KOGA 1OMIA 1RE4A 4OWFA 2L9FA 3PTZA 1NKZB 3FXDA 2LIUA 5DJUB 1IK9A 4I7ZB 2IZ1A 3CL3D 2MF4A 1AUMA 2Z4EA 5HGMA 1P84E 1PL5A 3AE4C 2K88A 1DD4A 2G8YA 3CWBJ 4IL6H 2P58A 1EXJA 2JAZA 1IFPA 2N1TD 5B5EH 2PEJA 3II6A 2OQQA 3AE1C 2C9NY 1ZN5A 3L73D 4O9BA 1SQQE 5EJDA 3G26A 4AYCA 3M06A 1Y9BA 2H43A 3CXHE 1EZVI 2BHVA 3V4WA 4H13B 1UIXA 4HKGA 3W67A 1K05A 2QJKC 2WPVB 3GG2A 4U0BA 4LC1A 5AVSB 3ABVC 4PV1C 3HZQA 2J59M 3B5NB 1L4AB 2KIKA 1E5WA 2R3CA 1SQXE 3L70D 3AEGC 2OYOA 2E43A 2FKWB 1NHLA 3Q2YA 5L8RJ 1KFNA 3L75J 1HBWA 3TGUG 3C9IA 1BE3D 4D6TG 5KLVJ 1LTJC 3RL0C 2OYIB 5APUA 2P10A 3VP8A 3Q3DA 1J1EB 1NTZE 1URQC 3E2DA 2FQ2A 3KZIH 1EDIA 2JEEA 3F5HA 4EOTA 2A45I 3AE6C 2SPZA 1M6EX 2DW3A 1SFCC 4KJMA 3RK2C 2O01J 3AE5C 3E7KA 2ZYAA 1IUQA 3GHGC 1OFCX 2W27A 2PRRA 5KJ7D 3L73J 3MTUE 1RY3A 1JNMA 1JCCA 3JCUE 3E1IA 1KORA 1NYHA 5AVRB 1M6NA 3L74D 1PPJD 2OYHC 4OGQD 3CCQP 2N6ZA 2KG8A 3CC4P 3CX5D 2L91A 2ZJSE 1M1KQ 1SQPD 5CCGD 4JYCA 2IPPA 4CA3A 1SVFA 1T2KC 1EOQA 5KAFE 2K9JB 2WSEJ 3L70J 3V2PA 1KILA 3DTJA 2VRSA 4EI2A 3MZWB 3U59A 3IF4A 2KWLA 1LWUA 1Q81Q 4ZMDA 1PZQA 1SQQJ 3TNUB 1AFOA 1YQ4C 4MRTC 1K8AQ 1VQ5P 3DS5A 2NPSC 4H44C 2B87A 1OR5A 2GUVA 3P8CD 4XA4A 4QNBA 3KXDA 2R44A 4GODA 2IYPA 3L71D 2R5DA 3WUUA 4R0MA 2YXRB 3EQ2A 1S5LE 2BEZF 4QKOA 1PEOA 2VSQA 1WRGA 4N6JA 1SQXJ 3CD6P 1PP9G 1JB0J 4M3LA 2FY8A 3I56P 3G21A 3MUDA 3H1LE 1JCDA 2K94A 3TGUE 1S1CX 2JQ4A 2E75D 4D6TE 3Q5PA 1GU4A 1X79B 5K5GB 2E74B 4XRQA 4NPEA 5KLIB 2CK3H 2IFNA 1NTMG 4C7RA 1SP4A 3M1MA 1M90Q 3F89A 1PEUA 3L36A 1SQPJ 2LPKA 2KLVA 1LT9A 4NPFX 5AW7B 3LRYA 3RK3D 1RO2A 4PD4H 3AEDC 4WY4D 3S4RA 3B4SA 3I5CA 3H1LD 2FYNB 5JPAA 1GW4A 2CNRA 1QEXA 2MR7A 2KZIA 2XZRA 3K5BA 3CX5I 1N7LA 4YXWH 1LTSC 5KKZB 2C0WA 4BRYB 2N98A 3BASA 1ZXGA 2QNWA 1K04A 2VLQA 4Z1MH 4IFFA 3OA7A 2NO8A 1M74A 3C8VA 1BDDA 2IBZE 2H88C 3SFDC 1SQBD 2HPCB 1RNIA 1J1DC 1ZR2A 2EFJA 2Z44A 1FC2C 5GTHE 1IFNA 2N1TA 1IJDB 2Z5IA 4L74A 3RBXA 2QIWA 3MP7B 2GZEA 2L5GB 3HD7C 2FVEA 4IFDK 2XT1A 1WT6A 3V2QA 2WZ7A 2BEQD 3NY7B 2CGQA 2Y0DA 1KD1Q 1OIPA 4NEOA 2YKPA 4NPDA 2JP3A 1VQMP 1GTWA 2E5YA 2E1MA 4HJGH 2ZAEB 4GOEA 1VF5D 2HODA 3V2RA 3U43A 1M57D 1L0LG 1LP1B 1MUUA 4F37A 3HE4A 3BATA 4DJGA 1T8KA 2A45G 3G6EP 1PP9E 2JJLA 2O01N 3WMM0 1EDKA 2FFDA 2ITAA 4PH0A 3L75G 3H1LJ 1GDTA 1NU1G 4UB6H 4BWNA 3UIAA 5CBOA 1JMMA 3TK1A 1T3JA 2YMKA 5AW1B 1YI2P 3BCCE 2K2QA 4GR2A 3SWKA 1T8ZA 1BCCD 1NTME 3CC2P 3OAKA 1BDCA 3KDPB 1AJYA 1XTGB 3H1HE 1IFIA 3MD0A 1S9KD 4L73A 5I4TG 5APSA 1IO4A 3KYQA 1SQBJ 1X9VA 2AVAA 4PJ0E 1YJ9P 3B8EB 3GKLC 2XV5A 4YTPC 5KJ7A 2AXTE 3G4SP 2P2UA 1NU1K 2KP8A 2K0YA 4H0LC 2XKMA 1HWTC 5CCHA 1YBKA 3PHLA 2N9YB 1GL2D 1P84H 4PD4D 2OTKE 5CHXA 1CEIA 2WMMA 2KG9A 2YXQB 1DNYA 3RL0g 1AQTA 1DH3A 1DX7A 2M8NA 2WSEH 1OVVA 4K35A 5CCGA 1PEQA 1GMJA 1Z6MA 3W68A 1L2PA 5CJ0A 2M8LA 2FACA 3H1JE 3PH0A 3CXHH 2D2CD 1GXGA 1BE3G 3VTPC 4A7PA 2PY8A 1GW3A 1RE3A 4LGDE 1LWUC 4BRYA 2X2BA 1K73Q 1M1JC 1NVOA 5APVA 5CBNA 5AW0B 2OTLP 2AEJA 1NAYA 3A0BE 2W6BA 3AEEC 2QRXA 4I7ZC 1VQ8P 1L0LE 1HJBA 3S9OA 5F2NA 5HGNA 1KZUB 5AW3B 2QE7H 1X22A 2PEIA 3AE8C 2KNCA 2ZXEB 1N7SD 3FWNA 4H2YC 1NU1E 2R5BA 3GZLA 1JEKA 1FZFA 2KG6A 2K92A 1S4XA 1SQVD 1PEMA 3L72D 2C9LY 4XROA 3L74G 3BCCJ 1PPJG 1FAVA 1CZQA 2GZIA 1KILB 4H13C 3CCRP 3TYYA 2DNWA 2BQ1E 5KP7B 1DEEG 3V6IA 1KV4A 1SQPG 3H1HJ 1IMPA 1BGYG 3WUVA 3B5NC 2P7JA 3KHUA 1L4AC 2B87B 3M91A 3M9QA 2R3SA 3AEAC 4WY4A 3JCUH 1QRJA 2W90A 4PD4I 5B66E 3TDKA 4DCKA 5CMZA 2D2CB 3H1ID 1VDFA 3HYBA 2E76B 1NTKD 5KTBA 2GA1A 1EC5A 2K37A 1RQVA 1EDJA 4BPFA 5M1BA 2OYIC 3HE5A 2ERHA 1J1EC 1U57A 1H0TA 5HGOA 3BVHA 3L71G 4XE5B 2FBWC 2MJZA 2M5RA 3AEBC 3H6PA 1PIXA 5KAFH 3FWLA 2KI7B 4GDOA 3H47A 2H8PD 4PV1D 1LTTC 1HGVA 5APTA 1SQPK 4UB8H 2FVAA 3V2NA 3RG6C 3OW2O 3Q1MA 1P84D 1DD3A 5APYA 4I6MC 4DOJA 2M3BA 4U3FG 1SQVJ 1JY2P 1SLQA 1YQ3C 4R4MA 2KOPA 2HR3A 1LT9B 3L72J 4JQ0D 3RL0D 2M0BA 2MY5A 5AVXB 2HYNA 2A06G 1SQQD 3VN0A 2XNDH 4U0EA 2IYOA 1URQD 1S5LH 4W80A 1VQPP 2K93A 3Q20A 4COPA 3CXHD 3H1KG 2ZT9D 1X8YA 2JR8A 2K5XA 1FZEA 1SFCD 3GF3A 2J5UA 3RK2D 1LJ2A 1VQ6P 3MHVA 2RN0A 3H1IJ 1PV3A 1JY2N 3EFGA 1NTKJ 1SQXD 2N5IA 1YJWP 2Y9YA 1L0HA 4QMAA 2N1TB 1JTHA 2LOLA 3G1GA 2PGDA 3FGAD 3O6QB 3USSA 2FYZA 1VPCA 5HGLA 1JY3O 2WT7A 4GIFA 1BGYE 3WBHA 2V7QJ 2N9BA 4YXDC 1RHZB 1PGJA 1NTZD 2K0DX 1N73A 3MIWA 1T2KD 1ZP0C 1F80D 2DGYA 3GF7A 5APWA 3E1RA 4R4LA 5AVYB 2BCCG 2HODB 2EG5A 1MV8A 1OW7A 5KJ7C 1HH0A 2B88A 1HGZA 3A3YB 3HE4B 2LF4A 2NPSD 2YO3A 1KMIZ 3RGUA 4UB8E 5HVCA 2GDWA 2WTYA 1NQ4A 1GL2A 1JM0A 4H44D 3LW5H 3EWKA 2FFDB 1VQ9P 2PP6A 2E74C 5CCHC 5KLIC 1KYOE 5KAIE 1IC2A 1P84I 5GTHH 2BUOA 2GDYA 2C0XA 3ZDMA 4BXLA 2ZT9B 2NRGA 1UJZA 1CW5A 4DG9A 2AFEA 2KGDA 3HUSA 5BU5A 1LT1A 1VQNP 3R4YA 2FYNC 2PEKA 1L0NG 2FYUG 3CXHI 1G2CB 3T97A 3V4QA 1BCCG 2LXCB 5KKZC 1KQSO 2HFED 2A06E 1OZHA 5AW2B 3P05A 1R5LA 1YIJP 1Y47A 1BSNA 1YYCA 2JO0A 2AEFA 1FS0E 1Q90D 3H1KE 1N86A 1UNKA 2W6JH 2ONTA 1W2EA 5AVWB 4BPHA 5AW4B 2ZVOB 1NTZJ 4IL6X 2PEOA 3CCSP 2E42A 3AE2C 1N7SA 4OGQB 1NKNA 4W7ZA 5DCKA 1KB9E 1FZCA 1TU3F 2OARA 1JOCA 1GPJA 3AE3C 1AVYA 3CCMP 2JBGA 3ITKA 1L0NK 3IR9A 2E75C 2FYUK 2IFMA 3TGUD 3H32A 4D6TD 1A02J 4PJ0H 1H88A 1GK6A 2KGAA 2FQ0A 4IPYA 3CCUP 3DS2A 1E6JP 2AXTH 2WPTA 1CI6A 1Q2NA 1RE4C 1EZVG 5CZDB 4C7NA 3CWBG
chains in the Genus database with same CATH topology
2PENA 1VQOP 1K9MQ 1KD1Q 3VRLC 4XFXA 2PEJA 1VQNP 3DS1A 5BS1A 4GR6A 2PEKA 1NJIQ 4M0IA 3B5IA 2M8NA 1VQMP 2PEMA 3DS4A 2E1MA 1VQ6P 4XRQA 3G26A 1PEQA 3G28A 5F2KA 1QRJA 5F2OA 2XXMA 1KQSO 3M1MA 4U0DA 1M90Q 1M6NA 2M8LA 1D1DA 1N8RQ 1QVGO 3CCQP 2BHVA 3P05A 1YJWP 1PEUA 2Z46A 2JYGA 4U0CA 3HYBA 3H0DA 1YIJP 1VQ4P 3G6EP 1YHQP 2JO0A 2PY8A 1Q82Q 3CC4P 3DS3A 3G1GA 3CMEP 3LRYA 2JYLA 1YJNP 1RO2A 4PH0A 2ONTA 1Q86Q 1YITP 1M1KQ 1QVFO 4U0BA 5HGLA 1K73Q 2P9XA 1EOQA 3HZQA 3G29A 3I55P 2PEOA 3WBHA 5HGOA 5JPAA 3CPWO 3CCSP 3DTJA 2OTLP 1YI2P 1K30A 4WYMA 3MGEA 4U0AA 5DCKA 1JJ2O 4GR2A 1Q81Q 1BAJA 3H47A 1VQKP 3CCLP 2OARA 1VQ8P 2DGYA 3CCVP 3CC2P 3DPHA 3CMAP 1K8AQ 2L6EA 3G0VA 5F2NA 3RG6C 4XFYA 5HGNA 1VQ5P 1RO0A 3CCMP 3OW2O 3DS5A 2EG5A 1VQ7P 5I4TG 1A43A 3CCEP 2PEIA 2CWOA 1M74A 2EIAA 3G1IA 2LF4A 4QNBA 4PH1A 4XFZA 2PEQA 1A8OA 2XV6A 1RNIA 3E2DA 1YJ9P 2EFJA 1VQ9P 1VQLP 2Z44A 1PEMA 2Z45A 1EIAA 2QA4P 4IPYA 3CCUP 3DS2A 1ZMBA 4U0FA 4XROA 3G71P 3G4SP 2BUOA 3DS0A 1PEOA 2KODA 3H4EA 4U0EA 1M6EX 1E6JP 1KC8Q 1Q7YQ 1VQPP 1W2BO 3CC7P 3CD6P 3Q20A 1S72P 3CCRP 1AUMA 4COPA 5HGMA 5BS2A 3CXCO 3I56P 3G21A 4COCA 2OTJP 2BQ1E 1IUQA 2QEXP 3CCJP 2M8PA 2XT1A 3NTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG O;  3CCQ P;  1JJ2 O;  1YJW P;  1Q81 Q;  1YIJ P;  1VQ4 P;  1VQK P;  3CCL P;  1VQO P;  1YJ9 P;  1K9M Q;  1VQ9 P;  3G6E P;  1YHQ P;  1KD1 Q;  1VQ8 P;  1VQL P;  3CCV P;  3CC2 P;  3CMA P;  1Q82 Q;  1VQN P;  3CC4 P;  2QA4 P;  3CME P;  1K8A Q;  3CCU P;  1YJN P;  1NJI Q;  1Q86 Q;  1VQ5 P;  1M1K Q;  1YIT P;  3OW2 O;  3CCM P;  3G71 P;  3G4S P;  1QVF O;  1VQM P;  1K73 Q;  1KC8 Q;  1VQ7 P;  1Q7Y Q;  1VQ6 P;  3CCE P;  1VQP P;  3I55 P;  1W2B O;  3CC7 P;  3CD6 P;  1S72 P;  3CPW O;  3CCR P;  3CCS P;  3CXC O;  3I56 P;  2OTJ P;  1KQS O;  2OTL P;  1YI2 P;  1N8R Q;  1M90 Q;  2QEX P;  3CCJ P; 
#chains in the Genus database with same CATH topology
 3NXS A;  2BCC E;  1FDI A;  2N50 A;  1FOS F;  3HD7 D;  2Q3E A;  3DS1 A;  5BS1 A;  2RH0 A;  3NFQ A;  3B5I A;  3D71 A;  1LTG C;  1EMV A;  2KNC B;  2PAJ A;  3O6Q A;  3A0H E;  2LKI A;  2RKL A;  1IMQ A;  2KLU A;  4JF7 A;  1D1D A;  3P32 A;  3BRT B;  3C1L A;  1QVG O;  5KP8 B;  1AF8 A;  1OVU A;  2JYG A;  2E75 B;  4HH2 A;  3V5B A;  4XFJ A;  1IFD A;  2K0X A;  2WPQ A;  3DS3 A;  3CME P;  5TJH A;  2WIT A;  1QVF O;  2Q5U A;  2K3R A;  2KYV A;  2IBZ D;  2FVF A;  2WSF J;  1FU1 A;  2XU6 A;  2QM7 A;  2GDX A;  2ROQ A;  3QWO C;  1M7L A;  2FYU E;  1VQK P;  2KS1 A;  3A0B H;  3AE9 C;  4N78 E;  2QM8 A;  3JC2 2;  3RK3 B;  1JUN A;  1LTJ A;  4GKG A;  1E79 H;  4XFY A;  2Q1K A;  4WY4 B;  1VQ7 P;  4L76 A;  3O8Z A;  1KQG B;  1URQ A;  1J2J B;  1FZA A;  1OW8 A;  5KLV G;  3TGU J;  2KOO A;  1IFM A;  4H2X C;  1RF1 B;  4D6T J;  4Y99 B;  4PH1 A;  3G3Z A;  4ASV A;  4ASW A;  3B71 A;  3P8M C;  1SFC A;  1FBM A;  2VLP A;  3JSV C;  2Q6Q A;  2FHS C;  3AE7 C;  3G71 P;  3GHG A;  2Q7C A;  3HE5 B;  1KC8 Q;  2QG4 A;  3HTK A;  1Q7Y Q;  5CJ4 A;  1H0T B;  3A7O A;  4U7J A;  1JO5 A;  1G2C A;  1KIL E;  1SQV K;  2KGE A;  1WMK A;  2M8P A;  1PP9 D;  5GTI H;  2HLO A;  4H0L D;  3L73 G;  2M8R A;  2FQ1 A;  5AW5 B;  1FZG A;  2V7Q H;  4H2W C;  3VMA A;  2OYH A;  1ZNV A;  1ZRT E;  3DS4 A;  4GT1 A;  4OVN F;  4C46 A;  5BU8 B;  2NZ2 A;  1GXH A;  4DT0 A;  5KLV K;  3LIE A;  3BCC D;  4U0D A;  1N8R Q;  1RF0 A;  3WU2 E;  3QH9 A;  3L35 A;  1ZME C;  1NTM D;  3H0D A;  3VOP A;  5B66 H;  4W7Y A;  1Q82 Q;  2JKV A;  2O3J A;  3N7N A;  1KQF B;  4HB1 A;  3H1H D;  1Q86 Q;  3CWB E;  1YIT P;  3LW5 J;  1T6A A;  1VF5 B;  2LR2 A;  3L70 G;  4L75 A;  2EHT A;  1BXI A;  3EFF K;  2QJY B;  2MVU A;  1NTK K;  2M3E A;  2NPS A;  1SQQ G;  2YKO A;  3CCL P;  1NO4 A;  1KN7 A;  2N6Y A;  2LXB A;  5EW5 E;  1KIL C;  1U7J A;  4LLH A;  2IBZ I;  1HTL C;  1T3U A;  4ZKP A;  3PJS K;  4KT0 J;  1CSB A;  4AUW A;  1FDM A;  2PEQ A;  2QJP B;  3H25 A;  3N4X A;  2KGC A;  1JTH B;  4BPG A;  4N3Y B;  2YMY A;  5EFW B;  1NGM B;  1ZMB A;  2WT7 B;  1EDL A;  1PGO A;  3H4E A;  1SQX G;  2IX7 C;  1OWA A;  4I1L A;  2D2C C;  1L0I A;  1VHN A;  2KR5 A;  2E76 C;  1PP9 J;  1N73 B;  3CXC O;  4Y28 J;  2QSI A;  2KW2 A;  3L75 E;  3H1J D;  2PEN A;  1K9M Q;  3Q5S A;  4H13 D;  1SQQ K;  4XFX A;  3MUD C;  2B9B A;  3VP9 A;  3LMO A;  1NTM J;  2XXM A;  1OW6 A;  3B5N D;  5TIS E;  1HF9 A;  2JO1 A;  2M5A A;  2AEM A;  4IFM A;  1GL2 B;  5GTI E;  3EJD A;  1L4A D;  2KSE A;  2GZJ A;  1ZW0 A;  1VQ4 P;  1GD2 E;  1L0L D;  2PNG A;  1YJN P;  3L73 E;  1NOH A;  1SQX K;  3G29 A;  1LT9 C;  3PP5 A;  1NU1 D;  1M8O B;  2RMZ A;  3HUS B;  1E0H A;  3MGE A;  2KOQ A;  3KQG A;  4JPZ B;  1RF1 A;  2JU1 A;  1DIP A;  5AVQ B;  1LGH B;  1H89 A;  3P7K A;  2Y0E A;  1MFT A;  5E79 E;  4ZKU A;  1X0T A;  3CMA P;  2R32 A;  5HV8 A;  3T97 B;  3PLN A;  2I1J A;  3GMA A;  2YIU B;  3CCE P;  1VL2 A;  2JU2 A;  1NTZ K;  2UWJ E;  3SFE C;  2LML A;  4XFZ A;  3PRJ A;  2P67 A;  1MZ8 A;  3L70 E;  1R8E A;  5AW6 B;  3M0A A;  1R5S A;  2QA4 P;  2K9Y A;  2Z5H A;  1GK4 A;  3HD7 A;  1PGP A;  4U0F A;  3DS0 A;  1KYO H;  2KOD A;  5KAI H;  3H1J J;  2WSS H;  3CC7 P;  1N7S B;  2N1T C;  1AQ5 A;  1BE3 E;  4COC A;  1X3O A;  1FZC B;  3CCJ P;  3VYI A;  1VQO P;  2J58 A;  3FX0 A;  2K1A A;  4WBA A;  2OGU A;  2IDB A;  2WSF H;  1BSH A;  4RKU J;  2L0Q A;  1USD A;  3A5T A;  2GYK A;  3H32 B;  1L0L J;  5APX A;  4WVZ A;  3Q5R A;  1G1I A;  1YHQ P;  4HKZ H;  3H1L G;  2ZFC A;  1DV5 A;  2LL8 A;  1NU1 J;  1CI6 B;  2FXM A;  3S1K A;  5H2F E;  3I55 P;  4C7N B;  4MN4 C;  2FFD C;  3NMD A;  1HUC A;  3B4Q A;  3L74 E;  1PPJ E;  4IZ6 A;  1AVO A;  3DPH A;  1KB9 H;  4PWV B;  1Y8A A;  4DZO A;  2ZT9 C;  3CX5 E;  1SQP E;  1U7M A;  1SQB G;  2QJK B;  1QL2 A;  2GZF A;  4PV1 B;  2XV6 A;  2AXC A;  2KOR A;  4JYB A;  3IN6 A;  2FAE A;  3WUT A;  2Z45 A;  1H8A A;  1S3J A;  2YNY A;  3SWY A;  2CG5 B;  5AVT B;  2E74 D;  5CCH D;  2WVR A;  5BS2 A;  4IL6 E;  3VMZ A;  2KS1 B;  4EIJ A;  3P8C E;  2L6E A;  4GR6 A;  2MD9 A;  5B5E E;  1MFZ A;  1QL1 A;  1LTJ B;  3RL0 B;  2IBZ G;  3L71 E;  3HRN A;  2XNX A;  1RF0 C;  1NJI Q;  3EJB A;  1URQ B;  1BGY D;  1KTM A;  4OGQ C;  2QVA A;  3SWF A;  1IK7 A;  4RES B;  1A02 F;  1QGK B;  1S2E A;  1SQB K;  2L4B A;  1SFC B;  3A0H H;  3M0D A;  5CCG C;  3RK2 B;  2Z46 A;  1M1J A;  4YPC A;  3GHG B;  1BE3 J;  2L22 A;  1W5C E;  3HTK B;  2P1J A;  4U3F E;  2WSC J;  1Z56 A;  3G9R A;  1KQL A;  2XZ1 C;  1RE3 C;  1OXZ A;  2N5H A;  1ZLL A;  2KOS A;  2ZXX A;  2YKQ A;  1JJ2 O;  3R2P A;  4CPG A;  1KYO D;  2ZVN B;  2W83 C;  1LTA C;  4TLF A;  4HYT B;  2OYH B;  2JWD A;  1KLP A;  3RK3 E;  3NTN A;  3G1I A;  2POH A;  4EDF A;  1FJP A;  2CPS A;  5AW8 B;  3KZI E;  2HG5 D;  1EXI A;  5C39 A;  4U3F D;  1EIA A;  2EHS A;  3IAO A;  3BCC G;  2VLN A;  1FDO A;  3L74 J;  1W2B O;  1S72 P;  1HJ0 A;  1PGQ A;  1QLE D;  2A06 D;  3B5N A;  2NPS B;  3TSI A;  2QEX P;  3H1H G;  1FOS E;  1MKM A;  4H44 B;  1L4A A;  1DEB A;  2H7H A;  1SQB E;  3H1K D;  1BGY J;  1LTB C;  2MR8 A;  2B89 A;  2LKM A;  3GZM A;  2LTE A;  3CE7 A;  2KK7 A;  1KB9 D;  2FXO A;  2KUB A;  3RK3 C;  2OYI A;  4U0C A;  4WY4 C;  3GLM A;  3WU2 H;  1S5L X;  2KB7 P;  1RF1 C;  4Y99 C;  4EYY Q;  2G3A A;  3MGN A;  1ACP A;  3CPW O;  1IFJ A;  1NTM K;  2FAD A;  3L71 J;  1ZR4 A;  4UHP B;  2GM4 A;  3M9H A;  3EJE A;  3M9B A;  1D7M A;  3H1J G;  1A43 A;  2CWO A;  1JY3 P;  4RJT A;  4RO0 A;  2EIA A;  2M5A B;  5APQ A;  1SQV G;  2O1K A;  3AEC C;  2BCC D;  1N2D C;  2XDJ A;  1KYO I;  2I8D A;  4U3F J;  1L0N E;  1JMB A;  1AV1 A;  3L72 G;  3VMX A;  2XZ0 D;  2WWW A;  1SS1 A;  1BCC E;  3U1C A;  2MVV A;  1EQ7 A;  2WPR A;  4AQR D;  2JGP A;  3L4F A;  4TT3 H;  1S9K E;  3D6Y A;  2Q3I A;  1GZL A;  2CQ8 A;  2OTJ P;  2A45 H;  3H1K J;  1NAF A;  2K9J A;  2ZYD A;  3NTE A;  4OH8 B;  2I1K A;  3GW6 A;  3VRL C;  1VF5 C;  1AYI A;  3RBZ A;  3TNU A;  2YO2 A;  2KXP B;  1J1D B;  2PEM A;  1FZB A;  1LTI C;  2QJY C;  4I2L C;  4WB4 A;  1JY3 N;  3G28 A;  3H1I G;  5F2K A;  1NH4 A;  1L0N D;  1YTZ I;  1QX8 A;  1IZN B;  1NTK G;  2FYU D;  4PXH B;  3CLQ A;  5TIS H;  2FXP A;  4N78 D;  1PFI A;  4GOF A;  4PD4 E;  3HD7 B;  4IOI H;  2JYL A;  2O01 H;  1NWQ A;  2P9X A;  1KB9 I;  2QJP C;  2V4H A;  1JY2 O;  2JDI H;  1OVR A;  3FXE A;  1L0L K;  1K30 A;  4WYM A;  5AVZ B;  1BAJ A;  2KZJ A;  1AA0 A;  1RH5 B;  1USE A;  3U1A A;  2Y9Z A;  1EZV E;  3SSU A;  5E79 H;  1N73 C;  2BCC J;  5AVU B;  2AF8 A;  2H89 C;  3IFM A;  1KIL D;  3CI9 A;  1KFM A;  4ZNC A;  2VLO A;  1VQL P;  2BAS A;  3OJA B;  3A2A A;  1ZRT D;  4JBZ A;  1FJK A;  7CEI A;  2KSJ A;  1GL2 C;  2LIW A;  3D6Z A;  3VMY A;  2W6A A;  3GJN A;  3BRV B;  1HQB A;  1GU5 A;  1UII A;  3AEF C;  2ZYG A;  1RQU A;  1EZV D;  2E76 D;  2PFX A;  1ZV8 A;  2WPS A;  1SQV E;  2WSC H;  3CWB D;  2MKV A;  4M0I A;  3M0D C;  1FE6 A;  1ZOY C;  1L0N J;  3L72 E;  3HUS C;  2FYU J;  2WQY C;  2O1J A;  2GUS A;  1YTZ T;  5F2O A;  1BCC J;  2Y0C A;  3TF5 A;  1HVV A;  4H0L B;  3LID A;  3KPE A;  5KLV E;  2HPC A;  2YIU C;  4UB6 E;  2JWA A;  2W8Z A;  1HY8 A;  1VKU A;  5AW9 B;  1NTZ G;  4B86 A;  3RG2 A;  2CPB A;  5AVV B;  5H2F H;  4K3A A;  4U0A A;  4WWI A;  3L37 A;  3H1I E;  1FR2 A;  3CCV P;  2AFD A;  1NTK E;  1N7S C;  3G0V A;  2IZ0 A;  1RO0 A;  2JB0 A;  5DJT B;  1FZC C;  2Q9I A;  1OX3 A;  3CX5 H;  1MZ9 A;  1LWU B;  1XTC C;  5BVZ A;  3L75 D;  1LNQ A;  5KP6 B;  1M56 D;  4KHX A;  1M1J B;  2E5T A;  2GZG A;  1LP1 A;  5KLV D;  1A8O A;  3D70 A;  1G1J A;  2KOG A;  1OMI A;  1RE4 A;  4OWF A;  2L9F A;  3PTZ A;  1NKZ B;  3FXD A;  2LIU A;  5DJU B;  1IK9 A;  4I7Z B;  2IZ1 A;  3CL3 D;  2MF4 A;  1AUM A;  2Z4E A;  5HGM A;  1P84 E;  1PL5 A;  3AE4 C;  2K88 A;  1DD4 A;  2G8Y A;  3CWB J;  4IL6 H;  2P58 A;  1EXJ A;  2JAZ A;  1IFP A;  2N1T D;  5B5E H;  2PEJ A;  3II6 A;  2OQQ A;  3AE1 C;  2C9N Y;  1ZN5 A;  3L73 D;  4O9B A;  1SQQ E;  5EJD A;  3G26 A;  4AYC A;  3M06 A;  1Y9B A;  2H43 A;  3CXH E;  1EZV I;  2BHV A;  3V4W A;  4H13 B;  1UIX A;  4HKG A;  3W67 A;  1K05 A;  2QJK C;  2WPV B;  3GG2 A;  4U0B A;  4LC1 A;  5AVS B;  3ABV C;  4PV1 C;  3HZQ A;  2J59 M;  3B5N B;  1L4A B;  2KIK A;  1E5W A;  2R3C A;  1SQX E;  3L70 D;  3AEG C;  2OYO A;  2E43 A;  2FKW B;  1NHL A;  3Q2Y A;  5L8R J;  1KFN A;  3L75 J;  1HBW A;  3TGU G;  3C9I A;  1BE3 D;  4D6T G;  5KLV J;  1LTJ C;  3RL0 C;  2OYI B;  5APU A;  2P10 A;  3VP8 A;  3Q3D A;  1J1E B;  1NTZ E;  1URQ C;  3E2D A;  2FQ2 A;  3KZI H;  1EDI A;  2JEE A;  3F5H A;  4EOT A;  2A45 I;  3AE6 C;  2SPZ A;  1M6E X;  2DW3 A;  1SFC C;  4KJM A;  3RK2 C;  2O01 J;  3AE5 C;  3E7K A;  2ZYA A;  1IUQ A;  3GHG C;  1OFC X;  2W27 A;  2PRR A;  5KJ7 D;  3L73 J;  3MTU E;  1RY3 A;  1JNM A;  1JCC A;  3JCU E;  3E1I A;  1KOR A;  1NYH A;  5AVR B;  1M6N A;  3L74 D;  1PPJ D;  2OYH C;  4OGQ D;  3CCQ P;  2N6Z A;  2KG8 A;  3CC4 P;  3CX5 D;  2L91 A;  2ZJS E;  1M1K Q;  1SQP D;  5CCG D;  4JYC A;  2IPP A;  4CA3 A;  1SVF A;  1T2K C;  1EOQ A;  5KAF E;  2K9J B;  2WSE J;  3L70 J;  3V2P A;  1KIL A;  3DTJ A;  2VRS A;  4EI2 A;  3MZW B;  3U59 A;  3IF4 A;  2KWL A;  1LWU A;  1Q81 Q;  4ZMD A;  1PZQ A;  1SQQ J;  3TNU B;  1AFO A;  1YQ4 C;  4MRT C;  1K8A Q;  1VQ5 P;  3DS5 A;  2NPS C;  4H44 C;  2B87 A;  1OR5 A;  2GUV A;  3P8C D;  4XA4 A;  4QNB A;  3KXD A;  2R44 A;  4GOD A;  2IYP A;  3L71 D;  2R5D A;  3WUU A;  4R0M A;  2YXR B;  3EQ2 A;  1S5L E;  2BEZ F;  4QKO A;  1PEO A;  2VSQ A;  1WRG A;  4N6J A;  1SQX J;  3CD6 P;  1PP9 G;  1JB0 J;  4M3L A;  2FY8 A;  3I56 P;  3G21 A;  3MUD A;  3H1L E;  1JCD A;  2K94 A;  3TGU E;  1S1C X;  2JQ4 A;  2E75 D;  4D6T E;  3Q5P A;  1GU4 A;  1X79 B;  5K5G B;  2E74 B;  4XRQ A;  4NPE A;  5KLI B;  2CK3 H;  2IFN A;  1NTM G;  4C7R A;  1SP4 A;  3M1M A;  1M90 Q;  3F89 A;  1PEU A;  3L36 A;  1SQP J;  2LPK A;  2KLV A;  1LT9 A;  4NPF X;  5AW7 B;  3LRY A;  3RK3 D;  1RO2 A;  4PD4 H;  3AED C;  4WY4 D;  3S4R A;  3B4S A;  3I5C A;  3H1L D;  2FYN B;  5JPA A;  1GW4 A;  2CNR A;  1QEX A;  2MR7 A;  2KZI A;  2XZR A;  3K5B A;  3CX5 I;  1N7L A;  4YXW H;  1LTS C;  5KKZ B;  2C0W A;  4BRY B;  2N98 A;  3BAS A;  1ZXG A;  2QNW A;  1K04 A;  2VLQ A;  4Z1M H;  4IFF A;  3OA7 A;  2NO8 A;  1M74 A;  3C8V A;  1BDD A;  2IBZ E;  2H88 C;  3SFD C;  1SQB D;  2HPC B;  1RNI A;  1J1D C;  1ZR2 A;  2EFJ A;  2Z44 A;  1FC2 C;  5GTH E;  1IFN A;  2N1T A;  1IJD B;  2Z5I A;  4L74 A;  3RBX A;  2QIW A;  3MP7 B;  2GZE A;  2L5G B;  3HD7 C;  2FVE A;  4IFD K;  2XT1 A;  1WT6 A;  3V2Q A;  2WZ7 A;  2BEQ D;  3NY7 B;  2CGQ A;  2Y0D A;  1KD1 Q;  1OIP A;  4NEO A;  2YKP A;  4NPD A;  2JP3 A;  1VQM P;  1GTW A;  2E5Y A;  2E1M A;  4HJG H;  2ZAE B;  4GOE A;  1VF5 D;  2HOD A;  3V2R A;  3U43 A;  1M57 D;  1L0L G;  1LP1 B;  1MUU A;  4F37 A;  3HE4 A;  3BAT A;  4DJG A;  1T8K A;  2A45 G;  3G6E P;  1PP9 E;  2JJL A;  2O01 N;  3WMM 0;  1EDK A;  2FFD A;  2ITA A;  4PH0 A;  3L75 G;  3H1L J;  1GDT A;  1NU1 G;  4UB6 H;  4BWN A;  3UIA A;  5CBO A;  1JMM A;  3TK1 A;  1T3J A;  2YMK A;  5AW1 B;  1YI2 P;  3BCC E;  2K2Q A;  4GR2 A;  3SWK A;  1T8Z A;  1BCC D;  1NTM E;  3CC2 P;  3OAK A;  1BDC A;  3KDP B;  1AJY A;  1XTG B;  3H1H E;  1IFI A;  3MD0 A;  1S9K D;  4L73 A;  5I4T G;  5APS A;  1IO4 A;  3KYQ A;  1SQB J;  1X9V A;  2AVA A;  4PJ0 E;  1YJ9 P;  3B8E B;  3GKL C;  2XV5 A;  4YTP C;  5KJ7 A;  2AXT E;  3G4S P;  2P2U A;  1NU1 K;  2KP8 A;  2K0Y A;  4H0L C;  2XKM A;  1HWT C;  5CCH A;  1YBK A;  3PHL A;  2N9Y B;  1GL2 D;  1P84 H;  4PD4 D;  2OTK E;  5CHX A;  1CEI A;  2WMM A;  2KG9 A;  2YXQ B;  1DNY A;  3RL0 g;  1AQT A;  1DH3 A;  1DX7 A;  2M8N A;  2WSE H;  1OVV A;  4K35 A;  5CCG A;  1PEQ A;  1GMJ A;  1Z6M A;  3W68 A;  1L2P A;  5CJ0 A;  2M8L A;  2FAC A;  3H1J E;  3PH0 A;  3CXH H;  2D2C D;  1GXG A;  1BE3 G;  3VTP C;  4A7P A;  2PY8 A;  1GW3 A;  1RE3 A;  4LGD E;  1LWU C;  4BRY A;  2X2B A;  1K73 Q;  1M1J C;  1NVO A;  5APV A;  5CBN A;  5AW0 B;  2OTL P;  2AEJ A;  1NAY A;  3A0B E;  2W6B A;  3AEE C;  2QRX A;  4I7Z C;  1VQ8 P;  1L0L E;  1HJB A;  3S9O A;  5F2N A;  5HGN A;  1KZU B;  5AW3 B;  2QE7 H;  1X22 A;  2PEI A;  3AE8 C;  2KNC A;  2ZXE B;  1N7S D;  3FWN A;  4H2Y C;  1NU1 E;  2R5B A;  3GZL A;  1JEK A;  1FZF A;  2KG6 A;  2K92 A;  1S4X A;  1SQV D;  1PEM A;  3L72 D;  2C9L Y;  4XRO A;  3L74 G;  3BCC J;  1PPJ G;  1FAV A;  1CZQ A;  2GZI A;  1KIL B;  4H13 C;  3CCR P;  3TYY A;  2DNW A;  2BQ1 E;  5KP7 B;  1DEE G;  3V6I A;  1KV4 A;  1SQP G;  3H1H J;  1IMP A;  1BGY G;  3WUV A;  3B5N C;  2P7J A;  3KHU A;  1L4A C;  2B87 B;  3M91 A;  3M9Q A;  2R3S A;  3AEA C;  4WY4 A;  3JCU H;  1QRJ A;  2W90 A;  4PD4 I;  5B66 E;  3TDK A;  4DCK A;  5CMZ A;  2D2C B;  3H1I D;  1VDF A;  3HYB A;  2E76 B;  1NTK D;  5KTB A;  2GA1 A;  1EC5 A;  2K37 A;  1RQV A;  1EDJ A;  4BPF A;  5M1B A;  2OYI C;  3HE5 A;  2ERH A;  1J1E C;  1U57 A;  1H0T A;  5HGO A;  3BVH A;  3L71 G;  4XE5 B;  2FBW C;  2MJZ A;  2M5R A;  3AEB C;  3H6P A;  1PIX A;  5KAF H;  3FWL A;  2KI7 B;  4GDO A;  3H47 A;  2H8P D;  4PV1 D;  1LTT C;  1HGV A;  5APT A;  1SQP K;  4UB8 H;  2FVA A;  3V2N A;  3RG6 C;  3OW2 O;  3Q1M A;  1P84 D;  1DD3 A;  5APY A;  4I6M C;  4DOJ A;  2M3B A;  4U3F G;  1SQV J;  1JY2 P;  1SLQ A;  1YQ3 C;  4R4M A;  2KOP A;  2HR3 A;  1LT9 B;  3L72 J;  4JQ0 D;  3RL0 D;  2M0B A;  2MY5 A;  5AVX B;  2HYN A;  2A06 G;  1SQQ D;  3VN0 A;  2XND H;  4U0E A;  2IYO A;  1URQ D;  1S5L H;  4W80 A;  1VQP P;  2K93 A;  3Q20 A;  4COP A;  3CXH D;  3H1K G;  2ZT9 D;  1X8Y A;  2JR8 A;  2K5X A;  1FZE A;  1SFC D;  3GF3 A;  2J5U A;  3RK2 D;  1LJ2 A;  1VQ6 P;  3MHV A;  2RN0 A;  3H1I J;  1PV3 A;  1JY2 N;  3EFG A;  1NTK J;  1SQX D;  2N5I A;  1YJW P;  2Y9Y A;  1L0H A;  4QMA A;  2N1T B;  1JTH A;  2LOL A;  3G1G A;  2PGD A;  3FGA D;  3O6Q B;  3USS A;  2FYZ A;  1VPC A;  5HGL A;  1JY3 O;  2WT7 A;  4GIF A;  1BGY E;  3WBH A;  2V7Q J;  2N9B A;  4YXD C;  1RHZ B;  1PGJ A;  1NTZ D;  2K0D X;  1N73 A;  3MIW A;  1T2K D;  1ZP0 C;  1F80 D;  2DGY A;  3GF7 A;  5APW A;  3E1R A;  4R4L A;  5AVY B;  2BCC G;  2HOD B;  2EG5 A;  1MV8 A;  1OW7 A;  5KJ7 C;  1HH0 A;  2B88 A;  1HGZ A;  3A3Y B;  3HE4 B;  2LF4 A;  2NPS D;  2YO3 A;  1KMI Z;  3RGU A;  4UB8 E;  5HVC A;  2GDW A;  2WTY A;  1NQ4 A;  1GL2 A;  1JM0 A;  4H44 D;  3LW5 H;  3EWK A;  2FFD B;  1VQ9 P;  2PP6 A;  2E74 C;  5CCH C;  5KLI C;  1KYO E;  5KAI E;  1IC2 A;  1P84 I;  5GTH H;  2BUO A;  2GDY A;  2C0X A;  3ZDM A;  4BXL A;  2ZT9 B;  2NRG A;  1UJZ A;  1CW5 A;  4DG9 A;  2AFE A;  2KGD A;  3HUS A;  5BU5 A;  1LT1 A;  1VQN P;  3R4Y A;  2FYN C;  2PEK A;  1L0N G;  2FYU G;  3CXH I;  1G2C B;  3T97 A;  3V4Q A;  1BCC G;  2LXC B;  5KKZ C;  1KQS O;  2HFE D;  2A06 E;  1OZH A;  5AW2 B;  3P05 A;  1R5L A;  1YIJ P;  1Y47 A;  1BSN A;  1YYC A;  2JO0 A;  2AEF A;  1FS0 E;  1Q90 D;  3H1K E;  1N86 A;  1UNK A;  2W6J H;  2ONT A;  1W2E A;  5AVW B;  4BPH A;  5AW4 B;  2ZVO B;  1NTZ J;  4IL6 X;  2PEO A;  3CCS P;  2E42 A;  3AE2 C;  1N7S A;  4OGQ B;  1NKN A;  4W7Z A;  5DCK A;  1KB9 E;  1FZC A;  1TU3 F;  2OAR A;  1JOC A;  1GPJ A;  3AE3 C;  1AVY A;  3CCM P;  2JBG A;  3ITK A;  1L0N K;  3IR9 A;  2E75 C;  2FYU K;  2IFM A;  3TGU D;  3H32 A;  4D6T D;  1A02 J;  4PJ0 H;  1H88 A;  1GK6 A;  2KGA A;  2FQ0 A;  4IPY A;  3CCU P;  3DS2 A;  1E6J P;  2AXT H;  2WPT A;  1CI6 A;  1Q2N A;  1RE4 C;  1EZV G;  5CZD B;  4C7N A;  3CWB G; 
#chains in the Genus database with same CATH homology
 2PEN A;  1VQO P;  1K9M Q;  1KD1 Q;  3VRL C;  4XFX A;  2PEJ A;  1VQN P;  3DS1 A;  5BS1 A;  4GR6 A;  2PEK A;  1NJI Q;  4M0I A;  3B5I A;  2M8N A;  1VQM P;  2PEM A;  3DS4 A;  2E1M A;  1VQ6 P;  4XRQ A;  3G26 A;  1PEQ A;  3G28 A;  5F2K A;  1QRJ A;  5F2O A;  2XXM A;  1KQS O;  3M1M A;  4U0D A;  1M90 Q;  1M6N A;  2M8L A;  1D1D A;  1N8R Q;  1QVG O;  3CCQ P;  2BHV A;  3P05 A;  1YJW P;  1PEU A;  2Z46 A;  2JYG A;  4U0C A;  3HYB A;  3H0D A;  1YIJ P;  1VQ4 P;  3G6E P;  1YHQ P;  2JO0 A;  2PY8 A;  1Q82 Q;  3CC4 P;  3DS3 A;  3G1G A;  3CME P;  3LRY A;  2JYL A;  1YJN P;  1RO2 A;  4PH0 A;  2ONT A;  1Q86 Q;  1YIT P;  1M1K Q;  1QVF O;  4U0B A;  5HGL A;  1K73 Q;  2P9X A;  1EOQ A;  3HZQ A;  3G29 A;  3I55 P;  2PEO A;  3WBH A;  5HGO A;  5JPA A;  3CPW O;  3CCS P;  3DTJ A;  2OTL P;  1YI2 P;  1K30 A;  4WYM A;  3MGE A;  4U0A A;  5DCK A;  1JJ2 O;  4GR2 A;  1Q81 Q;  1BAJ A;  3H47 A;  1VQK P;  3CCL P;  2OAR A;  1VQ8 P;  2DGY A;  3CCV P;  3CC2 P;  3DPH A;  3CMA P;  1K8A Q;  2L6E A;  3G0V A;  5F2N A;  3RG6 C;  4XFY A;  5HGN A;  1VQ5 P;  1RO0 A;  3CCM P;  3OW2 O;  3DS5 A;  2EG5 A;  1VQ7 P;  5I4T G;  1A43 A;  3CCE P;  2PEI A;  2CWO A;  1M74 A;  2EIA A;  3G1I A;  2LF4 A;  4QNB A;  4PH1 A;  4XFZ A;  2PEQ A;  1A8O A;  2XV6 A;  1RNI A;  3E2D A;  1YJ9 P;  2EFJ A;  1VQ9 P;  1VQL P;  2Z44 A;  1PEM A;  2Z45 A;  1EIA A;  2QA4 P;  4IPY A;  3CCU P;  3DS2 A;  1ZMB A;  4U0F A;  4XRO A;  3G71 P;  3G4S P;  2BUO A;  3DS0 A;  1PEO A;  2KOD A;  3H4E A;  4U0E A;  1M6E X;  1E6J P;  1KC8 Q;  1Q7Y Q;  1VQP P;  1W2B O;  3CC7 P;  3CD6 P;  3Q20 A;  1S72 P;  3CCR P;  1AUM A;  4COP A;  5HGM A;  5BS2 A;  3CXC O;  3I56 P;  3G21 A;  4COC A;  2OTJ P;  2BQ1 E;  1IUQ A;  2QEX P;  3CCJ P;  2M8P A;  2XT1 A;  3NTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...