1ACPA

Refinement of the nmr structures for acyl carrier protein with scalar coupling data
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fatty acid synthesis protein
molecule keywords ACYL-CARRIER PROTEIN
publication title Refinement of the NMR structures for acyl carrier protein with scalar coupling data.
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1990-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1acpA00
1HQBA 2N98A 4NEOA 3EJBA 2N6YA 2AVAA 2N6ZA 2FVEA 2JQ4A 2MD9A 3CE7A 1NQ4A 2N5IA 2K92A 2MR8A 1T8KA 2AF8A 2KOOA 2GDXA 3EJEA 3NY7B 2LL8A 2ROQA 2CQ8A 2KG9A 2L0QA 2FVFA 1F80D 2K94A 2VSQA 5HV8A 2KG6A 4BPHA 5CZDB 2GDYA 3RG2A 2CNRA 4BPFA 2MY5A 1DNYA 4PXHB 2K0XA 5KP7B 2CG5B 2M5RA 3LMOA 4PWVB 2FQ0A 2LIUA 2AFDA 2KORA 4H2XC 2K0YA 2LOLA 2EHTA 2FVAA 2N50A 2LMLA 2KOQA 4H2YC 2JU2A 2KR5A 5KP6B 1AF8A 2FHSC 2MR7A 1KLPA 2L22A 2KGCA 2LIWA 4H2WC 1L0HA 2KGEA 2CGQA 1DV5A 3EJDA 5KP8B 4MRTC 2FAEA 2JGPA 4HKGA 2FQ2A 2X2BA 1OR5A 2KOPA 2FADA 4CA3A 2PNGA 1HY8A 2KW2A 2DNWA 5EJDA 4BPGA 2FQ1A 1X3OA 5HVCA 2XZ1C 2MVVA 3GZLA 4DG9A 2KGDA 2LKIA 2LTEA 2KOSA 2KG8A 2JU1A 1VKUA 2GDWA 2N5HA 1L0IA 2L9FA 2MVUA 4R0MA 2EHSA 2KWLA 1ACPA 2LPKA 2FACA 2XZ0D 2K2QA 2QNWA 2MF4A 2K93A 2AFEA 2KGAA 4IZ6A 2L4BA 3GZMA
chains in the Genus database with same CATH superfamily
2N98A 1S72P 3EJBA 2N6YA 1M6EX 1M6NA 1VQ7P 3CE7A 3VRLC 5HGNA 1GXGA 2AF8A 2KOOA 3NY7B 2VLNA 1YJ9P 1F80D 1Q82Q 4BPHA 1VQ9P 3RG2A 4U0AA 1YIJP 1DNYA 1W2BO 3LMOA 1QRJA 4PWVB 1D1DA 2KORA 3U43A 2EIAA 2EHTA 2FVAA 2OTJP 2KR5A 1AF8A 4QKOA 1KLPA 1L0HA 2KGEA 5HGMA 2QEXP 1Q81Q 2XT1A 2DGYA 4MRTC 1QVGO 4GR6A 1GXHA 1CEIA 1YITP 2ERHA 3CCUP 2PEIA 2FQ1A 1AYIA 1VQPP 2E1MA 2XZ1C 3H4EA 3G71P 2MVVA 3GZLA 3DS3A 2KGDA 1VQ4P 1Z6MA 3G1IA 3GKLC 2JU1A 2GZEA 2GDWA 4XFXA 1UNKA 1L0IA 2EFJA 3G1GA 2K5XA 2MVUA 2JB0A 2M8PA 1M74A 2LPKA 2MF4A 3CCMP 2KGAA 4IZ6A 1IMQA 1A43A 2PY8A 2JBGA 1M90Q 1AUMA 1RNIA 2JYGA 2N6ZA 2LF4A 4XROA 2JQ4A 5BS1A 1YJNP 2MD9A 2M8NA 1NQ4A 1K9MQ 3OW2O 5EW5E 2PENA 2MR8A 1T8KA 1RO2A 3G26A 5I4TG 4PH1A 4PH0A 2CQ8A 2XV6A 2FVFA 2K94A 2VSQA 2Z45A 2BHVA 1BAJA 3Q20A 1YJWP 2GDYA 2CNRA 3CMEP 5DCKA 2MY5A 2K0DX 4IPYA 4U0DA 2K0YA 2ONTA 4F37A 2KOQA 5KP6B 1QVFO 2MR7A 3G29A 4XRQA 2OARA 2GZGA 1A8OA 2X2BA 1OR5A 4CA3A 2BUOA 3RG6C 1HY8A 2CWOA 5EJDA 1X3OA 5BS2A 3H0DA 1EIAA 3CCLP 4DG9A 2LKIA 4U0CA 1VKUA 1EMVA 3CCEP 2JYLA 4QNBA 7CEIA 2N5HA 3M1MA 2L9FA 3CCQP 2EHSA 3B5IA 2FACA 1E6JP 2GZJA 2GZIA 2XXMA 2QNWA 3G4SP 3DS2A 2GYKA 4XFYA 5F2NA 3CCSP 3DS5A 3GZMA 1HQBA 2QA4P 2FVEA 3HYBA 5HGLA 1RO0A 2N5IA 4WYMA 1IUQA 4U0BA 2PEJA 2KG9A 2L0QA 2JAZA 2KG6A 2Z44A 5CZDB 3CC2P 1K73Q 4PXHB 2K0XA 5KP7B 2CG5B 2M5RA 3DS4A 2LIUA 2PEQA 2AFDA 1MZ8A 4H2XC 3G28A 2N50A 2LMLA 2M8LA 2EG5A 4H2YC 5F2KA 2LIWA 4H2WC 2NO8A 2CGQA 2VLOA 1BXIA 4GR2A 3CMAP 3GJNA 4HKGA 2FQ2A 3CCJP 2KOPA 3G0VA 2KW2A 4BPGA 3I55P 1VQNP 3CPWO 1IMPA 1Q7YQ 2KG8A 5JPAA 4XFZA 1VQOP 1JJ2O 2VLPA 1YHQP 1VQMP 1UJZA 2XZ0D 3CD6P 4COPA 2KODA 2K93A 2AFEA 3WBHA 1KC8Q 4NEOA 4U0EA 3DTJA 2AVAA 1Q86Q 3CCVP 1VHNA 2K92A 2PEMA 3DS0A 1ZNVA 5F2OA 3G6EP 2GDXA 1EOQA 3EJEA 2LL8A 2ROQA 1K8AQ 3P05A 4UHPB 1VQ5P 5HV8A 3DS1A 3I56P 1N8RQ 1KQSO 3H47A 5HGOA 2VLQA 4BPFA 2Z46A 2L6EA 1K30A 2FQ0A 3MGEA 2LOLA 1VQLP 1GPJA 2JU2A 2FHSC 4U0FA 2GZFA 1KD1Q 2L22A 2PEKA 2KGCA 4COCA 1DV5A 3EJDA 3NTEA 5KP8B 2PEOA 3CXCO 3CC7P 2FAEA 2P9XA 2JGPA 2WPTA 2FADA 2PNGA 3HZQA 2DNWA 1VQ6P 3LRYA 5HVCA 3B4QA 2JO0A 1NJIQ 3E2DA 3CC4P 2LTEA 2KOSA 1YI2P 1VQKP 3G21A 1M1KQ 2OTLP 4M0IA 4R0MA 1FR2A 2KWLA 1ACPA 1VQ8P 2K2QA 3DPHA 1E0HA 3CCRP 1ZMBA 2L4BA
chains in the Genus database with same CATH topology
1HQBA 2N98A 4NEOA 3EJBA 2N6YA 2AVAA 2N6ZA 2FVEA 2JQ4A 2MD9A 3CE7A 1NQ4A 2N5IA 2K92A 2MR8A 1T8KA 2AF8A 2KOOA 2GDXA 3EJEA 3NY7B 2LL8A 2ROQA 2CQ8A 2KG9A 2L0QA 2FVFA 1F80D 2K94A 2VSQA 5HV8A 2KG6A 4BPHA 5CZDB 2GDYA 3RG2A 2CNRA 4BPFA 2MY5A 1DNYA 4PXHB 2K0XA 5KP7B 2CG5B 2M5RA 3LMOA 4PWVB 2FQ0A 2LIUA 2AFDA 2KORA 4H2XC 2K0YA 2LOLA 2EHTA 2FVAA 2N50A 2LMLA 2KOQA 4H2YC 2JU2A 2KR5A 5KP6B 1AF8A 2FHSC 2MR7A 1KLPA 2L22A 2KGCA 2LIWA 4H2WC 1L0HA 2KGEA 2CGQA 1DV5A 3EJDA 5KP8B 4MRTC 2FAEA 2JGPA 4HKGA 2FQ2A 2X2BA 1OR5A 2KOPA 2FADA 4CA3A 2PNGA 1HY8A 2KW2A 2DNWA 5EJDA 4BPGA 2FQ1A 1X3OA 5HVCA 2XZ1C 2MVVA 3GZLA 4DG9A 2KGDA 2LKIA 2LTEA 2KOSA 2KG8A 2JU1A 1VKUA 2GDWA 2N5HA 1L0IA 2L9FA 2MVUA 4R0MA 2EHSA 2KWLA 1ACPA 2LPKA 2FACA 2XZ0D 2K2QA 2QNWA 2MF4A 2K93A 2AFEA 2KGAA 4IZ6A 2L4BA 3GZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQB A;  2N98 A;  4NEO A;  3EJB A;  2N6Y A;  2AVA A;  2N6Z A;  2FVE A;  2JQ4 A;  2MD9 A;  3CE7 A;  1NQ4 A;  2N5I A;  2K92 A;  2MR8 A;  1T8K A;  2AF8 A;  2KOO A;  2GDX A;  3EJE A;  3NY7 B;  2LL8 A;  2ROQ A;  2CQ8 A;  2KG9 A;  2L0Q A;  2FVF A;  1F80 D;  2K94 A;  2VSQ A;  5HV8 A;  2KG6 A;  4BPH A;  5CZD B;  2GDY A;  3RG2 A;  2CNR A;  4BPF A;  2MY5 A;  1DNY A;  4PXH B;  2K0X A;  5KP7 B;  2CG5 B;  2M5R A;  3LMO A;  4PWV B;  2FQ0 A;  2LIU A;  2AFD A;  2KOR A;  4H2X C;  2K0Y A;  2LOL A;  2EHT A;  2FVA A;  2N50 A;  2LML A;  2KOQ A;  4H2Y C;  2JU2 A;  2KR5 A;  5KP6 B;  1AF8 A;  2FHS C;  2MR7 A;  1KLP A;  2L22 A;  2KGC A;  2LIW A;  4H2W C;  1L0H A;  2KGE A;  2CGQ A;  1DV5 A;  3EJD A;  5KP8 B;  4MRT C;  2FAE A;  2JGP A;  4HKG A;  2FQ2 A;  2X2B A;  1OR5 A;  2KOP A;  2FAD A;  4CA3 A;  2PNG A;  1HY8 A;  2KW2 A;  2DNW A;  5EJD A;  4BPG A;  2FQ1 A;  1X3O A;  5HVC A;  2XZ1 C;  2MVV A;  3GZL A;  4DG9 A;  2KGD A;  2LKI A;  2LTE A;  2KOS A;  2KG8 A;  2JU1 A;  1VKU A;  2GDW A;  2N5H A;  1L0I A;  2L9F A;  2MVU A;  4R0M A;  2EHS A;  2KWL A;  1ACP A;  2LPK A;  2FAC A;  2XZ0 D;  2K2Q A;  2QNW A;  2MF4 A;  2K93 A;  2AFE A;  2KGA A;  4IZ6 A;  2L4B A;  3GZM A; 
#chains in the Genus database with same CATH topology
 2N98 A;  1S72 P;  3EJB A;  2N6Y A;  1M6E X;  1M6N A;  1VQ7 P;  3CE7 A;  3VRL C;  5HGN A;  1GXG A;  2AF8 A;  2KOO A;  3NY7 B;  2VLN A;  1YJ9 P;  1F80 D;  1Q82 Q;  4BPH A;  1VQ9 P;  3RG2 A;  4U0A A;  1YIJ P;  1DNY A;  1W2B O;  3LMO A;  1QRJ A;  4PWV B;  1D1D A;  2KOR A;  3U43 A;  2EIA A;  2EHT A;  2FVA A;  2OTJ P;  2KR5 A;  1AF8 A;  4QKO A;  1KLP A;  1L0H A;  2KGE A;  5HGM A;  2QEX P;  1Q81 Q;  2XT1 A;  2DGY A;  4MRT C;  1QVG O;  4GR6 A;  1GXH A;  1CEI A;  1YIT P;  2ERH A;  3CCU P;  2PEI A;  2FQ1 A;  1AYI A;  1VQP P;  2E1M A;  2XZ1 C;  3H4E A;  3G71 P;  2MVV A;  3GZL A;  3DS3 A;  2KGD A;  1VQ4 P;  1Z6M A;  3G1I A;  3GKL C;  2JU1 A;  2GZE A;  2GDW A;  4XFX A;  1UNK A;  1L0I A;  2EFJ A;  3G1G A;  2K5X A;  2MVU A;  2JB0 A;  2M8P A;  1M74 A;  2LPK A;  2MF4 A;  3CCM P;  2KGA A;  4IZ6 A;  1IMQ A;  1A43 A;  2PY8 A;  2JBG A;  1M90 Q;  1AUM A;  1RNI A;  2JYG A;  2N6Z A;  2LF4 A;  4XRO A;  2JQ4 A;  5BS1 A;  1YJN P;  2MD9 A;  2M8N A;  1NQ4 A;  1K9M Q;  3OW2 O;  5EW5 E;  2PEN A;  2MR8 A;  1T8K A;  1RO2 A;  3G26 A;  5I4T G;  4PH1 A;  4PH0 A;  2CQ8 A;  2XV6 A;  2FVF A;  2K94 A;  2VSQ A;  2Z45 A;  2BHV A;  1BAJ A;  3Q20 A;  1YJW P;  2GDY A;  2CNR A;  3CME P;  5DCK A;  2MY5 A;  2K0D X;  4IPY A;  4U0D A;  2K0Y A;  2ONT A;  4F37 A;  2KOQ A;  5KP6 B;  1QVF O;  2MR7 A;  3G29 A;  4XRQ A;  2OAR A;  2GZG A;  1A8O A;  2X2B A;  1OR5 A;  4CA3 A;  2BUO A;  3RG6 C;  1HY8 A;  2CWO A;  5EJD A;  1X3O A;  5BS2 A;  3H0D A;  1EIA A;  3CCL P;  4DG9 A;  2LKI A;  4U0C A;  1VKU A;  1EMV A;  3CCE P;  2JYL A;  4QNB A;  7CEI A;  2N5H A;  3M1M A;  2L9F A;  3CCQ P;  2EHS A;  3B5I A;  2FAC A;  1E6J P;  2GZJ A;  2GZI A;  2XXM A;  2QNW A;  3G4S P;  3DS2 A;  2GYK A;  4XFY A;  5F2N A;  3CCS P;  3DS5 A;  3GZM A;  1HQB A;  2QA4 P;  2FVE A;  3HYB A;  5HGL A;  1RO0 A;  2N5I A;  4WYM A;  1IUQ A;  4U0B A;  2PEJ A;  2KG9 A;  2L0Q A;  2JAZ A;  2KG6 A;  2Z44 A;  5CZD B;  3CC2 P;  1K73 Q;  4PXH B;  2K0X A;  5KP7 B;  2CG5 B;  2M5R A;  3DS4 A;  2LIU A;  2PEQ A;  2AFD A;  1MZ8 A;  4H2X C;  3G28 A;  2N50 A;  2LML A;  2M8L A;  2EG5 A;  4H2Y C;  5F2K A;  2LIW A;  4H2W C;  2NO8 A;  2CGQ A;  2VLO A;  1BXI A;  4GR2 A;  3CMA P;  3GJN A;  4HKG A;  2FQ2 A;  3CCJ P;  2KOP A;  3G0V A;  2KW2 A;  4BPG A;  3I55 P;  1VQN P;  3CPW O;  1IMP A;  1Q7Y Q;  2KG8 A;  5JPA A;  4XFZ A;  1VQO P;  1JJ2 O;  2VLP A;  1YHQ P;  1VQM P;  1UJZ A;  2XZ0 D;  3CD6 P;  4COP A;  2KOD A;  2K93 A;  2AFE A;  3WBH A;  1KC8 Q;  4NEO A;  4U0E A;  3DTJ A;  2AVA A;  1Q86 Q;  3CCV P;  1VHN A;  2K92 A;  2PEM A;  3DS0 A;  1ZNV A;  5F2O A;  3G6E P;  2GDX A;  1EOQ A;  3EJE A;  2LL8 A;  2ROQ A;  1K8A Q;  3P05 A;  4UHP B;  1VQ5 P;  5HV8 A;  3DS1 A;  3I56 P;  1N8R Q;  1KQS O;  3H47 A;  5HGO A;  2VLQ A;  4BPF A;  2Z46 A;  2L6E A;  1K30 A;  2FQ0 A;  3MGE A;  2LOL A;  1VQL P;  1GPJ A;  2JU2 A;  2FHS C;  4U0F A;  2GZF A;  1KD1 Q;  2L22 A;  2PEK A;  2KGC A;  4COC A;  1DV5 A;  3EJD A;  3NTE A;  5KP8 B;  2PEO A;  3CXC O;  3CC7 P;  2FAE A;  2P9X A;  2JGP A;  2WPT A;  2FAD A;  2PNG A;  3HZQ A;  2DNW A;  1VQ6 P;  3LRY A;  5HVC A;  3B4Q A;  2JO0 A;  1NJI Q;  3E2D A;  3CC4 P;  2LTE A;  2KOS A;  1YI2 P;  1VQK P;  3G21 A;  1M1K Q;  2OTL P;  4M0I A;  4R0M A;  1FR2 A;  2KWL A;  1ACP A;  1VQ8 P;  2K2Q A;  3DPH A;  1E0H A;  3CCR P;  1ZMB A;  2L4B A; 
#chains in the Genus database with same CATH homology
 1HQB A;  2N98 A;  4NEO A;  3EJB A;  2N6Y A;  2AVA A;  2N6Z A;  2FVE A;  2JQ4 A;  2MD9 A;  3CE7 A;  1NQ4 A;  2N5I A;  2K92 A;  2MR8 A;  1T8K A;  2AF8 A;  2KOO A;  2GDX A;  3EJE A;  3NY7 B;  2LL8 A;  2ROQ A;  2CQ8 A;  2KG9 A;  2L0Q A;  2FVF A;  1F80 D;  2K94 A;  2VSQ A;  5HV8 A;  2KG6 A;  4BPH A;  5CZD B;  2GDY A;  3RG2 A;  2CNR A;  4BPF A;  2MY5 A;  1DNY A;  4PXH B;  2K0X A;  5KP7 B;  2CG5 B;  2M5R A;  3LMO A;  4PWV B;  2FQ0 A;  2LIU A;  2AFD A;  2KOR A;  4H2X C;  2K0Y A;  2LOL A;  2EHT A;  2FVA A;  2N50 A;  2LML A;  2KOQ A;  4H2Y C;  2JU2 A;  2KR5 A;  5KP6 B;  1AF8 A;  2FHS C;  2MR7 A;  1KLP A;  2L22 A;  2KGC A;  2LIW A;  4H2W C;  1L0H A;  2KGE A;  2CGQ A;  1DV5 A;  3EJD A;  5KP8 B;  4MRT C;  2FAE A;  2JGP A;  4HKG A;  2FQ2 A;  2X2B A;  1OR5 A;  2KOP A;  2FAD A;  4CA3 A;  2PNG A;  1HY8 A;  2KW2 A;  2DNW A;  5EJD A;  4BPG A;  2FQ1 A;  1X3O A;  5HVC A;  2XZ1 C;  2MVV A;  3GZL A;  4DG9 A;  2KGD A;  2LKI A;  2LTE A;  2KOS A;  2KG8 A;  2JU1 A;  1VKU A;  2GDW A;  2N5H A;  1L0I A;  2L9F A;  2MVU A;  4R0M A;  2EHS A;  2KWL A;  1ACP A;  2LPK A;  2FAC A;  2XZ0 D;  2K2Q A;  2QNW A;  2MF4 A;  2K93 A;  2AFE A;  2KGA A;  4IZ6 A;  2L4B A;  3GZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...