1ACPA

Refinement of the nmr structures for acyl carrier protein with scalar coupling data
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-CARRIER PROTEIN
publication title Refinement of the NMR structures for acyl carrier protein with scalar coupling data.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Fatty acid synthesis protein
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1990-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1acpA00
2KG6A 5HV8A 2N5IA 4HKGA 2AVAA 2L22A 2KOSA 2X2BA 2FQ1A 2GDXA 2DNWA 2XZ0D 1DV5A 2QNWA 2MD9A 2LPKA 4BPGA 4IZ6A 2CG5B 2GDYA 4BPHA 2EHSA 5KP6B 2K2QA 2JU1A 3GZLA 2PNGA 5KP7B 2MY5A 1OR5A 2ROQA 1HY8A 2FVAA 2KWLA 2LKIA 2FQ0A 2LL8A 2MR8A 3EJBA 2GDWA 2FACA 2FVEA 2K93A 2N50A 3RG2A 2XZ1C 2JGPA 4PXHB 4R0MA 2K0XA 4PWVB 1L0HA 2KORA 2EHTA 2LIWA 2KGEA 5CZDB 2L4BA 1KLPA 2KOOA 2AFDA 2CNRA 1VKUA 2L0QA 3EJEA 2LMLA 3LMOA 4BPFA 3EJDA 2MR7A 2MVVA 4H2XC 2JU2A 2KW2A 5KP8B 2AFEA 4H2WC 4H2YC 2LIUA 2N6ZA 2K0YA 2KGCA 2N98A 3CE7A 3GZMA 2CGQA 3NY7B 1NQ4A 2MF4A 4DG9A 5HVCA 1T8KA 2FQ2A 2KOQA 4NEOA 2JQ4A 2KOPA 2KR5A 2KG9A 2KG8A 1X3OA 2FADA 2L9FA 2LTEA 2K92A 1L0IA 2VSQA 2FAEA 1HQBA 2K94A 2KGDA 4CA3A 4MRTC 1F80D 2LOLA 1AF8A 2FHSC 2M5RA 5EJDA 1DNYA 2KGAA 2N6YA 2AF8A 2N5HA 2CQ8A 2FVFA 1ACPA 2MVUA
chains in the Genus database with same CATH superfamily
3P05A 5HV8A 3CCEP 2X2BA 1GPJA 2FQ1A 1BAJA 2GDXA 2DNWA 2Z46A 1NJIQ 2OARA 4BPGA 3I55P 3CCRP 1E6JP 2EG5A 5KP6B 2K0DX 3B5IA 3LRYA 5KP7B 1OR5A 2FVAA 3CXCO 1K30A 2KWLA 4U0EA 2FQ0A 3CCSP 2MR8A 2FACA 2FVEA 3DS2A 1VQ7P 2BUOA 2XXMA 4U0CA 2P9XA 1YJWP 1UNKA 3CMEP 1VQ4P 1RNIA 1KLPA 2CNRA 5HGLA 2L0QA 2XT1A 2K5XA 5BS2A 1Q86Q 3EJDA 3CCLP 1YIJP 4H2XC 1QRJA 3G28A 2KW2A 1VQKP 4UHPB 5HGNA 3CE7A 3DS0A 5HVCA 4U0DA 1QVGO 1AYIA 1T8KA 2FQ2A 1E0HA 1IMQA 2KOPA 2KG9A 1EOQA 1EIAA 2L9FA 7CEIA 1F80D 2M5RA 1DNYA 2KGAA 2OTLP 3H47A 1N8RQ 2N5HA 2PEQA 2JAZA 1ACPA 2MVUA 2N5IA 3H0DA 2DGYA 2L22A 1IUQA 2XZ0D 2M8PA 2XV6A 2MD9A 4IZ6A 1RO0A 2CG5B 3CCMP 1MZ8A 1VQOP 2GZJA 2JYLA 3G0VA 1QVFO 4XFYA 2GDWA 3CCUP 3DS3A 2EIAA 3DS5A 1GXGA 4PWVB 2BHVA 1YJ9P 1M6EX 3G4SP 3G21A 2PY8A 2KGEA 3DS4A 1VQLP 3HYBA 2L4BA 2M8LA 2PENA 2AFDA 1VKUA 3EJEA 3CMAP 4IPYA 3B4QA 4BPFA 1Q81Q 1VQ9P 2VLPA 1Q7YQ 2OTJP 2JU2A 3CCVP 2AFEA 4GR6A 3CCQP 2KGCA 2N98A 3GZMA 2CGQA 2MF4A 3E2DA 5DCKA 4NEOA 2JQ4A 2VLOA 3DS1A 1CEIA 3WBHA 3H4EA 1D1DA 2GYKA 2JYGA 3VRLC 4MRTC 1M6NA 5EJDA 5HGMA 2AF8A 1YI2P 4M0IA 2KOSA 5HGOA 1JJ2O 3DPHA 2QNWA 2QEXP 2GDYA 2EHSA 4U0BA 2K2QA 4U0FA 2JU1A 4XRQA 3GZLA 2PNGA 2LKIA 2LL8A 3CC7P 3GJNA 3EJBA 3CD6P 2M8NA 2WPTA 3G1IA 1GXHA 1VQMP 3DTJA 2GZFA 1FR2A 1ZMBA 3CPWO 1IMPA 1EMVA 1S72P 4GR2A 2EHTA 2JB0A 3I56P 4QNBA 3OW2O 4PH1A 2LMLA 3LMOA 4WYMA 3CC2P 2MVVA 4COPA 2Z45A 2PEJA 5KP8B 2LIUA 2N6ZA 1AUMA 4U0AA 2KOQA 1VQPP 2PEOA 2KR5A 1YJNP 2VLNA 2KG8A 2K92A 1A8OA 3HZQA 2FAEA 1BXIA 1HQBA 2K94A 4QKOA 2GZIA 2KGDA 5EW5E 3U43A 3G29A 2VLQA 3NTEA 4XFXA 1RO2A 1K73Q 2KG6A 4HKGA 2AVAA 2ERHA 1YITP 3MGEA 2PEIA 1DV5A 1VQ8P 2LPKA 1M74A 4BPHA 2JO0A 1M1KQ 1A43A 5JPAA 1K9MQ 3RG6C 2PEKA 2MY5A 2ROQA 1HY8A 2CWOA 2K93A 2N50A 3RG2A 4F37A 2XZ1C 2JGPA 4PXHB 5F2KA 2KODA 2K0XA 4R0MA 1L0HA 5BS1A 3M1MA 2KORA 1VQ6P 4XROA 2L6EA 2LIWA 5CZDB 1VHNA 2KOOA 1Q82Q 1UJZA 1K8AQ 3CC4P 1Z6MA 3G71P 2QA4P 1VQNP 1KQSO 1W2BO 1ZNVA 2MR7A 2EFJA 2Z44A 4H2WC 2PEMA 4H2YC 2K0YA 3NY7B 1M90Q 1NQ4A 1KD1Q 4DG9A 3G6EP 3G1GA 1YHQP 3Q20A 1KC8Q 4XFZA 2E1MA 1X3OA 2FADA 2LTEA 1L0IA 2VSQA 2ONTA 4CA3A 2LOLA 1AF8A 2FHSC 2GZGA 2LF4A 3CCJP 4PH0A 2GZEA 5I4TG 2N6YA 2NO8A 4COCA 3G26A 5F2OA 3GKLC 2CQ8A 2FVFA 5F2NA 2JBGA 1VQ5P
chains in the Genus database with same CATH topology
2KG6A 5HV8A 2N5IA 4HKGA 2AVAA 2L22A 2KOSA 2X2BA 2FQ1A 2GDXA 2DNWA 2XZ0D 1DV5A 2QNWA 2MD9A 2LPKA 4BPGA 4IZ6A 2CG5B 2GDYA 4BPHA 2EHSA 5KP6B 2K2QA 2JU1A 3GZLA 2PNGA 5KP7B 2MY5A 1OR5A 2ROQA 1HY8A 2FVAA 2KWLA 2LKIA 2FQ0A 2LL8A 2MR8A 3EJBA 2GDWA 2FACA 2FVEA 2K93A 2N50A 3RG2A 2XZ1C 2JGPA 4PXHB 4R0MA 2K0XA 4PWVB 1L0HA 2KORA 2EHTA 2LIWA 2KGEA 5CZDB 2L4BA 1KLPA 2KOOA 2AFDA 2CNRA 1VKUA 2L0QA 3EJEA 2LMLA 3LMOA 4BPFA 3EJDA 2MR7A 2MVVA 4H2XC 2JU2A 2KW2A 5KP8B 2AFEA 4H2WC 4H2YC 2LIUA 2N6ZA 2K0YA 2KGCA 2N98A 3CE7A 3GZMA 2CGQA 3NY7B 1NQ4A 2MF4A 4DG9A 5HVCA 1T8KA 2FQ2A 2KOQA 4NEOA 2JQ4A 2KOPA 2KR5A 2KG9A 2KG8A 1X3OA 2FADA 2L9FA 2LTEA 2K92A 1L0IA 2VSQA 2FAEA 1HQBA 2K94A 2KGDA 4CA3A 4MRTC 1F80D 2LOLA 1AF8A 2FHSC 2M5RA 5EJDA 1DNYA 2KGAA 2N6YA 2AF8A 2N5HA 2CQ8A 2FVFA 1ACPA 2MVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG6 A;  5HV8 A;  2N5I A;  4HKG A;  2AVA A;  2L22 A;  2KOS A;  2X2B A;  2FQ1 A;  2GDX A;  2DNW A;  2XZ0 D;  1DV5 A;  2QNW A;  2MD9 A;  2LPK A;  4BPG A;  4IZ6 A;  2CG5 B;  2GDY A;  4BPH A;  2EHS A;  5KP6 B;  2K2Q A;  2JU1 A;  3GZL A;  2PNG A;  5KP7 B;  2MY5 A;  1OR5 A;  2ROQ A;  1HY8 A;  2FVA A;  2KWL A;  2LKI A;  2FQ0 A;  2LL8 A;  2MR8 A;  3EJB A;  2GDW A;  2FAC A;  2FVE A;  2K93 A;  2N50 A;  3RG2 A;  2XZ1 C;  2JGP A;  4PXH B;  4R0M A;  2K0X A;  4PWV B;  1L0H A;  2KOR A;  2EHT A;  2LIW A;  2KGE A;  5CZD B;  2L4B A;  1KLP A;  2KOO A;  2AFD A;  2CNR A;  1VKU A;  2L0Q A;  3EJE A;  2LML A;  3LMO A;  4BPF A;  3EJD A;  2MR7 A;  2MVV A;  4H2X C;  2JU2 A;  2KW2 A;  5KP8 B;  2AFE A;  4H2W C;  4H2Y C;  2LIU A;  2N6Z A;  2K0Y A;  2KGC A;  2N98 A;  3CE7 A;  3GZM A;  2CGQ A;  3NY7 B;  1NQ4 A;  2MF4 A;  4DG9 A;  5HVC A;  1T8K A;  2FQ2 A;  2KOQ A;  4NEO A;  2JQ4 A;  2KOP A;  2KR5 A;  2KG9 A;  2KG8 A;  1X3O A;  2FAD A;  2L9F A;  2LTE A;  2K92 A;  1L0I A;  2VSQ A;  2FAE A;  1HQB A;  2K94 A;  2KGD A;  4CA3 A;  4MRT C;  1F80 D;  2LOL A;  1AF8 A;  2FHS C;  2M5R A;  5EJD A;  1DNY A;  2KGA A;  2N6Y A;  2AF8 A;  2N5H A;  2CQ8 A;  2FVF A;  1ACP A;  2MVU A; 
#chains in the Genus database with same CATH topology
 3P05 A;  5HV8 A;  3CCE P;  2X2B A;  1GPJ A;  2FQ1 A;  1BAJ A;  2GDX A;  2DNW A;  2Z46 A;  1NJI Q;  2OAR A;  4BPG A;  3I55 P;  3CCR P;  1E6J P;  2EG5 A;  5KP6 B;  2K0D X;  3B5I A;  3LRY A;  5KP7 B;  1OR5 A;  2FVA A;  3CXC O;  1K30 A;  2KWL A;  4U0E A;  2FQ0 A;  3CCS P;  2MR8 A;  2FAC A;  2FVE A;  3DS2 A;  1VQ7 P;  2BUO A;  2XXM A;  4U0C A;  2P9X A;  1YJW P;  1UNK A;  3CME P;  1VQ4 P;  1RNI A;  1KLP A;  2CNR A;  5HGL A;  2L0Q A;  2XT1 A;  2K5X A;  5BS2 A;  1Q86 Q;  3EJD A;  3CCL P;  1YIJ P;  4H2X C;  1QRJ A;  3G28 A;  2KW2 A;  1VQK P;  4UHP B;  5HGN A;  3CE7 A;  3DS0 A;  5HVC A;  4U0D A;  1QVG O;  1AYI A;  1T8K A;  2FQ2 A;  1E0H A;  1IMQ A;  2KOP A;  2KG9 A;  1EOQ A;  1EIA A;  2L9F A;  7CEI A;  1F80 D;  2M5R A;  1DNY A;  2KGA A;  2OTL P;  3H47 A;  1N8R Q;  2N5H A;  2PEQ A;  2JAZ A;  1ACP A;  2MVU A;  2N5I A;  3H0D A;  2DGY A;  2L22 A;  1IUQ A;  2XZ0 D;  2M8P A;  2XV6 A;  2MD9 A;  4IZ6 A;  1RO0 A;  2CG5 B;  3CCM P;  1MZ8 A;  1VQO P;  2GZJ A;  2JYL A;  3G0V A;  1QVF O;  4XFY A;  2GDW A;  3CCU P;  3DS3 A;  2EIA A;  3DS5 A;  1GXG A;  4PWV B;  2BHV A;  1YJ9 P;  1M6E X;  3G4S P;  3G21 A;  2PY8 A;  2KGE A;  3DS4 A;  1VQL P;  3HYB A;  2L4B A;  2M8L A;  2PEN A;  2AFD A;  1VKU A;  3EJE A;  3CMA P;  4IPY A;  3B4Q A;  4BPF A;  1Q81 Q;  1VQ9 P;  2VLP A;  1Q7Y Q;  2OTJ P;  2JU2 A;  3CCV P;  2AFE A;  4GR6 A;  3CCQ P;  2KGC A;  2N98 A;  3GZM A;  2CGQ A;  2MF4 A;  3E2D A;  5DCK A;  4NEO A;  2JQ4 A;  2VLO A;  3DS1 A;  1CEI A;  3WBH A;  3H4E A;  1D1D A;  2GYK A;  2JYG A;  3VRL C;  4MRT C;  1M6N A;  5EJD A;  5HGM A;  2AF8 A;  1YI2 P;  4M0I A;  2KOS A;  5HGO A;  1JJ2 O;  3DPH A;  2QNW A;  2QEX P;  2GDY A;  2EHS A;  4U0B A;  2K2Q A;  4U0F A;  2JU1 A;  4XRQ A;  3GZL A;  2PNG A;  2LKI A;  2LL8 A;  3CC7 P;  3GJN A;  3EJB A;  3CD6 P;  2M8N A;  2WPT A;  3G1I A;  1GXH A;  1VQM P;  3DTJ A;  2GZF A;  1FR2 A;  1ZMB A;  3CPW O;  1IMP A;  1EMV A;  1S72 P;  4GR2 A;  2EHT A;  2JB0 A;  3I56 P;  4QNB A;  3OW2 O;  4PH1 A;  2LML A;  3LMO A;  4WYM A;  3CC2 P;  2MVV A;  4COP A;  2Z45 A;  2PEJ A;  5KP8 B;  2LIU A;  2N6Z A;  1AUM A;  4U0A A;  2KOQ A;  1VQP P;  2PEO A;  2KR5 A;  1YJN P;  2VLN A;  2KG8 A;  2K92 A;  1A8O A;  3HZQ A;  2FAE A;  1BXI A;  1HQB A;  2K94 A;  4QKO A;  2GZI A;  2KGD A;  5EW5 E;  3U43 A;  3G29 A;  2VLQ A;  3NTE A;  4XFX A;  1RO2 A;  1K73 Q;  2KG6 A;  4HKG A;  2AVA A;  2ERH A;  1YIT P;  3MGE A;  2PEI A;  1DV5 A;  1VQ8 P;  2LPK A;  1M74 A;  4BPH A;  2JO0 A;  1M1K Q;  1A43 A;  5JPA A;  1K9M Q;  3RG6 C;  2PEK A;  2MY5 A;  2ROQ A;  1HY8 A;  2CWO A;  2K93 A;  2N50 A;  3RG2 A;  4F37 A;  2XZ1 C;  2JGP A;  4PXH B;  5F2K A;  2KOD A;  2K0X A;  4R0M A;  1L0H A;  5BS1 A;  3M1M A;  2KOR A;  1VQ6 P;  4XRO A;  2L6E A;  2LIW A;  5CZD B;  1VHN A;  2KOO A;  1Q82 Q;  1UJZ A;  1K8A Q;  3CC4 P;  1Z6M A;  3G71 P;  2QA4 P;  1VQN P;  1KQS O;  1W2B O;  1ZNV A;  2MR7 A;  2EFJ A;  2Z44 A;  4H2W C;  2PEM A;  4H2Y C;  2K0Y A;  3NY7 B;  1M90 Q;  1NQ4 A;  1KD1 Q;  4DG9 A;  3G6E P;  3G1G A;  1YHQ P;  3Q20 A;  1KC8 Q;  4XFZ A;  2E1M A;  1X3O A;  2FAD A;  2LTE A;  1L0I A;  2VSQ A;  2ONT A;  4CA3 A;  2LOL A;  1AF8 A;  2FHS C;  2GZG A;  2LF4 A;  3CCJ P;  4PH0 A;  2GZE A;  5I4T G;  2N6Y A;  2NO8 A;  4COC A;  3G26 A;  5F2O A;  3GKL C;  2CQ8 A;  2FVF A;  5F2N A;  2JBG A;  1VQ5 P; 
#chains in the Genus database with same CATH homology
 2KG6 A;  5HV8 A;  2N5I A;  4HKG A;  2AVA A;  2L22 A;  2KOS A;  2X2B A;  2FQ1 A;  2GDX A;  2DNW A;  2XZ0 D;  1DV5 A;  2QNW A;  2MD9 A;  2LPK A;  4BPG A;  4IZ6 A;  2CG5 B;  2GDY A;  4BPH A;  2EHS A;  5KP6 B;  2K2Q A;  2JU1 A;  3GZL A;  2PNG A;  5KP7 B;  2MY5 A;  1OR5 A;  2ROQ A;  1HY8 A;  2FVA A;  2KWL A;  2LKI A;  2FQ0 A;  2LL8 A;  2MR8 A;  3EJB A;  2GDW A;  2FAC A;  2FVE A;  2K93 A;  2N50 A;  3RG2 A;  2XZ1 C;  2JGP A;  4PXH B;  4R0M A;  2K0X A;  4PWV B;  1L0H A;  2KOR A;  2EHT A;  2LIW A;  2KGE A;  5CZD B;  2L4B A;  1KLP A;  2KOO A;  2AFD A;  2CNR A;  1VKU A;  2L0Q A;  3EJE A;  2LML A;  3LMO A;  4BPF A;  3EJD A;  2MR7 A;  2MVV A;  4H2X C;  2JU2 A;  2KW2 A;  5KP8 B;  2AFE A;  4H2W C;  4H2Y C;  2LIU A;  2N6Z A;  2K0Y A;  2KGC A;  2N98 A;  3CE7 A;  3GZM A;  2CGQ A;  3NY7 B;  1NQ4 A;  2MF4 A;  4DG9 A;  5HVC A;  1T8K A;  2FQ2 A;  2KOQ A;  4NEO A;  2JQ4 A;  2KOP A;  2KR5 A;  2KG9 A;  2KG8 A;  1X3O A;  2FAD A;  2L9F A;  2LTE A;  2K92 A;  1L0I A;  2VSQ A;  2FAE A;  1HQB A;  2K94 A;  2KGD A;  4CA3 A;  4MRT C;  1F80 D;  2LOL A;  1AF8 A;  2FHS C;  2M5R A;  5EJD A;  1DNY A;  2KGA A;  2N6Y A;  2AF8 A;  2N5H A;  2CQ8 A;  2FVF A;  1ACP A;  2MVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...