4BPHA

High resolution crystal structure of bacillus subtilis dltc
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
MDFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDSFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSELKRSHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 2
publication title High-Resolution Structures of the D-Alanyl Carrier Protein (Dcp) Dltc from Bacillus Subtilis Reveal Equivalent Conformations of Apo- and Holo-Forms
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Ligase
total genus 23
structure length 85
sequence length 85
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2013-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4bphA00
1X3OA 2LL8A 1DNYA 2AFEA 5KP8B 2L22A 2EHSA 4PXHB 2K0YA 1L0IA 2CNRA 3GZMA 4CA3A 1F80D 2K94A 3LMOA 2K0XA 4IZ6A 4H2WC 2KR5A 2GDYA 2KG8A 3EJBA 3NY7B 5KP7B 2K93A 2KOPA 2KOSA 2N6ZA 2EHTA 4NEOA 4MRTC 2L4BA 2LIUA 2CGQA 2FHSC 2N50A 1AF8A 2FVAA 3EJEA 2MF4A 4DG9A 1DV5A 2LKIA 2MVUA 2DNWA 2FACA 1NQ4A 2LTEA 2FQ0A 1OR5A 2LOLA 2XZ0D 4PWVB 4R0MA 3RG2A 4H2YC 4BPGA 2FQ2A 1HY8A 2JU1A 2JU2A 2N6YA 2N5HA 2LMLA 2KOOA 2GDXA 2XZ1C 2PNGA 4H2XC 2CQ8A 3GZLA 2KW2A 2KGDA 2MVVA 2L9FA 2VSQA 2AFDA 2FADA 2KG9A 2K2QA 2KG6A 5CZDB 2M5RA 2KGCA 2N98A 5HV8A 2FQ1A 1L0HA 1T8KA 3CE7A 4HKGA 2AVAA 4BPHA 2FVEA 1HQBA 2JQ4A 2K92A 2ROQA 5EJDA 2FVFA 2AF8A 2LPKA 2GDWA 2FAEA 2MR7A 1VKUA 2MD9A 2N5IA 2CG5B 4BPFA 5KP6B 2KWLA 2JGPA 2KOQA 2KORA 2MY5A 2MR8A 2KGAA 2QNWA 5HVCA 2KGEA 1ACPA 2L0QA 1KLPA 2X2BA 3EJDA 2LIWA
chains in the Genus database with same CATH superfamily
3E2DA 2BHVA 2NO8A 3H0DA 2XT1A 4PXHB 5DCKA 2EG5A 3M1MA 1L0IA 4IZ6A 4H2WC 1MZ8A 4QNBA 2KR5A 4WYMA 5F2KA 2KG8A 1QVFO 2KOSA 3GKLC 1VQ9P 1VHNA 2CGQA 4M0IA 1GXGA 4F37A 1NQ4A 3CD6P 2GZFA 2XZ0D 2GZJA 3DS5A 5F2NA 3G71P 2DGYA 2JU1A 2JU2A 4XRQA 4XFXA 3CC7P 1VQKP 2KOOA 1FR2A 2XZ1C 1Q81Q 2KW2A 2KGDA 2L9FA 3U43A 2VSQA 1UNKA 2KG9A 2PEQA 4XROA 1M74A 2VLQA 3CCJP 2CWOA 1GXHA 4COPA 2FQ1A 4HKGA 2AVAA 2JAZA 2PEOA 2JQ4A 2K92A 2JBGA 5EJDA 2AF8A 2LPKA 1Q86Q 4BPFA 2L6EA 2JGPA 2M8LA 1JJ2O 3G1GA 2KGEA 2L0QA 2ERHA 3CMAP 3EJDA 2LIWA 3CCSP 1X3OA 2ONTA 1GPJA 3G26A 2L22A 4PH1A 2M8PA 2GZIA 3LMOA 1S72P 2GZGA 2OTJP 2KOPA 1KD1Q 2Z44A 2N6ZA 2EHTA 2VLPA 3CCEP 2FHSC 2MF4A 3CMEP 1DV5A 1VQMP 2LKIA 2FACA 1ZMBA 1OR5A 3VRLC 2LOLA 3LRYA 4PWVB 3H47A 2M8NA 4BPGA 4XFZA 1Z6MA 3DTJA 2N6YA 3CCRP 2N5HA 2P9XA 2LMLA 1VQ6P 3Q20A 2VLOA 2MVVA 2XXMA 4XFYA 1VQOP 5HGNA 2K5XA 3P05A 2JO0A 1M90Q 3CC4P 5HV8A 3G28A 2OARA 2KODA 4BPHA 1YHQP 1KC8Q 2FVFA 1VQ8P 2FAEA 1AYIA 1VKUA 3RG6C 3HYBA 1AUMA 3G4SP 2CG5B 3I56P 5KP6B 3CCUP 1EIAA 2KGAA 2JB0A 5HVCA 2PEJA 1ACPA 2BUOA 1KLPA 2X2BA 4UHPB 3DS2A 2LL8A 1DNYA 4QKOA 5F2OA 5KP8B 4IPYA 2EHSA 2EFJA 2E1MA 2K0YA 2GZEA 2CNRA 1A43A 2GDYA 3NY7B 5KP7B 3H4EA 3I55P 4NEOA 1RO2A 2L4BA 1M6NA 7CEIA 1AF8A 3EJEA 4DG9A 2DNWA 2LTEA 1E6JP 2FQ0A 2PEKA 1K9MQ 4R0MA 3RG2A 1IUQA 2FQ2A 2OTLP 3DS0A 3G0VA 3OW2O 1ZNVA 2XV6A 3MGEA 1VQ4P 1A8OA 2GDXA 2PNGA 4H2XC 2CQ8A 1YI2P 3GZLA 2VLNA 1QRJA 4GR6A 2EIAA 3CXCO 2WPTA 2K2QA 2KG6A 5CZDB 2Z46A 4PH0A 2N98A 1W2BO 1YIJP 1M6EX 2PENA 2ROQA 1BXIA 1RNIA 4U0DA 2MD9A 3DS4A 4U0CA 1IMQA 5BS1A 1M1KQ 5JPAA 2LF4A 2KOQA 2KORA 1EMVA 2QNWA 1BAJA 1VQNP 1E0HA 2AFEA 1Q82Q 1YJ9P 3DS1A 3CCVP 4GR2A 3NTEA 3GZMA 4CA3A 1F80D 2K94A 2K0XA 1D1DA 3WBHA 1CEIA 5EW5E 3EJBA 1VQLP 2K93A 3CCQP 1UJZA 4MRTC 2LIUA 2N50A 2FVAA 3DPHA 3CCMP 2PEIA 3G29A 2JYLA 2MVUA 1YJNP 3G1IA 1VQPP 2QEXP 1K8AQ 4H2YC 1VQ5P 2GYKA 4U0FA 1HY8A 2K0DX 2PEMA 5I4TG 1RO0A 1N8RQ 1YITP 1NJIQ 3G21A 3CCLP 3GJNA 1IMPA 1QVGO 3CC2P 2AFDA 2FADA 1EOQA 5HGLA 5HGOA 1K30A 1K73Q 1VQ7P 3DS3A 2M5RA 5HGMA 2KGCA 4COCA 3B4QA 3B5IA 1L0HA 1T8KA 3CE7A 2Z45A 2FVEA 1HQBA 5BS2A 1KQSO 2JYGA 3CPWO 2GDWA 2MR7A 2PY8A 3HZQA 2N5IA 4U0AA 1Q7YQ 4U0EA 2KWLA 2MY5A 2MR8A 3G6EP 1YJWP 2QA4P 4U0BA
chains in the Genus database with same CATH topology
1X3OA 2LL8A 1DNYA 2AFEA 5KP8B 2L22A 2EHSA 4PXHB 2K0YA 1L0IA 2CNRA 3GZMA 4CA3A 1F80D 2K94A 3LMOA 2K0XA 4IZ6A 4H2WC 2KR5A 2GDYA 2KG8A 3EJBA 3NY7B 5KP7B 2K93A 2KOPA 2KOSA 2N6ZA 2EHTA 4NEOA 4MRTC 2L4BA 2LIUA 2CGQA 2FHSC 2N50A 1AF8A 2FVAA 3EJEA 2MF4A 4DG9A 1DV5A 2LKIA 2MVUA 2DNWA 2FACA 1NQ4A 2LTEA 2FQ0A 1OR5A 2LOLA 2XZ0D 4PWVB 4R0MA 3RG2A 4H2YC 4BPGA 2FQ2A 1HY8A 2JU1A 2JU2A 2N6YA 2N5HA 2LMLA 2KOOA 2GDXA 2XZ1C 2PNGA 4H2XC 2CQ8A 3GZLA 2KW2A 2KGDA 2MVVA 2L9FA 2VSQA 2AFDA 2FADA 2KG9A 2K2QA 2KG6A 5CZDB 2M5RA 2KGCA 2N98A 5HV8A 2FQ1A 1L0HA 1T8KA 3CE7A 4HKGA 2AVAA 4BPHA 2FVEA 1HQBA 2JQ4A 2K92A 2ROQA 5EJDA 2FVFA 2AF8A 2LPKA 2GDWA 2FAEA 2MR7A 1VKUA 2MD9A 2N5IA 2CG5B 4BPFA 5KP6B 2KWLA 2JGPA 2KOQA 2KORA 2MY5A 2MR8A 2KGAA 2QNWA 5HVCA 2KGEA 1ACPA 2L0QA 1KLPA 2X2BA 3EJDA 2LIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3O A;  2LL8 A;  1DNY A;  2AFE A;  5KP8 B;  2L22 A;  2EHS A;  4PXH B;  2K0Y A;  1L0I A;  2CNR A;  3GZM A;  4CA3 A;  1F80 D;  2K94 A;  3LMO A;  2K0X A;  4IZ6 A;  4H2W C;  2KR5 A;  2GDY A;  2KG8 A;  3EJB A;  3NY7 B;  5KP7 B;  2K93 A;  2KOP A;  2KOS A;  2N6Z A;  2EHT A;  4NEO A;  4MRT C;  2L4B A;  2LIU A;  2CGQ A;  2FHS C;  2N50 A;  1AF8 A;  2FVA A;  3EJE A;  2MF4 A;  4DG9 A;  1DV5 A;  2LKI A;  2MVU A;  2DNW A;  2FAC A;  1NQ4 A;  2LTE A;  2FQ0 A;  1OR5 A;  2LOL A;  2XZ0 D;  4PWV B;  4R0M A;  3RG2 A;  4H2Y C;  4BPG A;  2FQ2 A;  1HY8 A;  2JU1 A;  2JU2 A;  2N6Y A;  2N5H A;  2LML A;  2KOO A;  2GDX A;  2XZ1 C;  2PNG A;  4H2X C;  2CQ8 A;  3GZL A;  2KW2 A;  2KGD A;  2MVV A;  2L9F A;  2VSQ A;  2AFD A;  2FAD A;  2KG9 A;  2K2Q A;  2KG6 A;  5CZD B;  2M5R A;  2KGC A;  2N98 A;  5HV8 A;  2FQ1 A;  1L0H A;  1T8K A;  3CE7 A;  4HKG A;  2AVA A;  4BPH A;  2FVE A;  1HQB A;  2JQ4 A;  2K92 A;  2ROQ A;  5EJD A;  2FVF A;  2AF8 A;  2LPK A;  2GDW A;  2FAE A;  2MR7 A;  1VKU A;  2MD9 A;  2N5I A;  2CG5 B;  4BPF A;  5KP6 B;  2KWL A;  2JGP A;  2KOQ A;  2KOR A;  2MY5 A;  2MR8 A;  2KGA A;  2QNW A;  5HVC A;  2KGE A;  1ACP A;  2L0Q A;  1KLP A;  2X2B A;  3EJD A;  2LIW A; 
#chains in the Genus database with same CATH topology
 3E2D A;  2BHV A;  2NO8 A;  3H0D A;  2XT1 A;  4PXH B;  5DCK A;  2EG5 A;  3M1M A;  1L0I A;  4IZ6 A;  4H2W C;  1MZ8 A;  4QNB A;  2KR5 A;  4WYM A;  5F2K A;  2KG8 A;  1QVF O;  2KOS A;  3GKL C;  1VQ9 P;  1VHN A;  2CGQ A;  4M0I A;  1GXG A;  4F37 A;  1NQ4 A;  3CD6 P;  2GZF A;  2XZ0 D;  2GZJ A;  3DS5 A;  5F2N A;  3G71 P;  2DGY A;  2JU1 A;  2JU2 A;  4XRQ A;  4XFX A;  3CC7 P;  1VQK P;  2KOO A;  1FR2 A;  2XZ1 C;  1Q81 Q;  2KW2 A;  2KGD A;  2L9F A;  3U43 A;  2VSQ A;  1UNK A;  2KG9 A;  2PEQ A;  4XRO A;  1M74 A;  2VLQ A;  3CCJ P;  2CWO A;  1GXH A;  4COP A;  2FQ1 A;  4HKG A;  2AVA A;  2JAZ A;  2PEO A;  2JQ4 A;  2K92 A;  2JBG A;  5EJD A;  2AF8 A;  2LPK A;  1Q86 Q;  4BPF A;  2L6E A;  2JGP A;  2M8L A;  1JJ2 O;  3G1G A;  2KGE A;  2L0Q A;  2ERH A;  3CMA P;  3EJD A;  2LIW A;  3CCS P;  1X3O A;  2ONT A;  1GPJ A;  3G26 A;  2L22 A;  4PH1 A;  2M8P A;  2GZI A;  3LMO A;  1S72 P;  2GZG A;  2OTJ P;  2KOP A;  1KD1 Q;  2Z44 A;  2N6Z A;  2EHT A;  2VLP A;  3CCE P;  2FHS C;  2MF4 A;  3CME P;  1DV5 A;  1VQM P;  2LKI A;  2FAC A;  1ZMB A;  1OR5 A;  3VRL C;  2LOL A;  3LRY A;  4PWV B;  3H47 A;  2M8N A;  4BPG A;  4XFZ A;  1Z6M A;  3DTJ A;  2N6Y A;  3CCR P;  2N5H A;  2P9X A;  2LML A;  1VQ6 P;  3Q20 A;  2VLO A;  2MVV A;  2XXM A;  4XFY A;  1VQO P;  5HGN A;  2K5X A;  3P05 A;  2JO0 A;  1M90 Q;  3CC4 P;  5HV8 A;  3G28 A;  2OAR A;  2KOD A;  4BPH A;  1YHQ P;  1KC8 Q;  2FVF A;  1VQ8 P;  2FAE A;  1AYI A;  1VKU A;  3RG6 C;  3HYB A;  1AUM A;  3G4S P;  2CG5 B;  3I56 P;  5KP6 B;  3CCU P;  1EIA A;  2KGA A;  2JB0 A;  5HVC A;  2PEJ A;  1ACP A;  2BUO A;  1KLP A;  2X2B A;  4UHP B;  3DS2 A;  2LL8 A;  1DNY A;  4QKO A;  5F2O A;  5KP8 B;  4IPY A;  2EHS A;  2EFJ A;  2E1M A;  2K0Y A;  2GZE A;  2CNR A;  1A43 A;  2GDY A;  3NY7 B;  5KP7 B;  3H4E A;  3I55 P;  4NEO A;  1RO2 A;  2L4B A;  1M6N A;  7CEI A;  1AF8 A;  3EJE A;  4DG9 A;  2DNW A;  2LTE A;  1E6J P;  2FQ0 A;  2PEK A;  1K9M Q;  4R0M A;  3RG2 A;  1IUQ A;  2FQ2 A;  2OTL P;  3DS0 A;  3G0V A;  3OW2 O;  1ZNV A;  2XV6 A;  3MGE A;  1VQ4 P;  1A8O A;  2GDX A;  2PNG A;  4H2X C;  2CQ8 A;  1YI2 P;  3GZL A;  2VLN A;  1QRJ A;  4GR6 A;  2EIA A;  3CXC O;  2WPT A;  2K2Q A;  2KG6 A;  5CZD B;  2Z46 A;  4PH0 A;  2N98 A;  1W2B O;  1YIJ P;  1M6E X;  2PEN A;  2ROQ A;  1BXI A;  1RNI A;  4U0D A;  2MD9 A;  3DS4 A;  4U0C A;  1IMQ A;  5BS1 A;  1M1K Q;  5JPA A;  2LF4 A;  2KOQ A;  2KOR A;  1EMV A;  2QNW A;  1BAJ A;  1VQN P;  1E0H A;  2AFE A;  1Q82 Q;  1YJ9 P;  3DS1 A;  3CCV P;  4GR2 A;  3NTE A;  3GZM A;  4CA3 A;  1F80 D;  2K94 A;  2K0X A;  1D1D A;  3WBH A;  1CEI A;  5EW5 E;  3EJB A;  1VQL P;  2K93 A;  3CCQ P;  1UJZ A;  4MRT C;  2LIU A;  2N50 A;  2FVA A;  3DPH A;  3CCM P;  2PEI A;  3G29 A;  2JYL A;  2MVU A;  1YJN P;  3G1I A;  1VQP P;  2QEX P;  1K8A Q;  4H2Y C;  1VQ5 P;  2GYK A;  4U0F A;  1HY8 A;  2K0D X;  2PEM A;  5I4T G;  1RO0 A;  1N8R Q;  1YIT P;  1NJI Q;  3G21 A;  3CCL P;  3GJN A;  1IMP A;  1QVG O;  3CC2 P;  2AFD A;  2FAD A;  1EOQ A;  5HGL A;  5HGO A;  1K30 A;  1K73 Q;  1VQ7 P;  3DS3 A;  2M5R A;  5HGM A;  2KGC A;  4COC A;  3B4Q A;  3B5I A;  1L0H A;  1T8K A;  3CE7 A;  2Z45 A;  2FVE A;  1HQB A;  5BS2 A;  1KQS O;  2JYG A;  3CPW O;  2GDW A;  2MR7 A;  2PY8 A;  3HZQ A;  2N5I A;  4U0A A;  1Q7Y Q;  4U0E A;  2KWL A;  2MY5 A;  2MR8 A;  3G6E P;  1YJW P;  2QA4 P;  4U0B A; 
#chains in the Genus database with same CATH homology
 1X3O A;  2LL8 A;  1DNY A;  2AFE A;  5KP8 B;  2L22 A;  2EHS A;  4PXH B;  2K0Y A;  1L0I A;  2CNR A;  3GZM A;  4CA3 A;  1F80 D;  2K94 A;  3LMO A;  2K0X A;  4IZ6 A;  4H2W C;  2KR5 A;  2GDY A;  2KG8 A;  3EJB A;  3NY7 B;  5KP7 B;  2K93 A;  2KOP A;  2KOS A;  2N6Z A;  2EHT A;  4NEO A;  4MRT C;  2L4B A;  2LIU A;  2CGQ A;  2FHS C;  2N50 A;  1AF8 A;  2FVA A;  3EJE A;  2MF4 A;  4DG9 A;  1DV5 A;  2LKI A;  2MVU A;  2DNW A;  2FAC A;  1NQ4 A;  2LTE A;  2FQ0 A;  1OR5 A;  2LOL A;  2XZ0 D;  4PWV B;  4R0M A;  3RG2 A;  4H2Y C;  4BPG A;  2FQ2 A;  1HY8 A;  2JU1 A;  2JU2 A;  2N6Y A;  2N5H A;  2LML A;  2KOO A;  2GDX A;  2XZ1 C;  2PNG A;  4H2X C;  2CQ8 A;  3GZL A;  2KW2 A;  2KGD A;  2MVV A;  2L9F A;  2VSQ A;  2AFD A;  2FAD A;  2KG9 A;  2K2Q A;  2KG6 A;  5CZD B;  2M5R A;  2KGC A;  2N98 A;  5HV8 A;  2FQ1 A;  1L0H A;  1T8K A;  3CE7 A;  4HKG A;  2AVA A;  4BPH A;  2FVE A;  1HQB A;  2JQ4 A;  2K92 A;  2ROQ A;  5EJD A;  2FVF A;  2AF8 A;  2LPK A;  2GDW A;  2FAE A;  2MR7 A;  1VKU A;  2MD9 A;  2N5I A;  2CG5 B;  4BPF A;  5KP6 B;  2KWL A;  2JGP A;  2KOQ A;  2KOR A;  2MY5 A;  2MR8 A;  2KGA A;  2QNW A;  5HVC A;  2KGE A;  1ACP A;  2L0Q A;  1KLP A;  2X2B A;  3EJD A;  2LIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...