4BPHA

High resolution crystal structure of bacillus subtilis dltc
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
85
structure length
85
Chain Sequence
MDFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDSFGTVELLLAIENRFDILVPITEFDRDVWNTPNNIVNQLSELKRSHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 2
publication title High-Resolution Structures of the D-Alanyl Carrier Protein (Dcp) Dltc from Bacillus Subtilis Reveal Equivalent Conformations of Apo- and Holo-Forms
pubmed doi rcsb
source organism Bacillus subtilis
total genus 23
structure length 85
sequence length 85
ec nomenclature ec 6.1.1.13: D-alanine--poly(phosphoribitol) ligase.
pdb deposition date 2013-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 4bphA00
3GZMA 2X2BA 2M5RA 2VSQA 1HY8A 4BPHA 2AFDA 4H2YC 2CGQA 2N5IA 2LTEA 2AFEA 2JU1A 2FHSC 2KG9A 2MR7A 2XZ0D 1ACPA 1L0HA 4PXHB 2MVUA 2KR5A 2GDWA 2L22A 2FQ1A 2K0XA 2XZ1C 2JU2A 2L9FA 4H2WC 2KWLA 2EHTA 1X3OA 2FACA 2KW2A 2K94A 2FVFA 2KGDA 2K93A 5HVCA 2KOPA 1DV5A 2CNRA 2KGEA 4BPFA 2N5HA 1DNYA 2LPKA 1L0IA 2CG5B 2LL8A 2LOLA 2KG6A 4NEOA 2ROQA 4DG9A 2N50A 4H2XC 2FQ2A 2GDXA 2CQ8A 2MF4A 5KP6B 1VKUA 2AF8A 2JQ4A 2LIWA 4BPGA 5CZDB 2KOOA 4PWVB 5KP8B 1OR5A 1F80D 2LKIA 2GDYA 2KORA 2N98A 2FVAA 2K92A 1T8KA 2FADA 2K0YA 3GZLA 4MRTC 5HV8A 2DNWA 2PNGA 3EJBA 3CE7A 2MR8A 2JGPA 2KOQA 3LMOA 2AVAA 4R0MA 2KOSA 4HKGA 3NY7B 2MY5A 2KGAA 3EJDA 5KP7B 1HQBA 2MVVA 2FQ0A 2N6ZA 1KLPA 2KGCA 1AF8A 5EJDA 2MD9A 4IZ6A 3RG2A 4CA3A 3EJEA 2FVEA 2LIUA 1NQ4A 2EHSA 2FAEA 2LMLA 2QNWA 2K2QA 2KG8A 2N6YA 2L0QA 2L4BA
chains in the Genus database with same CATH superfamily
3GZMA 2P9XA 1A8OA 2M8PA 5F2KA 4QNBA 1IMPA 1HY8A 4BPHA 1IMQA 2VLOA 1K30A 3VRLC 2XZ0D 1ACPA 1M6NA 1YJWP 3CC7P 3CMEP 2L22A 2FQ1A 3E2DA 2PEQA 1E0HA 1RO0A 2JU2A 4H2WC 2KWLA 1S72P 2K94A 2FVFA 2KGDA 1M1KQ 1BXIA 1VQLP 2XV6A 1M90Q 5DCKA 2N5HA 1GPJA 2OTJP 2WPTA 3I55P 3G4SP 2ROQA 4F37A 3H0DA 2N50A 1VQ9P 1YI2P 3DTJA 2MF4A 3CCSP 3G1IA 7CEIA 5F2OA 1VQPP 3OW2O 1JJ2O 2NO8A 2CWOA 1M74A 1D1DA 2PEIA 3U43A 2MR8A 1EOQA 3G21A 1YHQP 3G1GA 2MY5A 2OTLP 3EJDA 1YIJP 5KP7B 5HGOA 4U0EA 2N6ZA 5EJDA 2MD9A 1AYIA 1VQ4P 2L6EA 5F2NA 2GZEA 1NQ4A 2QNWA 2K2QA 2KG8A 2EIAA 3CCLP 2L0QA 1W2BO 1AUMA 2DGYA 2M5RA 2VLPA 1KD1Q 4GR6A 2CGQA 2N5IA 3CCMP 3G28A 3CCJP 2K0DX 3CCQP 4PXHB 4XFYA 2JB0A 2GDWA 4UHPB 1Q81Q 3RG6C 2GZFA 3LRYA 4PH0A 2L9FA 2EHTA 1CEIA 2K93A 5HVCA 2KOPA 3CCRP 5I4TG 3CPWO 2KGEA 2Z46A 2EFJA 1DNYA 3M1MA 2LL8A 2LOLA 2KG6A 2K5XA 3HYBA 3Q20A 3H4EA 2GDXA 2CQ8A 2BUOA 4IPYA 2JQ4A 4PWVB 1KC8Q 1K8AQ 2LKIA 2GDYA 2KORA 2KODA 1T8KA 2K0YA 4MRTC 2DNWA 2PEKA 1IUQA 5HGMA 2JYGA 3MGEA 4WYMA 4XFXA 2KOQA 3LMOA 2AVAA 4HKGA 4GR2A 1HQBA 2GZGA 1GXGA 1M6EX 2VLNA 2KGCA 4IZ6A 2FVEA 2LIUA 3G26A 1MZ8A 2PEOA 4COCA 3P05A 2X2BA 4PH1A 1QRJA 2AFDA 1K73Q 4H2YC 2AFEA 2JU1A 2FHSC 2PENA 1VQMP 2MVUA 1Q82Q 2KR5A 2PEJA 4U0CA 1KQSO 2ONTA 2XZ1C 3CMAP 1X3OA 2FACA 2E1MA 3CC2P 1EMVA 1EIAA 3CC4P 2JO0A 4U0AA 2LPKA 1L0IA 2BHVA 2CG5B 4NEOA 4DG9A 1N8RQ 4H2XC 2FQ2A 1YITP 2JAZA 3DS1A 1UNKA 3CD6P 5HGLA 3DS0A 5KP6B 2AF8A 2Z45A 2KOOA 3DS3A 2PEMA 5KP8B 1F80D 3DS2A 2GYKA 3NTEA 1ZMBA 1VQ7P 2FVAA 2GZJA 2FADA 1Z6MA 3GZLA 1BAJA 4M0IA 3B4QA 2GZIA 3G6EP 1UJZA 2XXMA 3CE7A 4R0MA 2KOSA 1YJNP 3NY7B 2M8NA 1VQKP 3GKLC 1AF8A 2PY8A 3B5IA 4U0DA 3DPHA 1GXHA 1YJ9P 3G0VA 4U0BA 2EG5A 2LMLA 1RO2A 2Z44A 5BS2A 1VQNP 4XROA 2N6YA 1VQ6P 3G29A 3DS5A 2VSQA 4U0FA 2LTEA 2KG9A 2MR7A 1L0HA 2VLQA 2K0XA 3HZQA 2ERHA 1NJIQ 2OARA 1VQ5P 1E6JP 2KW2A 1DV5A 2LF4A 2CNRA 3CXCO 4BPFA 3G71P 4COPA 1Q7YQ 3CCEP 2QEXP 1FR2A 1VKUA 2LIWA 4BPGA 5CZDB 1OR5A 3CCUP 3CCVP 2QA4P 2N98A 5JPAA 3H47A 1QVGO 2K92A 2JYLA 5HV8A 4XFZA 3WBHA 1VQOP 1RNIA 1ZNVA 2PNGA 3EJBA 1K9MQ 1A43A 1QVFO 2JGPA 4XRQA 2KGAA 5EW5E 3DS4A 2MVVA 2FQ0A 2XT1A 2JBGA 1KLPA 3GJNA 5HGNA 1VHNA 2M8LA 3RG2A 4CA3A 3EJEA 2EHSA 1Q86Q 2FAEA 3I56P 4QKOA 1VQ8P 5BS1A 2L4BA
chains in the Genus database with same CATH topology
3GZMA 2X2BA 2M5RA 2VSQA 1HY8A 4BPHA 2AFDA 4H2YC 2CGQA 2N5IA 2LTEA 2AFEA 2JU1A 2FHSC 2KG9A 2MR7A 2XZ0D 1ACPA 1L0HA 4PXHB 2MVUA 2KR5A 2GDWA 2L22A 2FQ1A 2K0XA 2XZ1C 2JU2A 2L9FA 4H2WC 2KWLA 2EHTA 1X3OA 2FACA 2KW2A 2K94A 2FVFA 2KGDA 2K93A 5HVCA 2KOPA 1DV5A 2CNRA 2KGEA 4BPFA 2N5HA 1DNYA 2LPKA 1L0IA 2CG5B 2LL8A 2LOLA 2KG6A 4NEOA 2ROQA 4DG9A 2N50A 4H2XC 2FQ2A 2GDXA 2CQ8A 2MF4A 5KP6B 1VKUA 2AF8A 2JQ4A 2LIWA 4BPGA 5CZDB 2KOOA 4PWVB 5KP8B 1OR5A 1F80D 2LKIA 2GDYA 2KORA 2N98A 2FVAA 2K92A 1T8KA 2FADA 2K0YA 3GZLA 4MRTC 5HV8A 2DNWA 2PNGA 3EJBA 3CE7A 2MR8A 2JGPA 2KOQA 3LMOA 2AVAA 4R0MA 2KOSA 4HKGA 3NY7B 2MY5A 2KGAA 3EJDA 5KP7B 1HQBA 2MVVA 2FQ0A 2N6ZA 1KLPA 2KGCA 1AF8A 5EJDA 2MD9A 4IZ6A 3RG2A 4CA3A 3EJEA 2FVEA 2LIUA 1NQ4A 2EHSA 2FAEA 2LMLA 2QNWA 2K2QA 2KG8A 2N6YA 2L0QA 2L4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZM A;  2X2B A;  2M5R A;  2VSQ A;  1HY8 A;  4BPH A;  2AFD A;  4H2Y C;  2CGQ A;  2N5I A;  2LTE A;  2AFE A;  2JU1 A;  2FHS C;  2KG9 A;  2MR7 A;  2XZ0 D;  1ACP A;  1L0H A;  4PXH B;  2MVU A;  2KR5 A;  2GDW A;  2L22 A;  2FQ1 A;  2K0X A;  2XZ1 C;  2JU2 A;  2L9F A;  4H2W C;  2KWL A;  2EHT A;  1X3O A;  2FAC A;  2KW2 A;  2K94 A;  2FVF A;  2KGD A;  2K93 A;  5HVC A;  2KOP A;  1DV5 A;  2CNR A;  2KGE A;  4BPF A;  2N5H A;  1DNY A;  2LPK A;  1L0I A;  2CG5 B;  2LL8 A;  2LOL A;  2KG6 A;  4NEO A;  2ROQ A;  4DG9 A;  2N50 A;  4H2X C;  2FQ2 A;  2GDX A;  2CQ8 A;  2MF4 A;  5KP6 B;  1VKU A;  2AF8 A;  2JQ4 A;  2LIW A;  4BPG A;  5CZD B;  2KOO A;  4PWV B;  5KP8 B;  1OR5 A;  1F80 D;  2LKI A;  2GDY A;  2KOR A;  2N98 A;  2FVA A;  2K92 A;  1T8K A;  2FAD A;  2K0Y A;  3GZL A;  4MRT C;  5HV8 A;  2DNW A;  2PNG A;  3EJB A;  3CE7 A;  2MR8 A;  2JGP A;  2KOQ A;  3LMO A;  2AVA A;  4R0M A;  2KOS A;  4HKG A;  3NY7 B;  2MY5 A;  2KGA A;  3EJD A;  5KP7 B;  1HQB A;  2MVV A;  2FQ0 A;  2N6Z A;  1KLP A;  2KGC A;  1AF8 A;  5EJD A;  2MD9 A;  4IZ6 A;  3RG2 A;  4CA3 A;  3EJE A;  2FVE A;  2LIU A;  1NQ4 A;  2EHS A;  2FAE A;  2LML A;  2QNW A;  2K2Q A;  2KG8 A;  2N6Y A;  2L0Q A;  2L4B A; 
#chains in the Genus database with same CATH topology
 3GZM A;  2P9X A;  1A8O A;  2M8P A;  5F2K A;  4QNB A;  1IMP A;  1HY8 A;  4BPH A;  1IMQ A;  2VLO A;  1K30 A;  3VRL C;  2XZ0 D;  1ACP A;  1M6N A;  1YJW P;  3CC7 P;  3CME P;  2L22 A;  2FQ1 A;  3E2D A;  2PEQ A;  1E0H A;  1RO0 A;  2JU2 A;  4H2W C;  2KWL A;  1S72 P;  2K94 A;  2FVF A;  2KGD A;  1M1K Q;  1BXI A;  1VQL P;  2XV6 A;  1M90 Q;  5DCK A;  2N5H A;  1GPJ A;  2OTJ P;  2WPT A;  3I55 P;  3G4S P;  2ROQ A;  4F37 A;  3H0D A;  2N50 A;  1VQ9 P;  1YI2 P;  3DTJ A;  2MF4 A;  3CCS P;  3G1I A;  7CEI A;  5F2O A;  1VQP P;  3OW2 O;  1JJ2 O;  2NO8 A;  2CWO A;  1M74 A;  1D1D A;  2PEI A;  3U43 A;  2MR8 A;  1EOQ A;  3G21 A;  1YHQ P;  3G1G A;  2MY5 A;  2OTL P;  3EJD A;  1YIJ P;  5KP7 B;  5HGO A;  4U0E A;  2N6Z A;  5EJD A;  2MD9 A;  1AYI A;  1VQ4 P;  2L6E A;  5F2N A;  2GZE A;  1NQ4 A;  2QNW A;  2K2Q A;  2KG8 A;  2EIA A;  3CCL P;  2L0Q A;  1W2B O;  1AUM A;  2DGY A;  2M5R A;  2VLP A;  1KD1 Q;  4GR6 A;  2CGQ A;  2N5I A;  3CCM P;  3G28 A;  3CCJ P;  2K0D X;  3CCQ P;  4PXH B;  4XFY A;  2JB0 A;  2GDW A;  4UHP B;  1Q81 Q;  3RG6 C;  2GZF A;  3LRY A;  4PH0 A;  2L9F A;  2EHT A;  1CEI A;  2K93 A;  5HVC A;  2KOP A;  3CCR P;  5I4T G;  3CPW O;  2KGE A;  2Z46 A;  2EFJ A;  1DNY A;  3M1M A;  2LL8 A;  2LOL A;  2KG6 A;  2K5X A;  3HYB A;  3Q20 A;  3H4E A;  2GDX A;  2CQ8 A;  2BUO A;  4IPY A;  2JQ4 A;  4PWV B;  1KC8 Q;  1K8A Q;  2LKI A;  2GDY A;  2KOR A;  2KOD A;  1T8K A;  2K0Y A;  4MRT C;  2DNW A;  2PEK A;  1IUQ A;  5HGM A;  2JYG A;  3MGE A;  4WYM A;  4XFX A;  2KOQ A;  3LMO A;  2AVA A;  4HKG A;  4GR2 A;  1HQB A;  2GZG A;  1GXG A;  1M6E X;  2VLN A;  2KGC A;  4IZ6 A;  2FVE A;  2LIU A;  3G26 A;  1MZ8 A;  2PEO A;  4COC A;  3P05 A;  2X2B A;  4PH1 A;  1QRJ A;  2AFD A;  1K73 Q;  4H2Y C;  2AFE A;  2JU1 A;  2FHS C;  2PEN A;  1VQM P;  2MVU A;  1Q82 Q;  2KR5 A;  2PEJ A;  4U0C A;  1KQS O;  2ONT A;  2XZ1 C;  3CMA P;  1X3O A;  2FAC A;  2E1M A;  3CC2 P;  1EMV A;  1EIA A;  3CC4 P;  2JO0 A;  4U0A A;  2LPK A;  1L0I A;  2BHV A;  2CG5 B;  4NEO A;  4DG9 A;  1N8R Q;  4H2X C;  2FQ2 A;  1YIT P;  2JAZ A;  3DS1 A;  1UNK A;  3CD6 P;  5HGL A;  3DS0 A;  5KP6 B;  2AF8 A;  2Z45 A;  2KOO A;  3DS3 A;  2PEM A;  5KP8 B;  1F80 D;  3DS2 A;  2GYK A;  3NTE A;  1ZMB A;  1VQ7 P;  2FVA A;  2GZJ A;  2FAD A;  1Z6M A;  3GZL A;  1BAJ A;  4M0I A;  3B4Q A;  2GZI A;  3G6E P;  1UJZ A;  2XXM A;  3CE7 A;  4R0M A;  2KOS A;  1YJN P;  3NY7 B;  2M8N A;  1VQK P;  3GKL C;  1AF8 A;  2PY8 A;  3B5I A;  4U0D A;  3DPH A;  1GXH A;  1YJ9 P;  3G0V A;  4U0B A;  2EG5 A;  2LML A;  1RO2 A;  2Z44 A;  5BS2 A;  1VQN P;  4XRO A;  2N6Y A;  1VQ6 P;  3G29 A;  3DS5 A;  2VSQ A;  4U0F A;  2LTE A;  2KG9 A;  2MR7 A;  1L0H A;  2VLQ A;  2K0X A;  3HZQ A;  2ERH A;  1NJI Q;  2OAR A;  1VQ5 P;  1E6J P;  2KW2 A;  1DV5 A;  2LF4 A;  2CNR A;  3CXC O;  4BPF A;  3G71 P;  4COP A;  1Q7Y Q;  3CCE P;  2QEX P;  1FR2 A;  1VKU A;  2LIW A;  4BPG A;  5CZD B;  1OR5 A;  3CCU P;  3CCV P;  2QA4 P;  2N98 A;  5JPA A;  3H47 A;  1QVG O;  2K92 A;  2JYL A;  5HV8 A;  4XFZ A;  3WBH A;  1VQO P;  1RNI A;  1ZNV A;  2PNG A;  3EJB A;  1K9M Q;  1A43 A;  1QVF O;  2JGP A;  4XRQ A;  2KGA A;  5EW5 E;  3DS4 A;  2MVV A;  2FQ0 A;  2XT1 A;  2JBG A;  1KLP A;  3GJN A;  5HGN A;  1VHN A;  2M8L A;  3RG2 A;  4CA3 A;  3EJE A;  2EHS A;  1Q86 Q;  2FAE A;  3I56 P;  4QKO A;  1VQ8 P;  5BS1 A;  2L4B A; 
#chains in the Genus database with same CATH homology
 3GZM A;  2X2B A;  2M5R A;  2VSQ A;  1HY8 A;  4BPH A;  2AFD A;  4H2Y C;  2CGQ A;  2N5I A;  2LTE A;  2AFE A;  2JU1 A;  2FHS C;  2KG9 A;  2MR7 A;  2XZ0 D;  1ACP A;  1L0H A;  4PXH B;  2MVU A;  2KR5 A;  2GDW A;  2L22 A;  2FQ1 A;  2K0X A;  2XZ1 C;  2JU2 A;  2L9F A;  4H2W C;  2KWL A;  2EHT A;  1X3O A;  2FAC A;  2KW2 A;  2K94 A;  2FVF A;  2KGD A;  2K93 A;  5HVC A;  2KOP A;  1DV5 A;  2CNR A;  2KGE A;  4BPF A;  2N5H A;  1DNY A;  2LPK A;  1L0I A;  2CG5 B;  2LL8 A;  2LOL A;  2KG6 A;  4NEO A;  2ROQ A;  4DG9 A;  2N50 A;  4H2X C;  2FQ2 A;  2GDX A;  2CQ8 A;  2MF4 A;  5KP6 B;  1VKU A;  2AF8 A;  2JQ4 A;  2LIW A;  4BPG A;  5CZD B;  2KOO A;  4PWV B;  5KP8 B;  1OR5 A;  1F80 D;  2LKI A;  2GDY A;  2KOR A;  2N98 A;  2FVA A;  2K92 A;  1T8K A;  2FAD A;  2K0Y A;  3GZL A;  4MRT C;  5HV8 A;  2DNW A;  2PNG A;  3EJB A;  3CE7 A;  2MR8 A;  2JGP A;  2KOQ A;  3LMO A;  2AVA A;  4R0M A;  2KOS A;  4HKG A;  3NY7 B;  2MY5 A;  2KGA A;  3EJD A;  5KP7 B;  1HQB A;  2MVV A;  2FQ0 A;  2N6Z A;  1KLP A;  2KGC A;  1AF8 A;  5EJD A;  2MD9 A;  4IZ6 A;  3RG2 A;  4CA3 A;  3EJE A;  2FVE A;  2LIU A;  1NQ4 A;  2EHS A;  2FAE A;  2LML A;  2QNW A;  2K2Q A;  2KG8 A;  2N6Y A;  2L0Q A;  2L4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...