1ACPA

Refinement of the nmr structures for acyl carrier protein with scalar coupling data
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refinement of the NMR structures for acyl carrier protein with scalar coupling data.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Fatty acid synthesis protein
molecule keywords ACYL-CARRIER PROTEIN
total genus 16
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1990-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1acpA00
2FADA 3EJBA 2JU1A 3LMOA 5CZDB 2KGEA 2KGDA 4PWVB 2KG9A 4DG9A 2CG5B 2KG6A 2KOPA 2FQ1A 1ACPA 2L9FA 1DV5A 2N5IA 2GDWA 2VSQA 2JGPA 2LMLA 2MVUA 2N98A 5HV8A 5HVCA 2DNWA 2N6YA 3EJEA 5EJDA 2FACA 2AFDA 2K93A 2MF4A 2KGAA 2GDXA 2FVAA 1F80D 1DNYA 5KP6B 1AF8A 4MRTC 2ROQA 2CNRA 2LTEA 2KW2A 1L0IA 2KWLA 1HY8A 1L0HA 2L4BA 4R0MA 1OR5A 1HQBA 2MVVA 2LOLA 5KP7B 2MY5A 2CQ8A 2LIWA 2QNWA 2K2QA 2K0YA 2LL8A 4H2YC 1KLPA 2LIUA 1VKUA 2AF8A 2K0XA 2FVEA 4PXHB 1NQ4A 2FAEA 2K94A 2X2BA 3GZLA 2PNGA 2N50A 2FQ2A 2AVAA 2N6ZA 2LPKA 1X3OA 2KR5A 2JU2A 5KP8B 3CE7A 2EHTA 2M5RA 2MR7A 2KORA 4NEOA 2JQ4A 1T8KA 2GDYA 2FQ0A 4BPHA 4CA3A 4IZ6A 3GZMA 2KGCA 2XZ1C 3NY7B 4BPFA 2AFEA 4H2XC 2XZ0D 4BPGA 2N5HA 2EHSA 2L22A 2L0QA 2FHSC 3EJDA 2KG8A 4H2WC 2MR8A 2K92A 2LKIA 2KOOA 2KOQA 2MD9A 2CGQA 2KOSA 2FVFA 3RG2A 4HKGA
chains in the Genus database with same CATH superfamily
4GR6A 2JU1A 5CZDB 2KGEA 3DS5A 3G1IA 3H4EA 3CC2P 1Q81Q 2CG5B 3G71P 1ACPA 1EIAA 1AYIA 1VQLP 1UNKA 4XFXA 5HV8A 5HVCA 2OTLP 5EJDA 3G29A 2AFDA 5BS1A 3H0DA 1Q82Q 2ERHA 2FVAA 1M90Q 3CC7P 5DCKA 1DNYA 1VQPP 1A43A 2M8PA 2ROQA 1JJ2O 5F2NA 2CNRA 1YIJP 1KD1Q 2M8NA 1L0HA 2L4BA 1VQ7P 1HQBA 2LOLA 3CCRP 2L6EA 2E1MA 3DS2A 2PY8A 1E0HA 2P9XA 2LIUA 1UJZA 2FVEA 1NQ4A 4QNBA 2FQ2A 2AVAA 2PEQA 3NTEA 1VQOP 4U0EA 1M6NA 2PENA 2KR5A 1S72P 3G1GA 3Q20A 2VLPA 3I55P 2GZIA 4WYMA 2PEMA 3CE7A 2EHTA 2M5RA 2JQ4A 1VHNA 2FQ0A 2GZGA 4BPHA 3B4QA 1GXGA 2QEXP 3GZMA 2KGCA 2XZ1C 3DS0A 4BPFA 2DGYA 2GZFA 1A8OA 2EHSA 2L22A 4PH0A 1BXIA 2PEKA 2L0QA 2Z45A 1ZMBA 3CCLP 3M1MA 1EOQA 1VQ9P 2KOQA 2MD9A 1VQ8P 1IUQA 2VLQA 1YJNP 1VQ5P 4M0IA 5HGNA 2KG6A 2FQ1A 2N5IA 2VSQA 2N6YA 3GJNA 2VLNA 4U0BA 2CWOA 2JAZA 2GDXA 1IMPA 2JYGA 3DS3A 1VQKP 1L0IA 3DPHA 4R0MA 1VQ4P 2MY5A 4COPA 1VKUA 2K0XA 4PXHB 2FAEA 3GZLA 1X3OA 4U0FA 2EFJA 4QKOA 5KP8B 1K30A 5EW5E 5HGMA 2MR7A 1M1KQ 1T8KA 3CXCO 2GDYA 3CCUP 1N8RQ 4UHPB 1CEIA 4IZ6A 2NO8A 3G6EP 2GZEA 3G0VA 3NY7B 2VLOA 2XZ0D 5F2KA 3HZQA 7CEIA 4XFZA 3EJDA 2KG8A 1Q7YQ 4H2WC 3CCMP 1VQNP 4U0AA 2QA4P 2CGQA 2KOSA 1W2BO 2BUOA 3RG2A 5F2OA 2FADA 1ZNVA 3CCQP 2KG9A 2PEOA 2KOPA 2GDWA 3GKLC 2JGPA 1D1DA 2DNWA 3EJEA 3CCJP 2OTJP 4U0DA 2M8LA 2K0DX 1RNIA 1YHQP 1YI2P 2LF4A 3G21A 1F80D 5KP6B 4GR2A 5HGOA 2LTEA 1BAJA 2JO0A 2KWLA 2JB0A 5BS2A 1OR5A 2Z44A 1KQSO 2MVVA 3OW2O 4F37A 2EG5A 3G28A 1NJIQ 4XRQA 2LIWA 1Z6MA 2K0YA 2Z46A 1IMQA 2LL8A 4H2YC 4COCA 2PNGA 2N6ZA 3CMEP 2LPKA 1VQMP 2EIAA 2JU2A 1GXHA 5JPAA 2KORA 3CD6P 2GZJA 3DTJA 4CA3A 3U43A 2AFEA 3LRYA 4H2XC 2N5HA 1VQ6P 4U0CA 2OARA 1QVFO 1RO0A 1YITP 2WPTA 3E2DA 2FHSC 2MR8A 2K92A 1YJWP 2LKIA 1KC8Q 4XROA 1QRJA 2XXMA 4HKGA 3EJBA 3WBHA 3LMOA 3RG6C 3DS1A 2KGDA 4PWVB 3CC4P 4DG9A 2L9FA 1DV5A 2LMLA 2MVUA 2N98A 1MZ8A 2JYLA 2FACA 4XFYA 1FR2A 2K93A 3VRLC 2MF4A 2KGAA 2GYKA 3CCEP 3MGEA 1AF8A 2JBGA 1M6EX 4MRTC 3DS4A 1K73Q 2PEIA 3CCSP 2K5XA 2KODA 2KW2A 2BHVA 3I56P 1E6JP 1HY8A 2ONTA 1M74A 3P05A 5KP7B 2CQ8A 2QNWA 2PEJA 2K2QA 1KLPA 2AF8A 2K94A 2X2BA 1Q86Q 2N50A 3B5IA 1AUMA 1EMVA 4NEOA 3G26A 1RO2A 3G4SP 3H47A 4IPYA 1GPJA 3CPWO 1K8AQ 4BPGA 5I4TG 3HYBA 2XV6A 1YJ9P 2XT1A 3CMAP 1QVGO 2KOOA 4PH1A 3CCVP 5HGLA 1K9MQ 2FVFA
chains in the Genus database with same CATH topology
2FADA 3EJBA 2JU1A 3LMOA 5CZDB 2KGEA 2KGDA 4PWVB 2KG9A 4DG9A 2CG5B 2KG6A 2KOPA 2FQ1A 1ACPA 2L9FA 1DV5A 2N5IA 2GDWA 2VSQA 2JGPA 2LMLA 2MVUA 2N98A 5HV8A 5HVCA 2DNWA 2N6YA 3EJEA 5EJDA 2FACA 2AFDA 2K93A 2MF4A 2KGAA 2GDXA 2FVAA 1F80D 1DNYA 5KP6B 1AF8A 4MRTC 2ROQA 2CNRA 2LTEA 2KW2A 1L0IA 2KWLA 1HY8A 1L0HA 2L4BA 4R0MA 1OR5A 1HQBA 2MVVA 2LOLA 5KP7B 2MY5A 2CQ8A 2LIWA 2QNWA 2K2QA 2K0YA 2LL8A 4H2YC 1KLPA 2LIUA 1VKUA 2AF8A 2K0XA 2FVEA 4PXHB 1NQ4A 2FAEA 2K94A 2X2BA 3GZLA 2PNGA 2N50A 2FQ2A 2AVAA 2N6ZA 2LPKA 1X3OA 2KR5A 2JU2A 5KP8B 3CE7A 2EHTA 2M5RA 2MR7A 2KORA 4NEOA 2JQ4A 1T8KA 2GDYA 2FQ0A 4BPHA 4CA3A 4IZ6A 3GZMA 2KGCA 2XZ1C 3NY7B 4BPFA 2AFEA 4H2XC 2XZ0D 4BPGA 2N5HA 2EHSA 2L22A 2L0QA 2FHSC 3EJDA 2KG8A 4H2WC 2MR8A 2K92A 2LKIA 2KOOA 2KOQA 2MD9A 2CGQA 2KOSA 2FVFA 3RG2A 4HKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAD A;  3EJB A;  2JU1 A;  3LMO A;  5CZD B;  2KGE A;  2KGD A;  4PWV B;  2KG9 A;  4DG9 A;  2CG5 B;  2KG6 A;  2KOP A;  2FQ1 A;  1ACP A;  2L9F A;  1DV5 A;  2N5I A;  2GDW A;  2VSQ A;  2JGP A;  2LML A;  2MVU A;  2N98 A;  5HV8 A;  5HVC A;  2DNW A;  2N6Y A;  3EJE A;  5EJD A;  2FAC A;  2AFD A;  2K93 A;  2MF4 A;  2KGA A;  2GDX A;  2FVA A;  1F80 D;  1DNY A;  5KP6 B;  1AF8 A;  4MRT C;  2ROQ A;  2CNR A;  2LTE A;  2KW2 A;  1L0I A;  2KWL A;  1HY8 A;  1L0H A;  2L4B A;  4R0M A;  1OR5 A;  1HQB A;  2MVV A;  2LOL A;  5KP7 B;  2MY5 A;  2CQ8 A;  2LIW A;  2QNW A;  2K2Q A;  2K0Y A;  2LL8 A;  4H2Y C;  1KLP A;  2LIU A;  1VKU A;  2AF8 A;  2K0X A;  2FVE A;  4PXH B;  1NQ4 A;  2FAE A;  2K94 A;  2X2B A;  3GZL A;  2PNG A;  2N50 A;  2FQ2 A;  2AVA A;  2N6Z A;  2LPK A;  1X3O A;  2KR5 A;  2JU2 A;  5KP8 B;  3CE7 A;  2EHT A;  2M5R A;  2MR7 A;  2KOR A;  4NEO A;  2JQ4 A;  1T8K A;  2GDY A;  2FQ0 A;  4BPH A;  4CA3 A;  4IZ6 A;  3GZM A;  2KGC A;  2XZ1 C;  3NY7 B;  4BPF A;  2AFE A;  4H2X C;  2XZ0 D;  4BPG A;  2N5H A;  2EHS A;  2L22 A;  2L0Q A;  2FHS C;  3EJD A;  2KG8 A;  4H2W C;  2MR8 A;  2K92 A;  2LKI A;  2KOO A;  2KOQ A;  2MD9 A;  2CGQ A;  2KOS A;  2FVF A;  3RG2 A;  4HKG A; 
#chains in the Genus database with same CATH topology
 4GR6 A;  2JU1 A;  5CZD B;  2KGE A;  3DS5 A;  3G1I A;  3H4E A;  3CC2 P;  1Q81 Q;  2CG5 B;  3G71 P;  1ACP A;  1EIA A;  1AYI A;  1VQL P;  1UNK A;  4XFX A;  5HV8 A;  5HVC A;  2OTL P;  5EJD A;  3G29 A;  2AFD A;  5BS1 A;  3H0D A;  1Q82 Q;  2ERH A;  2FVA A;  1M90 Q;  3CC7 P;  5DCK A;  1DNY A;  1VQP P;  1A43 A;  2M8P A;  2ROQ A;  1JJ2 O;  5F2N A;  2CNR A;  1YIJ P;  1KD1 Q;  2M8N A;  1L0H A;  2L4B A;  1VQ7 P;  1HQB A;  2LOL A;  3CCR P;  2L6E A;  2E1M A;  3DS2 A;  2PY8 A;  1E0H A;  2P9X A;  2LIU A;  1UJZ A;  2FVE A;  1NQ4 A;  4QNB A;  2FQ2 A;  2AVA A;  2PEQ A;  3NTE A;  1VQO P;  4U0E A;  1M6N A;  2PEN A;  2KR5 A;  1S72 P;  3G1G A;  3Q20 A;  2VLP A;  3I55 P;  2GZI A;  4WYM A;  2PEM A;  3CE7 A;  2EHT A;  2M5R A;  2JQ4 A;  1VHN A;  2FQ0 A;  2GZG A;  4BPH A;  3B4Q A;  1GXG A;  2QEX P;  3GZM A;  2KGC A;  2XZ1 C;  3DS0 A;  4BPF A;  2DGY A;  2GZF A;  1A8O A;  2EHS A;  2L22 A;  4PH0 A;  1BXI A;  2PEK A;  2L0Q A;  2Z45 A;  1ZMB A;  3CCL P;  3M1M A;  1EOQ A;  1VQ9 P;  2KOQ A;  2MD9 A;  1VQ8 P;  1IUQ A;  2VLQ A;  1YJN P;  1VQ5 P;  4M0I A;  5HGN A;  2KG6 A;  2FQ1 A;  2N5I A;  2VSQ A;  2N6Y A;  3GJN A;  2VLN A;  4U0B A;  2CWO A;  2JAZ A;  2GDX A;  1IMP A;  2JYG A;  3DS3 A;  1VQK P;  1L0I A;  3DPH A;  4R0M A;  1VQ4 P;  2MY5 A;  4COP A;  1VKU A;  2K0X A;  4PXH B;  2FAE A;  3GZL A;  1X3O A;  4U0F A;  2EFJ A;  4QKO A;  5KP8 B;  1K30 A;  5EW5 E;  5HGM A;  2MR7 A;  1M1K Q;  1T8K A;  3CXC O;  2GDY A;  3CCU P;  1N8R Q;  4UHP B;  1CEI A;  4IZ6 A;  2NO8 A;  3G6E P;  2GZE A;  3G0V A;  3NY7 B;  2VLO A;  2XZ0 D;  5F2K A;  3HZQ A;  7CEI A;  4XFZ A;  3EJD A;  2KG8 A;  1Q7Y Q;  4H2W C;  3CCM P;  1VQN P;  4U0A A;  2QA4 P;  2CGQ A;  2KOS A;  1W2B O;  2BUO A;  3RG2 A;  5F2O A;  2FAD A;  1ZNV A;  3CCQ P;  2KG9 A;  2PEO A;  2KOP A;  2GDW A;  3GKL C;  2JGP A;  1D1D A;  2DNW A;  3EJE A;  3CCJ P;  2OTJ P;  4U0D A;  2M8L A;  2K0D X;  1RNI A;  1YHQ P;  1YI2 P;  2LF4 A;  3G21 A;  1F80 D;  5KP6 B;  4GR2 A;  5HGO A;  2LTE A;  1BAJ A;  2JO0 A;  2KWL A;  2JB0 A;  5BS2 A;  1OR5 A;  2Z44 A;  1KQS O;  2MVV A;  3OW2 O;  4F37 A;  2EG5 A;  3G28 A;  1NJI Q;  4XRQ A;  2LIW A;  1Z6M A;  2K0Y A;  2Z46 A;  1IMQ A;  2LL8 A;  4H2Y C;  4COC A;  2PNG A;  2N6Z A;  3CME P;  2LPK A;  1VQM P;  2EIA A;  2JU2 A;  1GXH A;  5JPA A;  2KOR A;  3CD6 P;  2GZJ A;  3DTJ A;  4CA3 A;  3U43 A;  2AFE A;  3LRY A;  4H2X C;  2N5H A;  1VQ6 P;  4U0C A;  2OAR A;  1QVF O;  1RO0 A;  1YIT P;  2WPT A;  3E2D A;  2FHS C;  2MR8 A;  2K92 A;  1YJW P;  2LKI A;  1KC8 Q;  4XRO A;  1QRJ A;  2XXM A;  4HKG A;  3EJB A;  3WBH A;  3LMO A;  3RG6 C;  3DS1 A;  2KGD A;  4PWV B;  3CC4 P;  4DG9 A;  2L9F A;  1DV5 A;  2LML A;  2MVU A;  2N98 A;  1MZ8 A;  2JYL A;  2FAC A;  4XFY A;  1FR2 A;  2K93 A;  3VRL C;  2MF4 A;  2KGA A;  2GYK A;  3CCE P;  3MGE A;  1AF8 A;  2JBG A;  1M6E X;  4MRT C;  3DS4 A;  1K73 Q;  2PEI A;  3CCS P;  2K5X A;  2KOD A;  2KW2 A;  2BHV A;  3I56 P;  1E6J P;  1HY8 A;  2ONT A;  1M74 A;  3P05 A;  5KP7 B;  2CQ8 A;  2QNW A;  2PEJ A;  2K2Q A;  1KLP A;  2AF8 A;  2K94 A;  2X2B A;  1Q86 Q;  2N50 A;  3B5I A;  1AUM A;  1EMV A;  4NEO A;  3G26 A;  1RO2 A;  3G4S P;  3H47 A;  4IPY A;  1GPJ A;  3CPW O;  1K8A Q;  4BPG A;  5I4T G;  3HYB A;  2XV6 A;  1YJ9 P;  2XT1 A;  3CMA P;  1QVG O;  2KOO A;  4PH1 A;  3CCV P;  5HGL A;  1K9M Q;  2FVF A; 
#chains in the Genus database with same CATH homology
 2FAD A;  3EJB A;  2JU1 A;  3LMO A;  5CZD B;  2KGE A;  2KGD A;  4PWV B;  2KG9 A;  4DG9 A;  2CG5 B;  2KG6 A;  2KOP A;  2FQ1 A;  1ACP A;  2L9F A;  1DV5 A;  2N5I A;  2GDW A;  2VSQ A;  2JGP A;  2LML A;  2MVU A;  2N98 A;  5HV8 A;  5HVC A;  2DNW A;  2N6Y A;  3EJE A;  5EJD A;  2FAC A;  2AFD A;  2K93 A;  2MF4 A;  2KGA A;  2GDX A;  2FVA A;  1F80 D;  1DNY A;  5KP6 B;  1AF8 A;  4MRT C;  2ROQ A;  2CNR A;  2LTE A;  2KW2 A;  1L0I A;  2KWL A;  1HY8 A;  1L0H A;  2L4B A;  4R0M A;  1OR5 A;  1HQB A;  2MVV A;  2LOL A;  5KP7 B;  2MY5 A;  2CQ8 A;  2LIW A;  2QNW A;  2K2Q A;  2K0Y A;  2LL8 A;  4H2Y C;  1KLP A;  2LIU A;  1VKU A;  2AF8 A;  2K0X A;  2FVE A;  4PXH B;  1NQ4 A;  2FAE A;  2K94 A;  2X2B A;  3GZL A;  2PNG A;  2N50 A;  2FQ2 A;  2AVA A;  2N6Z A;  2LPK A;  1X3O A;  2KR5 A;  2JU2 A;  5KP8 B;  3CE7 A;  2EHT A;  2M5R A;  2MR7 A;  2KOR A;  4NEO A;  2JQ4 A;  1T8K A;  2GDY A;  2FQ0 A;  4BPH A;  4CA3 A;  4IZ6 A;  3GZM A;  2KGC A;  2XZ1 C;  3NY7 B;  4BPF A;  2AFE A;  4H2X C;  2XZ0 D;  4BPG A;  2N5H A;  2EHS A;  2L22 A;  2L0Q A;  2FHS C;  3EJD A;  2KG8 A;  4H2W C;  2MR8 A;  2K92 A;  2LKI A;  2KOO A;  2KOQ A;  2MD9 A;  2CGQ A;  2KOS A;  2FVF A;  3RG2 A;  4HKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...