1ACPA

Refinement of the nmr structures for acyl carrier protein with scalar coupling data
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refinement of the NMR structures for acyl carrier protein with scalar coupling data.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Fatty acid synthesis protein
molecule keywords ACYL-CARRIER PROTEIN
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1990-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1acpA00
1OR5A 3LMOA 5KP8B 2KG9A 3GZLA 4IZ6A 2KOOA 1F80D 2AFEA 5KP7B 2KWLA 3NY7B 2LTEA 5HVCA 2FHSC 2AFDA 3EJBA 2JU2A 2FQ1A 4HKGA 2KOSA 2XZ0D 3EJEA 2AF8A 2N98A 2N50A 1KLPA 2LIWA 4BPHA 1X3OA 1L0HA 2FQ0A 2FVFA 2MD9A 4BPGA 2FAEA 2AVAA 5HV8A 2K0YA 1NQ4A 1L0IA 2FVEA 2FQ2A 2MY5A 2JGPA 1T8KA 2LKIA 3EJDA 2KGAA 2N5IA 2EHSA 2FVAA 2MVUA 2K93A 5EJDA 2JU1A 2M5RA 5CZDB 2N6YA 2MF4A 2N6ZA 2DNWA 4DG9A 2X2BA 2KGEA 3GZMA 4PWVB 1HY8A 2K94A 2GDWA 2LIUA 2CQ8A 2EHTA 1VKUA 3CE7A 2K2QA 1DV5A 2KOQA 4PXHB 2MR7A 2KORA 2LPKA 2LL8A 2L22A 2XZ1C 2KW2A 4H2XC 2N5HA 2MR8A 1ACPA 2K92A 2KOPA 2FACA 2L0QA 4BPFA 2JQ4A 2L9FA 4NEOA 2QNWA 5KP6B 2LMLA 2MVVA 2K0XA 1DNYA 2VSQA 2GDYA 2L4BA 2ROQA 4H2WC 4MRTC 2KGDA 2CG5B 1HQBA 2KG8A 2CGQA 2LOLA 2GDXA 2KG6A 2KR5A 2PNGA 4CA3A 4H2YC 4R0MA 2KGCA 3RG2A 2FADA 2CNRA 1AF8A
chains in the Genus database with same CATH superfamily
1OR5A 3CC7P 2LF4A 4U0BA 3GZLA 2AFEA 1MZ8A 5HVCA 3HYBA 3G4SP 2FQ1A 2BUOA 2N50A 4QKOA 4BPHA 3CC2P 2QEXP 2FQ0A 3P05A 1ZMBA 2EFJA 4GR6A 5F2KA 2M8LA 4WYMA 2AVAA 2OTLP 5HV8A 4GR2A 4U0EA 1NQ4A 1L0IA 2FQ2A 2MY5A 4XROA 1M74A 2LKIA 2XT1A 1W2BO 1VQ5P 2L6EA 3DTJA 3CXCO 2N5IA 3CCEP 2MVUA 1VQ8P 2N6YA 3H4EA 2DNWA 1A43A 2X2BA 2KGEA 3GZMA 4PWVB 3H0DA 1HY8A 3H47A 2K0DX 3GJNA 1YHQP 1DV5A 4PXHB 2L22A 1KC8Q 1GXHA 1EIAA 2N5HA 2M8PA 1YJ9P 4BPFA 5EW5E 2M8NA 2LMLA 2MVVA 3G6EP 2L4BA 2ROQA 4XFZA 1AYIA 2CG5B 1HQBA 5DCKA 2GZJA 4QNBA 2Z45A 2JYLA 3CCLP 2FADA 1Q82Q 3LMOA 2PEKA 2NO8A 4IZ6A 2KOOA 3G0VA 3DS3A 3CMEP 4IPYA 2LTEA 3Q20A 2AFDA 1AUMA 1YI2P 1YJNP 3U43A 5BS1A 2JU2A 4HKGA 2GZGA 2AF8A 2N98A 2P9XA 2LIWA 1X3OA 3DS2A 1L0HA 3DS1A 2MD9A 2PEIA 1A8OA 2OARA 4BPGA 3G1GA 2FAEA 5F2OA 1RO2A 2K0YA 1E0HA 2VLPA 3G28A 1T8KA 2BHVA 1VQ6P 4XRQA 1VQPP 1EMVA 2K93A 5EJDA 2JU1A 2JBGA 5CZDB 2OTJP 3CCMP 1KD1Q 1VQKP 3G26A 4XFYA 3DS4A 2LIUA 1YIJP 2EHTA 1FR2A 5F2NA 1VKUA 1VQNP 3CE7A 2Z46A 2K5XA 2KODA 2PEQA 2PEJA 1IMPA 3GKLC 2E1MA 2XV6A 3LRYA 2L0QA 1JJ2O 3B5IA 2JYGA 2K0XA 1VQOP 2VSQA 2GDYA 3CD6P 4H2WC 1VQ9P 1QVFO 1ZNVA 2LOLA 3CCJP 3G29A 2GYKA 4H2YC 2KGCA 1EOQA 1K30A 2PEOA 7CEIA 2GZFA 5KP7B 3CCVP 1Q7YQ 2FHSC 2ERHA 1M1KQ 2XXMA 3EJBA 3EJEA 4PH0A 1KLPA 5HGNA 2FVFA 1BAJA 1K8AQ 1UNKA 4U0AA 1Q81Q 3CCQP 3G1IA 1RNIA 1YJWP 1N8RQ 2FVEA 3DPHA 1Q86Q 2JGPA 1QRJA 5HGMA 3E2DA 3NTEA 2KGAA 4DG9A 3MGEA 2VLQA 4PH1A 3CC4P 2GDWA 1VHNA 1KQSO 3CCRP 2CQ8A 2Z44A 5JPAA 4U0DA 2VLOA 2GZIA 3DS0A 1Z6MA 2KORA 5HGLA 2XZ1C 1GXGA 2KW2A 4H2XC 4U0CA 2VLNA 5KP6B 1DNYA 3DS5A 3CCUP 4COCA 2KGDA 2JO0A 4COPA 2CGQA 1E6JP 2JAZA 1NJIQ 2GDXA 2KR5A 5BS2A 1GPJA 2PNGA 4CA3A 2GZEA 3I56P 4R0MA 3RG2A 1M90Q 1AF8A 3B4QA 5KP8B 1VQ4P 5HGOA 2KG9A 1M6EX 2JB0A 1QVGO 1F80D 3WBHA 2KWLA 1IUQA 3NY7B 2CWOA 3CCSP 1K9MQ 3HZQA 2PY8A 1D1DA 2EIAA 4F37A 2KOSA 2XZ0D 2QA4P 1UJZA 1BXIA 3RG6C 3G21A 4XFXA 1VQLP 1CEIA 1IMQA 1RO0A 2EG5A 4M0IA 5I4TG 1YITP 3M1MA 3OW2O 1K73Q 2DGYA 3EJDA 4U0FA 2EHSA 2FVAA 3G71P 2M5RA 2MF4A 2N6ZA 1M6NA 2K94A 1S72P 2PENA 2ONTA 1VQ7P 2WPTA 2K2QA 2KOQA 1VQMP 2MR7A 2LPKA 2LL8A 2MR8A 1ACPA 3CPWO 2K92A 2KOPA 2FACA 4UHPB 2JQ4A 2L9FA 3CMAP 4NEOA 2QNWA 3I55P 2PEMA 4MRTC 3VRLC 2KG8A 2KG6A 2CNRA
chains in the Genus database with same CATH topology
1OR5A 3LMOA 5KP8B 2KG9A 3GZLA 4IZ6A 2KOOA 1F80D 2AFEA 5KP7B 2KWLA 3NY7B 2LTEA 5HVCA 2FHSC 2AFDA 3EJBA 2JU2A 2FQ1A 4HKGA 2KOSA 2XZ0D 3EJEA 2AF8A 2N98A 2N50A 1KLPA 2LIWA 4BPHA 1X3OA 1L0HA 2FQ0A 2FVFA 2MD9A 4BPGA 2FAEA 2AVAA 5HV8A 2K0YA 1NQ4A 1L0IA 2FVEA 2FQ2A 2MY5A 2JGPA 1T8KA 2LKIA 3EJDA 2KGAA 2N5IA 2EHSA 2FVAA 2MVUA 2K93A 5EJDA 2JU1A 2M5RA 5CZDB 2N6YA 2MF4A 2N6ZA 2DNWA 4DG9A 2X2BA 2KGEA 3GZMA 4PWVB 1HY8A 2K94A 2GDWA 2LIUA 2CQ8A 2EHTA 1VKUA 3CE7A 2K2QA 1DV5A 2KOQA 4PXHB 2MR7A 2KORA 2LPKA 2LL8A 2L22A 2XZ1C 2KW2A 4H2XC 2N5HA 2MR8A 1ACPA 2K92A 2KOPA 2FACA 2L0QA 4BPFA 2JQ4A 2L9FA 4NEOA 2QNWA 5KP6B 2LMLA 2MVVA 2K0XA 1DNYA 2VSQA 2GDYA 2L4BA 2ROQA 4H2WC 4MRTC 2KGDA 2CG5B 1HQBA 2KG8A 2CGQA 2LOLA 2GDXA 2KG6A 2KR5A 2PNGA 4CA3A 4H2YC 4R0MA 2KGCA 3RG2A 2FADA 2CNRA 1AF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR5 A;  3LMO A;  5KP8 B;  2KG9 A;  3GZL A;  4IZ6 A;  2KOO A;  1F80 D;  2AFE A;  5KP7 B;  2KWL A;  3NY7 B;  2LTE A;  5HVC A;  2FHS C;  2AFD A;  3EJB A;  2JU2 A;  2FQ1 A;  4HKG A;  2KOS A;  2XZ0 D;  3EJE A;  2AF8 A;  2N98 A;  2N50 A;  1KLP A;  2LIW A;  4BPH A;  1X3O A;  1L0H A;  2FQ0 A;  2FVF A;  2MD9 A;  4BPG A;  2FAE A;  2AVA A;  5HV8 A;  2K0Y A;  1NQ4 A;  1L0I A;  2FVE A;  2FQ2 A;  2MY5 A;  2JGP A;  1T8K A;  2LKI A;  3EJD A;  2KGA A;  2N5I A;  2EHS A;  2FVA A;  2MVU A;  2K93 A;  5EJD A;  2JU1 A;  2M5R A;  5CZD B;  2N6Y A;  2MF4 A;  2N6Z A;  2DNW A;  4DG9 A;  2X2B A;  2KGE A;  3GZM A;  4PWV B;  1HY8 A;  2K94 A;  2GDW A;  2LIU A;  2CQ8 A;  2EHT A;  1VKU A;  3CE7 A;  2K2Q A;  1DV5 A;  2KOQ A;  4PXH B;  2MR7 A;  2KOR A;  2LPK A;  2LL8 A;  2L22 A;  2XZ1 C;  2KW2 A;  4H2X C;  2N5H A;  2MR8 A;  1ACP A;  2K92 A;  2KOP A;  2FAC A;  2L0Q A;  4BPF A;  2JQ4 A;  2L9F A;  4NEO A;  2QNW A;  5KP6 B;  2LML A;  2MVV A;  2K0X A;  1DNY A;  2VSQ A;  2GDY A;  2L4B A;  2ROQ A;  4H2W C;  4MRT C;  2KGD A;  2CG5 B;  1HQB A;  2KG8 A;  2CGQ A;  2LOL A;  2GDX A;  2KG6 A;  2KR5 A;  2PNG A;  4CA3 A;  4H2Y C;  4R0M A;  2KGC A;  3RG2 A;  2FAD A;  2CNR A;  1AF8 A; 
#chains in the Genus database with same CATH topology
 1OR5 A;  3CC7 P;  2LF4 A;  4U0B A;  3GZL A;  2AFE A;  1MZ8 A;  5HVC A;  3HYB A;  3G4S P;  2FQ1 A;  2BUO A;  2N50 A;  4QKO A;  4BPH A;  3CC2 P;  2QEX P;  2FQ0 A;  3P05 A;  1ZMB A;  2EFJ A;  4GR6 A;  5F2K A;  2M8L A;  4WYM A;  2AVA A;  2OTL P;  5HV8 A;  4GR2 A;  4U0E A;  1NQ4 A;  1L0I A;  2FQ2 A;  2MY5 A;  4XRO A;  1M74 A;  2LKI A;  2XT1 A;  1W2B O;  1VQ5 P;  2L6E A;  3DTJ A;  3CXC O;  2N5I A;  3CCE P;  2MVU A;  1VQ8 P;  2N6Y A;  3H4E A;  2DNW A;  1A43 A;  2X2B A;  2KGE A;  3GZM A;  4PWV B;  3H0D A;  1HY8 A;  3H47 A;  2K0D X;  3GJN A;  1YHQ P;  1DV5 A;  4PXH B;  2L22 A;  1KC8 Q;  1GXH A;  1EIA A;  2N5H A;  2M8P A;  1YJ9 P;  4BPF A;  5EW5 E;  2M8N A;  2LML A;  2MVV A;  3G6E P;  2L4B A;  2ROQ A;  4XFZ A;  1AYI A;  2CG5 B;  1HQB A;  5DCK A;  2GZJ A;  4QNB A;  2Z45 A;  2JYL A;  3CCL P;  2FAD A;  1Q82 Q;  3LMO A;  2PEK A;  2NO8 A;  4IZ6 A;  2KOO A;  3G0V A;  3DS3 A;  3CME P;  4IPY A;  2LTE A;  3Q20 A;  2AFD A;  1AUM A;  1YI2 P;  1YJN P;  3U43 A;  5BS1 A;  2JU2 A;  4HKG A;  2GZG A;  2AF8 A;  2N98 A;  2P9X A;  2LIW A;  1X3O A;  3DS2 A;  1L0H A;  3DS1 A;  2MD9 A;  2PEI A;  1A8O A;  2OAR A;  4BPG A;  3G1G A;  2FAE A;  5F2O A;  1RO2 A;  2K0Y A;  1E0H A;  2VLP A;  3G28 A;  1T8K A;  2BHV A;  1VQ6 P;  4XRQ A;  1VQP P;  1EMV A;  2K93 A;  5EJD A;  2JU1 A;  2JBG A;  5CZD B;  2OTJ P;  3CCM P;  1KD1 Q;  1VQK P;  3G26 A;  4XFY A;  3DS4 A;  2LIU A;  1YIJ P;  2EHT A;  1FR2 A;  5F2N A;  1VKU A;  1VQN P;  3CE7 A;  2Z46 A;  2K5X A;  2KOD A;  2PEQ A;  2PEJ A;  1IMP A;  3GKL C;  2E1M A;  2XV6 A;  3LRY A;  2L0Q A;  1JJ2 O;  3B5I A;  2JYG A;  2K0X A;  1VQO P;  2VSQ A;  2GDY A;  3CD6 P;  4H2W C;  1VQ9 P;  1QVF O;  1ZNV A;  2LOL A;  3CCJ P;  3G29 A;  2GYK A;  4H2Y C;  2KGC A;  1EOQ A;  1K30 A;  2PEO A;  7CEI A;  2GZF A;  5KP7 B;  3CCV P;  1Q7Y Q;  2FHS C;  2ERH A;  1M1K Q;  2XXM A;  3EJB A;  3EJE A;  4PH0 A;  1KLP A;  5HGN A;  2FVF A;  1BAJ A;  1K8A Q;  1UNK A;  4U0A A;  1Q81 Q;  3CCQ P;  3G1I A;  1RNI A;  1YJW P;  1N8R Q;  2FVE A;  3DPH A;  1Q86 Q;  2JGP A;  1QRJ A;  5HGM A;  3E2D A;  3NTE A;  2KGA A;  4DG9 A;  3MGE A;  2VLQ A;  4PH1 A;  3CC4 P;  2GDW A;  1VHN A;  1KQS O;  3CCR P;  2CQ8 A;  2Z44 A;  5JPA A;  4U0D A;  2VLO A;  2GZI A;  3DS0 A;  1Z6M A;  2KOR A;  5HGL A;  2XZ1 C;  1GXG A;  2KW2 A;  4H2X C;  4U0C A;  2VLN A;  5KP6 B;  1DNY A;  3DS5 A;  3CCU P;  4COC A;  2KGD A;  2JO0 A;  4COP A;  2CGQ A;  1E6J P;  2JAZ A;  1NJI Q;  2GDX A;  2KR5 A;  5BS2 A;  1GPJ A;  2PNG A;  4CA3 A;  2GZE A;  3I56 P;  4R0M A;  3RG2 A;  1M90 Q;  1AF8 A;  3B4Q A;  5KP8 B;  1VQ4 P;  5HGO A;  2KG9 A;  1M6E X;  2JB0 A;  1QVG O;  1F80 D;  3WBH A;  2KWL A;  1IUQ A;  3NY7 B;  2CWO A;  3CCS P;  1K9M Q;  3HZQ A;  2PY8 A;  1D1D A;  2EIA A;  4F37 A;  2KOS A;  2XZ0 D;  2QA4 P;  1UJZ A;  1BXI A;  3RG6 C;  3G21 A;  4XFX A;  1VQL P;  1CEI A;  1IMQ A;  1RO0 A;  2EG5 A;  4M0I A;  5I4T G;  1YIT P;  3M1M A;  3OW2 O;  1K73 Q;  2DGY A;  3EJD A;  4U0F A;  2EHS A;  2FVA A;  3G71 P;  2M5R A;  2MF4 A;  2N6Z A;  1M6N A;  2K94 A;  1S72 P;  2PEN A;  2ONT A;  1VQ7 P;  2WPT A;  2K2Q A;  2KOQ A;  1VQM P;  2MR7 A;  2LPK A;  2LL8 A;  2MR8 A;  1ACP A;  3CPW O;  2K92 A;  2KOP A;  2FAC A;  4UHP B;  2JQ4 A;  2L9F A;  3CMA P;  4NEO A;  2QNW A;  3I55 P;  2PEM A;  4MRT C;  3VRL C;  2KG8 A;  2KG6 A;  2CNR A; 
#chains in the Genus database with same CATH homology
 1OR5 A;  3LMO A;  5KP8 B;  2KG9 A;  3GZL A;  4IZ6 A;  2KOO A;  1F80 D;  2AFE A;  5KP7 B;  2KWL A;  3NY7 B;  2LTE A;  5HVC A;  2FHS C;  2AFD A;  3EJB A;  2JU2 A;  2FQ1 A;  4HKG A;  2KOS A;  2XZ0 D;  3EJE A;  2AF8 A;  2N98 A;  2N50 A;  1KLP A;  2LIW A;  4BPH A;  1X3O A;  1L0H A;  2FQ0 A;  2FVF A;  2MD9 A;  4BPG A;  2FAE A;  2AVA A;  5HV8 A;  2K0Y A;  1NQ4 A;  1L0I A;  2FVE A;  2FQ2 A;  2MY5 A;  2JGP A;  1T8K A;  2LKI A;  3EJD A;  2KGA A;  2N5I A;  2EHS A;  2FVA A;  2MVU A;  2K93 A;  5EJD A;  2JU1 A;  2M5R A;  5CZD B;  2N6Y A;  2MF4 A;  2N6Z A;  2DNW A;  4DG9 A;  2X2B A;  2KGE A;  3GZM A;  4PWV B;  1HY8 A;  2K94 A;  2GDW A;  2LIU A;  2CQ8 A;  2EHT A;  1VKU A;  3CE7 A;  2K2Q A;  1DV5 A;  2KOQ A;  4PXH B;  2MR7 A;  2KOR A;  2LPK A;  2LL8 A;  2L22 A;  2XZ1 C;  2KW2 A;  4H2X C;  2N5H A;  2MR8 A;  1ACP A;  2K92 A;  2KOP A;  2FAC A;  2L0Q A;  4BPF A;  2JQ4 A;  2L9F A;  4NEO A;  2QNW A;  5KP6 B;  2LML A;  2MVV A;  2K0X A;  1DNY A;  2VSQ A;  2GDY A;  2L4B A;  2ROQ A;  4H2W C;  4MRT C;  2KGD A;  2CG5 B;  1HQB A;  2KG8 A;  2CGQ A;  2LOL A;  2GDX A;  2KG6 A;  2KR5 A;  2PNG A;  4CA3 A;  4H2Y C;  4R0M A;  2KGC A;  3RG2 A;  2FAD A;  2CNR A;  1AF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...