4BPHA

High resolution crystal structure of bacillus subtilis dltc
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
MDFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDSFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSELKRSHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 2
publication title High-Resolution Structures of the D-Alanyl Carrier Protein (Dcp) Dltc from Bacillus Subtilis Reveal Equivalent Conformations of Apo- and Holo-Forms
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 23
structure length 85
sequence length 85
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2013-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4bphA00
2FACA 2N50A 2N5HA 3GZMA 4IZ6A 1KLPA 2K2QA 2KW2A 4BPGA 4PWVB 3GZLA 3NY7B 5CZDB 2XZ0D 2DNWA 2KR5A 2AVAA 2LIUA 4BPHA 2N6YA 2CG5B 3CE7A 2L9FA 2L22A 2GDYA 2FHSC 2KG6A 2MY5A 2GDWA 2MVUA 1DV5A 5KP6B 2FVAA 2MR7A 4NEOA 1VKUA 3LMOA 3EJEA 2K93A 1L0HA 3EJBA 5KP8B 2KGDA 4PXHB 2KGEA 1DNYA 2EHTA 1HQBA 4H2YC 4CA3A 2LL8A 1L0IA 2KG9A 2MR8A 1HY8A 2FQ2A 2N5IA 4BPFA 2KGAA 5HV8A 2CGQA 2FADA 2N98A 5HVCA 2L0QA 2K0XA 2LKIA 2FVEA 2KORA 2KWLA 2LPKA 2KGCA 2MD9A 1X3OA 2PNGA 1NQ4A 2QNWA 2KOOA 2FAEA 2AF8A 2FVFA 2JGPA 2FQ0A 1OR5A 2JQ4A 2K92A 5EJDA 2CNRA 1F80D 2KOSA 2L4BA 2M5RA 5KP7B 2N6ZA 1ACPA 2KOPA 4HKGA 2LMLA 2LTEA 3EJDA 2JU1A 4H2WC 2MF4A 2K94A 2X2BA 4MRTC 2K0YA 4H2XC 2KG8A 2KOQA 2JU2A 4DG9A 4R0MA 2FQ1A 2LOLA 2EHSA 2MVVA 1AF8A 2AFDA 1T8KA 3RG2A 2AFEA 2ROQA 2LIWA 2CQ8A 2VSQA 2GDXA 2XZ1C
chains in the Genus database with same CATH superfamily
3CCEP 3WBHA 5HGLA 1FR2A 1KLPA 4BPGA 2JB0A 3DS1A 1QVGO 1BAJA 3OW2O 3NY7B 2XZ0D 2PEIA 2DNWA 4PH0A 2QEXP 3DS0A 4BPHA 3G26A 2L9FA 2GDYA 2FHSC 2KG6A 2MY5A 2GDWA 2Z45A 2MVUA 4XRQA 3Q20A 1DV5A 4COPA 4NEOA 1VKUA 3LMOA 1Z6MA 1VQ5P 1NJIQ 2KGDA 5HGMA 5EW5E 1M1KQ 2LL8A 5BS2A 2PEQA 2N5IA 2BUOA 1VQ8P 1K8AQ 2VLOA 1VQMP 2K0XA 2DGYA 2LPKA 4WYMA 2MD9A 2NO8A 2PNGA 2Z44A 2FAEA 3CCRP 2EG5A 2PY8A 3CCSP 2PEOA 1QRJA 4XFZA 2N6ZA 4HKGA 1ZMBA 3G29A 5F2KA 2LTEA 2JYGA 5HGOA 2PEMA 3P05A 2JO0A 2K0YA 4H2XC 4U0AA 4GR6A 4R0MA 2FQ1A 2JBGA 2AFDA 1T8KA 2BHVA 3RG2A 2ROQA 1E6JP 2ERHA 2CQ8A 3CPWO 2VLQA 2N50A 3GZMA 2K2QA 2KW2A 1IMQA 3H4EA 4PWVB 1A8OA 3CC2P 3CCJP 2CG5B 1YHQP 2K5XA 1EOQA 3G1GA 2GZGA 5KP6B 2FVAA 2MR7A 3DTJA 3EJEA 2EFJA 2CWOA 3G4SP 2K93A 2VLNA 2M8NA 1DNYA 2EHTA 1GXHA 3H47A 3B5IA 3G28A 1L0IA 1Q7YQ 4XFXA 1VQNP 1HY8A 4BPFA 3DS4A 1VQKP 1M90Q 1BXIA 2KGCA 1X3OA 1NQ4A 2QNWA 4IPYA 2KOOA 2JGPA 3HZQA 1VQPP 1YI2P 4U0DA 1YJ9P 2CNRA 3RG6C 5BS1A 1YITP 1ACPA 2JU1A 2ONTA 2K94A 3CC4P 2KG8A 2KOQA 2JU2A 4DG9A 2MVVA 2EHSA 1AF8A 5F2NA 5DCKA 2LIWA 4XFYA 1M6NA 3B4QA 2N5HA 1ZNVA 1VQOP 5JPAA 1UNKA 2PEKA 1E0HA 2KR5A 2AVAA 2LIUA 4M0IA 1IMPA 3CD6P 2VLPA 3CE7A 1KQSO 2L22A 4U0EA 2E1MA 2PEJA 3CCMP 3GJNA 1W2BO 3LRYA 3GKLC 1HQBA 1AYIA 2JYLA 1VQLP 1RNIA 1N8RQ 1AUMA 3G21A 3CCLP 2KG9A 2MR8A 2KGAA 5HV8A 2CGQA 1VQ9P 1EMVA 2N98A 5HVCA 2K0DX 2L0QA 2Z46A 2FVEA 2KORA 2JAZA 2XXMA 1VQ6P 3CXCO 1K9MQ 3I56P 2AF8A 2FVFA 2FQ0A 1S72P 4F37A 1OR5A 2XT1A 2K92A 3M1MA 5EJDA 2GZIA 2M5RA 5KP7B 2LMLA 4H2WC 3NTEA 2OARA 4MRTC 1JJ2O 3CCQP 2GYKA 2KODA 2GZJA 4QKOA 2VSQA 1IUQA 2GDXA 2XZ1C 4U0CA 3VRLC 2FACA 1VQ4P 2OTLP 3G6EP 4IZ6A 1UJZA 1K73Q 3G1IA 3GZLA 2GZEA 1K30A 2XV6A 2P9XA 5CZDB 1VHNA 3CMEP 2N6YA 2L6EA 3E2DA 2M8LA 4COCA 3H0DA 7CEIA 3MGEA 1EIAA 4U0FA 3DPHA 1KC8Q 1VQ7P 1RO2A 4GR2A 1L0HA 3EJBA 3U43A 5KP8B 4PXHB 2KGEA 4H2YC 1A43A 4CA3A 4UHPB 1RO0A 3G71P 1MZ8A 3DS5A 4QNBA 3CC7P 1Q86Q 2FQ2A 2M8PA 1YJWP 1GXGA 4PH1A 1YIJP 2EIAA 2GZFA 2FADA 1QVFO 2LKIA 2PENA 4XROA 2KWLA 1M74A 1CEIA 3CMAP 1D1DA 3CCUP 5HGNA 1M6EX 2LF4A 2WPTA 3HYBA 2JQ4A 3DS2A 1F80D 2KOSA 3G0VA 2L4BA 2KOPA 1YJNP 3EJDA 3I55P 1Q81Q 1KD1Q 5I4TG 2MF4A 2QA4P 2X2BA 2LOLA 4U0BA 1GPJA 3DS3A 2AFEA 1Q82Q 3CCVP 5F2OA 2OTJP
chains in the Genus database with same CATH topology
2FACA 2N50A 2N5HA 3GZMA 4IZ6A 1KLPA 2K2QA 2KW2A 4BPGA 4PWVB 3GZLA 3NY7B 5CZDB 2XZ0D 2DNWA 2KR5A 2AVAA 2LIUA 4BPHA 2N6YA 2CG5B 3CE7A 2L9FA 2L22A 2GDYA 2FHSC 2KG6A 2MY5A 2GDWA 2MVUA 1DV5A 5KP6B 2FVAA 2MR7A 4NEOA 1VKUA 3LMOA 3EJEA 2K93A 1L0HA 3EJBA 5KP8B 2KGDA 4PXHB 2KGEA 1DNYA 2EHTA 1HQBA 4H2YC 4CA3A 2LL8A 1L0IA 2KG9A 2MR8A 1HY8A 2FQ2A 2N5IA 4BPFA 2KGAA 5HV8A 2CGQA 2FADA 2N98A 5HVCA 2L0QA 2K0XA 2LKIA 2FVEA 2KORA 2KWLA 2LPKA 2KGCA 2MD9A 1X3OA 2PNGA 1NQ4A 2QNWA 2KOOA 2FAEA 2AF8A 2FVFA 2JGPA 2FQ0A 1OR5A 2JQ4A 2K92A 5EJDA 2CNRA 1F80D 2KOSA 2L4BA 2M5RA 5KP7B 2N6ZA 1ACPA 2KOPA 4HKGA 2LMLA 2LTEA 3EJDA 2JU1A 4H2WC 2MF4A 2K94A 2X2BA 4MRTC 2K0YA 4H2XC 2KG8A 2KOQA 2JU2A 4DG9A 4R0MA 2FQ1A 2LOLA 2EHSA 2MVVA 1AF8A 2AFDA 1T8KA 3RG2A 2AFEA 2ROQA 2LIWA 2CQ8A 2VSQA 2GDXA 2XZ1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAC A;  2N50 A;  2N5H A;  3GZM A;  4IZ6 A;  1KLP A;  2K2Q A;  2KW2 A;  4BPG A;  4PWV B;  3GZL A;  3NY7 B;  5CZD B;  2XZ0 D;  2DNW A;  2KR5 A;  2AVA A;  2LIU A;  4BPH A;  2N6Y A;  2CG5 B;  3CE7 A;  2L9F A;  2L22 A;  2GDY A;  2FHS C;  2KG6 A;  2MY5 A;  2GDW A;  2MVU A;  1DV5 A;  5KP6 B;  2FVA A;  2MR7 A;  4NEO A;  1VKU A;  3LMO A;  3EJE A;  2K93 A;  1L0H A;  3EJB A;  5KP8 B;  2KGD A;  4PXH B;  2KGE A;  1DNY A;  2EHT A;  1HQB A;  4H2Y C;  4CA3 A;  2LL8 A;  1L0I A;  2KG9 A;  2MR8 A;  1HY8 A;  2FQ2 A;  2N5I A;  4BPF A;  2KGA A;  5HV8 A;  2CGQ A;  2FAD A;  2N98 A;  5HVC A;  2L0Q A;  2K0X A;  2LKI A;  2FVE A;  2KOR A;  2KWL A;  2LPK A;  2KGC A;  2MD9 A;  1X3O A;  2PNG A;  1NQ4 A;  2QNW A;  2KOO A;  2FAE A;  2AF8 A;  2FVF A;  2JGP A;  2FQ0 A;  1OR5 A;  2JQ4 A;  2K92 A;  5EJD A;  2CNR A;  1F80 D;  2KOS A;  2L4B A;  2M5R A;  5KP7 B;  2N6Z A;  1ACP A;  2KOP A;  4HKG A;  2LML A;  2LTE A;  3EJD A;  2JU1 A;  4H2W C;  2MF4 A;  2K94 A;  2X2B A;  4MRT C;  2K0Y A;  4H2X C;  2KG8 A;  2KOQ A;  2JU2 A;  4DG9 A;  4R0M A;  2FQ1 A;  2LOL A;  2EHS A;  2MVV A;  1AF8 A;  2AFD A;  1T8K A;  3RG2 A;  2AFE A;  2ROQ A;  2LIW A;  2CQ8 A;  2VSQ A;  2GDX A;  2XZ1 C; 
#chains in the Genus database with same CATH topology
 3CCE P;  3WBH A;  5HGL A;  1FR2 A;  1KLP A;  4BPG A;  2JB0 A;  3DS1 A;  1QVG O;  1BAJ A;  3OW2 O;  3NY7 B;  2XZ0 D;  2PEI A;  2DNW A;  4PH0 A;  2QEX P;  3DS0 A;  4BPH A;  3G26 A;  2L9F A;  2GDY A;  2FHS C;  2KG6 A;  2MY5 A;  2GDW A;  2Z45 A;  2MVU A;  4XRQ A;  3Q20 A;  1DV5 A;  4COP A;  4NEO A;  1VKU A;  3LMO A;  1Z6M A;  1VQ5 P;  1NJI Q;  2KGD A;  5HGM A;  5EW5 E;  1M1K Q;  2LL8 A;  5BS2 A;  2PEQ A;  2N5I A;  2BUO A;  1VQ8 P;  1K8A Q;  2VLO A;  1VQM P;  2K0X A;  2DGY A;  2LPK A;  4WYM A;  2MD9 A;  2NO8 A;  2PNG A;  2Z44 A;  2FAE A;  3CCR P;  2EG5 A;  2PY8 A;  3CCS P;  2PEO A;  1QRJ A;  4XFZ A;  2N6Z A;  4HKG A;  1ZMB A;  3G29 A;  5F2K A;  2LTE A;  2JYG A;  5HGO A;  2PEM A;  3P05 A;  2JO0 A;  2K0Y A;  4H2X C;  4U0A A;  4GR6 A;  4R0M A;  2FQ1 A;  2JBG A;  2AFD A;  1T8K A;  2BHV A;  3RG2 A;  2ROQ A;  1E6J P;  2ERH A;  2CQ8 A;  3CPW O;  2VLQ A;  2N50 A;  3GZM A;  2K2Q A;  2KW2 A;  1IMQ A;  3H4E A;  4PWV B;  1A8O A;  3CC2 P;  3CCJ P;  2CG5 B;  1YHQ P;  2K5X A;  1EOQ A;  3G1G A;  2GZG A;  5KP6 B;  2FVA A;  2MR7 A;  3DTJ A;  3EJE A;  2EFJ A;  2CWO A;  3G4S P;  2K93 A;  2VLN A;  2M8N A;  1DNY A;  2EHT A;  1GXH A;  3H47 A;  3B5I A;  3G28 A;  1L0I A;  1Q7Y Q;  4XFX A;  1VQN P;  1HY8 A;  4BPF A;  3DS4 A;  1VQK P;  1M90 Q;  1BXI A;  2KGC A;  1X3O A;  1NQ4 A;  2QNW A;  4IPY A;  2KOO A;  2JGP A;  3HZQ A;  1VQP P;  1YI2 P;  4U0D A;  1YJ9 P;  2CNR A;  3RG6 C;  5BS1 A;  1YIT P;  1ACP A;  2JU1 A;  2ONT A;  2K94 A;  3CC4 P;  2KG8 A;  2KOQ A;  2JU2 A;  4DG9 A;  2MVV A;  2EHS A;  1AF8 A;  5F2N A;  5DCK A;  2LIW A;  4XFY A;  1M6N A;  3B4Q A;  2N5H A;  1ZNV A;  1VQO P;  5JPA A;  1UNK A;  2PEK A;  1E0H A;  2KR5 A;  2AVA A;  2LIU A;  4M0I A;  1IMP A;  3CD6 P;  2VLP A;  3CE7 A;  1KQS O;  2L22 A;  4U0E A;  2E1M A;  2PEJ A;  3CCM P;  3GJN A;  1W2B O;  3LRY A;  3GKL C;  1HQB A;  1AYI A;  2JYL A;  1VQL P;  1RNI A;  1N8R Q;  1AUM A;  3G21 A;  3CCL P;  2KG9 A;  2MR8 A;  2KGA A;  5HV8 A;  2CGQ A;  1VQ9 P;  1EMV A;  2N98 A;  5HVC A;  2K0D X;  2L0Q A;  2Z46 A;  2FVE A;  2KOR A;  2JAZ A;  2XXM A;  1VQ6 P;  3CXC O;  1K9M Q;  3I56 P;  2AF8 A;  2FVF A;  2FQ0 A;  1S72 P;  4F37 A;  1OR5 A;  2XT1 A;  2K92 A;  3M1M A;  5EJD A;  2GZI A;  2M5R A;  5KP7 B;  2LML A;  4H2W C;  3NTE A;  2OAR A;  4MRT C;  1JJ2 O;  3CCQ P;  2GYK A;  2KOD A;  2GZJ A;  4QKO A;  2VSQ A;  1IUQ A;  2GDX A;  2XZ1 C;  4U0C A;  3VRL C;  2FAC A;  1VQ4 P;  2OTL P;  3G6E P;  4IZ6 A;  1UJZ A;  1K73 Q;  3G1I A;  3GZL A;  2GZE A;  1K30 A;  2XV6 A;  2P9X A;  5CZD B;  1VHN A;  3CME P;  2N6Y A;  2L6E A;  3E2D A;  2M8L A;  4COC A;  3H0D A;  7CEI A;  3MGE A;  1EIA A;  4U0F A;  3DPH A;  1KC8 Q;  1VQ7 P;  1RO2 A;  4GR2 A;  1L0H A;  3EJB A;  3U43 A;  5KP8 B;  4PXH B;  2KGE A;  4H2Y C;  1A43 A;  4CA3 A;  4UHP B;  1RO0 A;  3G71 P;  1MZ8 A;  3DS5 A;  4QNB A;  3CC7 P;  1Q86 Q;  2FQ2 A;  2M8P A;  1YJW P;  1GXG A;  4PH1 A;  1YIJ P;  2EIA A;  2GZF A;  2FAD A;  1QVF O;  2LKI A;  2PEN A;  4XRO A;  2KWL A;  1M74 A;  1CEI A;  3CMA P;  1D1D A;  3CCU P;  5HGN A;  1M6E X;  2LF4 A;  2WPT A;  3HYB A;  2JQ4 A;  3DS2 A;  1F80 D;  2KOS A;  3G0V A;  2L4B A;  2KOP A;  1YJN P;  3EJD A;  3I55 P;  1Q81 Q;  1KD1 Q;  5I4T G;  2MF4 A;  2QA4 P;  2X2B A;  2LOL A;  4U0B A;  1GPJ A;  3DS3 A;  2AFE A;  1Q82 Q;  3CCV P;  5F2O A;  2OTJ P; 
#chains in the Genus database with same CATH homology
 2FAC A;  2N50 A;  2N5H A;  3GZM A;  4IZ6 A;  1KLP A;  2K2Q A;  2KW2 A;  4BPG A;  4PWV B;  3GZL A;  3NY7 B;  5CZD B;  2XZ0 D;  2DNW A;  2KR5 A;  2AVA A;  2LIU A;  4BPH A;  2N6Y A;  2CG5 B;  3CE7 A;  2L9F A;  2L22 A;  2GDY A;  2FHS C;  2KG6 A;  2MY5 A;  2GDW A;  2MVU A;  1DV5 A;  5KP6 B;  2FVA A;  2MR7 A;  4NEO A;  1VKU A;  3LMO A;  3EJE A;  2K93 A;  1L0H A;  3EJB A;  5KP8 B;  2KGD A;  4PXH B;  2KGE A;  1DNY A;  2EHT A;  1HQB A;  4H2Y C;  4CA3 A;  2LL8 A;  1L0I A;  2KG9 A;  2MR8 A;  1HY8 A;  2FQ2 A;  2N5I A;  4BPF A;  2KGA A;  5HV8 A;  2CGQ A;  2FAD A;  2N98 A;  5HVC A;  2L0Q A;  2K0X A;  2LKI A;  2FVE A;  2KOR A;  2KWL A;  2LPK A;  2KGC A;  2MD9 A;  1X3O A;  2PNG A;  1NQ4 A;  2QNW A;  2KOO A;  2FAE A;  2AF8 A;  2FVF A;  2JGP A;  2FQ0 A;  1OR5 A;  2JQ4 A;  2K92 A;  5EJD A;  2CNR A;  1F80 D;  2KOS A;  2L4B A;  2M5R A;  5KP7 B;  2N6Z A;  1ACP A;  2KOP A;  4HKG A;  2LML A;  2LTE A;  3EJD A;  2JU1 A;  4H2W C;  2MF4 A;  2K94 A;  2X2B A;  4MRT C;  2K0Y A;  4H2X C;  2KG8 A;  2KOQ A;  2JU2 A;  4DG9 A;  4R0M A;  2FQ1 A;  2LOL A;  2EHS A;  2MVV A;  1AF8 A;  2AFD A;  1T8K A;  3RG2 A;  2AFE A;  2ROQ A;  2LIW A;  2CQ8 A;  2VSQ A;  2GDX A;  2XZ1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...