4BPHA

High resolution crystal structure of bacillus subtilis dltc
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
b'MDFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDSFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSELKRSHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 2
publication title High-Resolution Structures of the D-Alanyl Carrier Protein (Dcp) Dltc from Bacillus Subtilis Reveal Equivalent Conformations of Apo- and Holo-Forms
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 23
structure length 85
sequence length 85
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2013-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4bphA00
2KWLA 2LOLA 1DV5A 1ACPA 1F80D 3EJEA 1HQBA 2QNWA 2JU2A 4MRTC 2VSQA 2LKIA 2MD9A 1KLPA 2JU1A 4CA3A 3GZLA 1OR5A 1AF8A 2LPKA 5CZDB 2X2BA 2CNRA 2N50A 3CE7A 2LTEA 2FADA 5KP8B 2LMLA 2N6ZA 1NQ4A 2CGQA 5KP7B 2DNWA 2JGPA 3GZMA 2FVEA 2FQ1A 4BPFA 2L0QA 1VKUA 2K0YA 2K94A 2FVFA 2N5HA 2LL8A 2KOQA 2MF4A 2K92A 5HV8A 3EJDA 4H2XC 4PXHB 2MR7A 2AFDA 2L22A 2K0XA 2KOPA 2EHSA 2ROQA 1DNYA 2JQ4A 2FAEA 1T8KA 2FACA 2MVUA 2KGEA 3RG2A 4BPHA 2CQ8A 3NY7B 2AF8A 2KGAA 2GDXA 2MY5A 2LIWA 4DG9A 2FQ2A 2AVAA 2GDYA 3EJBA 1L0HA 2KOOA 1L0IA 2KGDA 2L9FA 4PWVB 4BPGA 2MVVA 4NEOA 3LMOA 2KW2A 2N6YA 2KG6A 2KGCA 2PNGA 5HVCA 2KOSA 5KP6B 2XZ0D 1X3OA 2FVAA 2MR8A 2KG9A 2AFEA 4HKGA 2K2QA 2GDWA 4H2YC 1HY8A 5EJDA 2FHSC 4H2WC 2K93A 2N98A 2N5IA 2LIUA 2L4BA 2M5RA 4R0MA 2EHTA 2KR5A 2XZ1C 2KORA 2CG5B 2KG8A 4IZ6A 2FQ0A
chains in the Genus database with same CATH superfamily
3G1IA 1ACPA 1Q82Q 3I55P 3EJEA 2QNWA 2LKIA 2JU1A 1YJ9P 2QA4P 3GZLA 4XFYA 1YHQP 4QNBA 3VRLC 5CZDB 3DS2A 2LTEA 5KP8B 2WPTA 2Z46A 2E1MA 3GJNA 3DTJA 2CGQA 5HGMA 5KP7B 3GZMA 2FVEA 2Z44A 1QVFO 1E0HA 2K0YA 3CCUP 2N5HA 2CWOA 1NJIQ 5HV8A 3EJDA 5HGOA 4H2XC 2PEIA 2K0XA 3GKLC 3P05A 1DNYA 1QRJA 3RG2A 2PEMA 2NO8A 3I56P 2MY5A 1VQ5P 4DG9A 3E2DA 2KGDA 4PWVB 1VQ4P 1ZNVA 3CMAP 2KW2A 2PNGA 2KGCA 1EIAA 3CCJP 1D1DA 4COCA 5F2OA 3H4EA 4F37A 4HKGA 4H2YC 5EJDA 2FHSC 2VLNA 5F2NA 2ERHA 2K93A 1K9MQ 2N98A 3G71P 1BXIA 3Q20A 2EHTA 1FR2A 3CCRP 2JYGA 1VQOP 2LOLA 1DV5A 3CCMP 2QEXP 1CEIA 3CCVP 2JU2A 2PEQA 1YJWP 4GR6A 3CC4P 1KLPA 3B5IA 2BUOA 1AF8A 2EG5A 2X2BA 5DCKA 2CNRA 2N50A 3CE7A 2P9XA 1VQLP 1RO0A 1YITP 2JGPA 4GR2A 7CEIA 4BPFA 1AYIA 1UNKA 1EOQA 4U0EA 1KQSO 2K0DX 2K94A 2XT1A 3G1GA 5HGNA 1VQ7P 3CCQP 3DS5A 1Z6MA 1S72P 3M1MA 2JO0A 1YI2P 1T8KA 2JYLA 2KGEA 4BPHA 2CQ8A 2GYKA 3G4SP 2FQ2A 3EJBA 1JJ2O 2L9FA 2MVVA 4XRQA 2N6YA 2MR8A 2FVAA 2AFEA 3HYBA 3MGEA 4COPA 2PEOA 1ZMBA 1BAJA 2L4BA 1GXHA 1M74A 2M5RA 4R0MA 3CMEP 3G21A 2KG8A 2FQ0A 1AUMA 4WYMA 1A8OA 2KWLA 1EMVA 1F80D 1QVGO 2Z45A 4MRTC 2MD9A 2JAZA 4IPYA 1IMQA 1VQPP 1OR5A 3H47A 2K5XA 2LPKA 2VLQA 3DS1A 5BS2A 1GXGA 1RO2A 3NTEA 2VLPA 2GZEA 2N6ZA 1NQ4A 3RG6C 3CD6P 2DGYA 2M8PA 1VQNP 2EFJA 2FQ1A 2L6EA 4UHPB 2L0QA 2KOQA 2XXMA 1E6JP 1YIJP 2AFDA 2MR7A 2L22A 2JB0A 2PEJA 2GZGA 1Q81Q 2KOPA 3HZQA 2EHSA 4XFXA 3G29A 3DS3A 2FAEA 5HGLA 4U0CA 4XFZA 2KODA 3NY7B 2AF8A 4U0AA 2LIWA 1K30A 2AVAA 3H0DA 1L0HA 2KOOA 1L0IA 4BPGA 5EW5E 5JPAA 4PH1A 2LF4A 4U0BA 2KG6A 5HVCA 2KOSA 1W2BO 2XV6A 5BS1A 2XZ0D 5F2KA 1X3OA 2KG9A 2K2QA 1RNIA 2GZJA 1VQKP 2GZFA 4H2WC 2N5IA 2M8LA 1IUQA 3G6EP 1MZ8A 2KR5A 2XZ1C 2KORA 2CG5B 4IZ6A 3CPWO 3CCEP 1Q86Q 2M8NA 4XROA 1HQBA 1KC8Q 2VSQA 3CXCO 2VLOA 3OW2O 1M90Q 1N8RQ 4CA3A 2JBGA 3G28A 2PENA 2OARA 3DS0A 3G0VA 1KD1Q 2FADA 2LMLA 2EIAA 2DNWA 1VHNA 1VKUA 3U43A 2FVFA 2LL8A 3G26A 2MF4A 2K92A 1VQMP 2PEKA 3DS4A 2ONTA 1VQ8P 4PXHB 3LRYA 2ROQA 1K73Q 2JQ4A 1VQ6P 3WBHA 2OTLP 2FACA 2MVUA 1K8AQ 2KGAA 2GDXA 2OTJP 2GDYA 2GZIA 3DPHA 1Q7YQ 4NEOA 3LMOA 2BHVA 5KP6B 4U0FA 3CCSP 4QKOA 1IMPA 1M6NA 2PY8A 2GDWA 3B4QA 1VQ9P 1HY8A 3CC7P 5I4TG 1UJZA 1A43A 3CC2P 4U0DA 2LIUA 4M0IA 1GPJA 4PH0A 1YJNP 1M1KQ 1M6EX 3CCLP
chains in the Genus database with same CATH topology
2KWLA 2LOLA 1DV5A 1ACPA 1F80D 3EJEA 1HQBA 2QNWA 2JU2A 4MRTC 2VSQA 2LKIA 2MD9A 1KLPA 2JU1A 4CA3A 3GZLA 1OR5A 1AF8A 2LPKA 5CZDB 2X2BA 2CNRA 2N50A 3CE7A 2LTEA 2FADA 5KP8B 2LMLA 2N6ZA 1NQ4A 2CGQA 5KP7B 2DNWA 2JGPA 3GZMA 2FVEA 2FQ1A 4BPFA 2L0QA 1VKUA 2K0YA 2K94A 2FVFA 2N5HA 2LL8A 2KOQA 2MF4A 2K92A 5HV8A 3EJDA 4H2XC 4PXHB 2MR7A 2AFDA 2L22A 2K0XA 2KOPA 2EHSA 2ROQA 1DNYA 2JQ4A 2FAEA 1T8KA 2FACA 2MVUA 2KGEA 3RG2A 4BPHA 2CQ8A 3NY7B 2AF8A 2KGAA 2GDXA 2MY5A 2LIWA 4DG9A 2FQ2A 2AVAA 2GDYA 3EJBA 1L0HA 2KOOA 1L0IA 2KGDA 2L9FA 4PWVB 4BPGA 2MVVA 4NEOA 3LMOA 2KW2A 2N6YA 2KG6A 2KGCA 2PNGA 5HVCA 2KOSA 5KP6B 2XZ0D 1X3OA 2FVAA 2MR8A 2KG9A 2AFEA 4HKGA 2K2QA 2GDWA 4H2YC 1HY8A 5EJDA 2FHSC 4H2WC 2K93A 2N98A 2N5IA 2LIUA 2L4BA 2M5RA 4R0MA 2EHTA 2KR5A 2XZ1C 2KORA 2CG5B 2KG8A 4IZ6A 2FQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWL A;  2LOL A;  1DV5 A;  1ACP A;  1F80 D;  3EJE A;  1HQB A;  2QNW A;  2JU2 A;  4MRT C;  2VSQ A;  2LKI A;  2MD9 A;  1KLP A;  2JU1 A;  4CA3 A;  3GZL A;  1OR5 A;  1AF8 A;  2LPK A;  5CZD B;  2X2B A;  2CNR A;  2N50 A;  3CE7 A;  2LTE A;  2FAD A;  5KP8 B;  2LML A;  2N6Z A;  1NQ4 A;  2CGQ A;  5KP7 B;  2DNW A;  2JGP A;  3GZM A;  2FVE A;  2FQ1 A;  4BPF A;  2L0Q A;  1VKU A;  2K0Y A;  2K94 A;  2FVF A;  2N5H A;  2LL8 A;  2KOQ A;  2MF4 A;  2K92 A;  5HV8 A;  3EJD A;  4H2X C;  4PXH B;  2MR7 A;  2AFD A;  2L22 A;  2K0X A;  2KOP A;  2EHS A;  2ROQ A;  1DNY A;  2JQ4 A;  2FAE A;  1T8K A;  2FAC A;  2MVU A;  2KGE A;  3RG2 A;  4BPH A;  2CQ8 A;  3NY7 B;  2AF8 A;  2KGA A;  2GDX A;  2MY5 A;  2LIW A;  4DG9 A;  2FQ2 A;  2AVA A;  2GDY A;  3EJB A;  1L0H A;  2KOO A;  1L0I A;  2KGD A;  2L9F A;  4PWV B;  4BPG A;  2MVV A;  4NEO A;  3LMO A;  2KW2 A;  2N6Y A;  2KG6 A;  2KGC A;  2PNG A;  5HVC A;  2KOS A;  5KP6 B;  2XZ0 D;  1X3O A;  2FVA A;  2MR8 A;  2KG9 A;  2AFE A;  4HKG A;  2K2Q A;  2GDW A;  4H2Y C;  1HY8 A;  5EJD A;  2FHS C;  4H2W C;  2K93 A;  2N98 A;  2N5I A;  2LIU A;  2L4B A;  2M5R A;  4R0M A;  2EHT A;  2KR5 A;  2XZ1 C;  2KOR A;  2CG5 B;  2KG8 A;  4IZ6 A;  2FQ0 A; 
#chains in the Genus database with same CATH topology
 3G1I A;  1ACP A;  1Q82 Q;  3I55 P;  3EJE A;  2QNW A;  2LKI A;  2JU1 A;  1YJ9 P;  2QA4 P;  3GZL A;  4XFY A;  1YHQ P;  4QNB A;  3VRL C;  5CZD B;  3DS2 A;  2LTE A;  5KP8 B;  2WPT A;  2Z46 A;  2E1M A;  3GJN A;  3DTJ A;  2CGQ A;  5HGM A;  5KP7 B;  3GZM A;  2FVE A;  2Z44 A;  1QVF O;  1E0H A;  2K0Y A;  3CCU P;  2N5H A;  2CWO A;  1NJI Q;  5HV8 A;  3EJD A;  5HGO A;  4H2X C;  2PEI A;  2K0X A;  3GKL C;  3P05 A;  1DNY A;  1QRJ A;  3RG2 A;  2PEM A;  2NO8 A;  3I56 P;  2MY5 A;  1VQ5 P;  4DG9 A;  3E2D A;  2KGD A;  4PWV B;  1VQ4 P;  1ZNV A;  3CMA P;  2KW2 A;  2PNG A;  2KGC A;  1EIA A;  3CCJ P;  1D1D A;  4COC A;  5F2O A;  3H4E A;  4F37 A;  4HKG A;  4H2Y C;  5EJD A;  2FHS C;  2VLN A;  5F2N A;  2ERH A;  2K93 A;  1K9M Q;  2N98 A;  3G71 P;  1BXI A;  3Q20 A;  2EHT A;  1FR2 A;  3CCR P;  2JYG A;  1VQO P;  2LOL A;  1DV5 A;  3CCM P;  2QEX P;  1CEI A;  3CCV P;  2JU2 A;  2PEQ A;  1YJW P;  4GR6 A;  3CC4 P;  1KLP A;  3B5I A;  2BUO A;  1AF8 A;  2EG5 A;  2X2B A;  5DCK A;  2CNR A;  2N50 A;  3CE7 A;  2P9X A;  1VQL P;  1RO0 A;  1YIT P;  2JGP A;  4GR2 A;  7CEI A;  4BPF A;  1AYI A;  1UNK A;  1EOQ A;  4U0E A;  1KQS O;  2K0D X;  2K94 A;  2XT1 A;  3G1G A;  5HGN A;  1VQ7 P;  3CCQ P;  3DS5 A;  1Z6M A;  1S72 P;  3M1M A;  2JO0 A;  1YI2 P;  1T8K A;  2JYL A;  2KGE A;  4BPH A;  2CQ8 A;  2GYK A;  3G4S P;  2FQ2 A;  3EJB A;  1JJ2 O;  2L9F A;  2MVV A;  4XRQ A;  2N6Y A;  2MR8 A;  2FVA A;  2AFE A;  3HYB A;  3MGE A;  4COP A;  2PEO A;  1ZMB A;  1BAJ A;  2L4B A;  1GXH A;  1M74 A;  2M5R A;  4R0M A;  3CME P;  3G21 A;  2KG8 A;  2FQ0 A;  1AUM A;  4WYM A;  1A8O A;  2KWL A;  1EMV A;  1F80 D;  1QVG O;  2Z45 A;  4MRT C;  2MD9 A;  2JAZ A;  4IPY A;  1IMQ A;  1VQP P;  1OR5 A;  3H47 A;  2K5X A;  2LPK A;  2VLQ A;  3DS1 A;  5BS2 A;  1GXG A;  1RO2 A;  3NTE A;  2VLP A;  2GZE A;  2N6Z A;  1NQ4 A;  3RG6 C;  3CD6 P;  2DGY A;  2M8P A;  1VQN P;  2EFJ A;  2FQ1 A;  2L6E A;  4UHP B;  2L0Q A;  2KOQ A;  2XXM A;  1E6J P;  1YIJ P;  2AFD A;  2MR7 A;  2L22 A;  2JB0 A;  2PEJ A;  2GZG A;  1Q81 Q;  2KOP A;  3HZQ A;  2EHS A;  4XFX A;  3G29 A;  3DS3 A;  2FAE A;  5HGL A;  4U0C A;  4XFZ A;  2KOD A;  3NY7 B;  2AF8 A;  4U0A A;  2LIW A;  1K30 A;  2AVA A;  3H0D A;  1L0H A;  2KOO A;  1L0I A;  4BPG A;  5EW5 E;  5JPA A;  4PH1 A;  2LF4 A;  4U0B A;  2KG6 A;  5HVC A;  2KOS A;  1W2B O;  2XV6 A;  5BS1 A;  2XZ0 D;  5F2K A;  1X3O A;  2KG9 A;  2K2Q A;  1RNI A;  2GZJ A;  1VQK P;  2GZF A;  4H2W C;  2N5I A;  2M8L A;  1IUQ A;  3G6E P;  1MZ8 A;  2KR5 A;  2XZ1 C;  2KOR A;  2CG5 B;  4IZ6 A;  3CPW O;  3CCE P;  1Q86 Q;  2M8N A;  4XRO A;  1HQB A;  1KC8 Q;  2VSQ A;  3CXC O;  2VLO A;  3OW2 O;  1M90 Q;  1N8R Q;  4CA3 A;  2JBG A;  3G28 A;  2PEN A;  2OAR A;  3DS0 A;  3G0V A;  1KD1 Q;  2FAD A;  2LML A;  2EIA A;  2DNW A;  1VHN A;  1VKU A;  3U43 A;  2FVF A;  2LL8 A;  3G26 A;  2MF4 A;  2K92 A;  1VQM P;  2PEK A;  3DS4 A;  2ONT A;  1VQ8 P;  4PXH B;  3LRY A;  2ROQ A;  1K73 Q;  2JQ4 A;  1VQ6 P;  3WBH A;  2OTL P;  2FAC A;  2MVU A;  1K8A Q;  2KGA A;  2GDX A;  2OTJ P;  2GDY A;  2GZI A;  3DPH A;  1Q7Y Q;  4NEO A;  3LMO A;  2BHV A;  5KP6 B;  4U0F A;  3CCS P;  4QKO A;  1IMP A;  1M6N A;  2PY8 A;  2GDW A;  3B4Q A;  1VQ9 P;  1HY8 A;  3CC7 P;  5I4T G;  1UJZ A;  1A43 A;  3CC2 P;  4U0D A;  2LIU A;  4M0I A;  1GPJ A;  4PH0 A;  1YJN P;  1M1K Q;  1M6E X;  3CCL P; 
#chains in the Genus database with same CATH homology
 2KWL A;  2LOL A;  1DV5 A;  1ACP A;  1F80 D;  3EJE A;  1HQB A;  2QNW A;  2JU2 A;  4MRT C;  2VSQ A;  2LKI A;  2MD9 A;  1KLP A;  2JU1 A;  4CA3 A;  3GZL A;  1OR5 A;  1AF8 A;  2LPK A;  5CZD B;  2X2B A;  2CNR A;  2N50 A;  3CE7 A;  2LTE A;  2FAD A;  5KP8 B;  2LML A;  2N6Z A;  1NQ4 A;  2CGQ A;  5KP7 B;  2DNW A;  2JGP A;  3GZM A;  2FVE A;  2FQ1 A;  4BPF A;  2L0Q A;  1VKU A;  2K0Y A;  2K94 A;  2FVF A;  2N5H A;  2LL8 A;  2KOQ A;  2MF4 A;  2K92 A;  5HV8 A;  3EJD A;  4H2X C;  4PXH B;  2MR7 A;  2AFD A;  2L22 A;  2K0X A;  2KOP A;  2EHS A;  2ROQ A;  1DNY A;  2JQ4 A;  2FAE A;  1T8K A;  2FAC A;  2MVU A;  2KGE A;  3RG2 A;  4BPH A;  2CQ8 A;  3NY7 B;  2AF8 A;  2KGA A;  2GDX A;  2MY5 A;  2LIW A;  4DG9 A;  2FQ2 A;  2AVA A;  2GDY A;  3EJB A;  1L0H A;  2KOO A;  1L0I A;  2KGD A;  2L9F A;  4PWV B;  4BPG A;  2MVV A;  4NEO A;  3LMO A;  2KW2 A;  2N6Y A;  2KG6 A;  2KGC A;  2PNG A;  5HVC A;  2KOS A;  5KP6 B;  2XZ0 D;  1X3O A;  2FVA A;  2MR8 A;  2KG9 A;  2AFE A;  4HKG A;  2K2Q A;  2GDW A;  4H2Y C;  1HY8 A;  5EJD A;  2FHS C;  4H2W C;  2K93 A;  2N98 A;  2N5I A;  2LIU A;  2L4B A;  2M5R A;  4R0M A;  2EHT A;  2KR5 A;  2XZ1 C;  2KOR A;  2CG5 B;  2KG8 A;  4IZ6 A;  2FQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...