5KP6B

Crystal structure of the curacin biosynthetic pathway hmg synthase in complex with apo donor-acp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVMEDLSLNIPRIELAGAKNIGELADLFAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anatomy of the beta-branching enzyme of polyketide biosynthesis and its interaction with an acyl-ACP substrate.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Transferase
molecule keywords CurD
total genus 27
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5kp6B00
3EJEA 2AFEA 2FADA 5HV8A 1KLPA 2KR5A 2LTEA 2FHSC 2K94A 2JU2A 2LMLA 2ROQA 2LPKA 1T8KA 5CZDB 4PXHB 2MVUA 2GDXA 3EJBA 2GDYA 2PNGA 2KOPA 1DV5A 2LKIA 1L0IA 1VKUA 2N5IA 2K93A 1AF8A 2AFDA 2K0XA 2AVAA 2MF4A 4MRTC 2CQ8A 2KG6A 2K2QA 2KGEA 3RG2A 2FQ1A 4H2WC 2N50A 1HQBA 2LIWA 2L0QA 2KGAA 4CA3A 2KG9A 5HVCA 2MY5A 1HY8A 2XZ0D 5KP6B 3EJDA 2QNWA 1F80D 2K0YA 4BPGA 2N6ZA 2VSQA 3CE7A 2JU1A 2XZ1C 3NY7B 2CGQA 2N6YA 2MVVA 4PWVB 2FQ0A 2KW2A 2KOQA 4BPHA 2MD9A 2LL8A 2GDWA 1L0HA 4BPFA 2FQ2A 2KG8A 2N5HA 2N98A 4H2YC 2KWLA 2JQ4A 4HKGA 2M5RA 4R0MA 1X3OA 3LMOA 5EJDA 5KP7B 2FVFA 4NEOA 2L9FA 2FAEA 2MR8A 1NQ4A 4DG9A 2KGDA 2MR7A 2FVEA 2KGCA 3GZMA 2DNWA 2KOOA 3GZLA 2K92A 4IZ6A 2LIUA 2KOSA 2KORA 2CG5B 1ACPA 2EHSA 1DNYA 2AF8A 4H2XC 2FACA 2JGPA 2X2BA 2LOLA 2FVAA 2CNRA 2L4BA 2EHTA 1OR5A 5KP8B 2L22A
chains in the Genus database with same CATH superfamily
1GXGA 2PEMA 2LTEA 4XROA 2LMLA 2PEKA 4XFYA 2OTJP 1VQ7P 4XRQA 3CCQP 2GDXA 1Q7YQ 2OTLP 2GDYA 1DV5A 2LKIA 1VQOP 2BUOA 2CQ8A 1GXHA 1M74A 1M6NA 3G26A 3DTJA 3U43A 2M8PA 1M6EX 1F80D 3HZQA 5HGOA 2LF4A 3CE7A 3WBHA 3VRLC 3Q20A 2CGQA 3CCUP 4XFZA 3CC4P 1UJZA 4BPHA 3G21A 4U0CA 1YHQP 2LL8A 2N5HA 4H2YC 1VQ8P 1RO0A 2EFJA 1X3OA 2BHVA 3CC7P 5EJDA 5KP7B 3RG6C 2FAEA 2VLPA 2MR7A 2KGCA 2K92A 3GJNA 3G29A 3DS5A 1K30A 2Z44A 2EHSA 1DNYA 1VQ4P 2JGPA 2LOLA 2CNRA 2Z45A 3P05A 2JO0A 3CMAP 3EJEA 1KLPA 2K94A 3DPHA 4COPA 1YJNP 2LPKA 5DCKA 1VKUA 1CEIA 2K93A 1AF8A 2AFDA 1YJWP 2K0XA 4MRTC 2VLNA 2XV6A 2Z46A 2CWOA 1QRJA 2L6EA 1HQBA 1W2BO 2L0QA 2MY5A 1YITP 3HYBA 3EJDA 5KP6B 2QNWA 1IUQA 1AYIA 1VQ6P 2PEJA 5BS2A 1GPJA 3GKLC 2JB0A 2PENA 2VSQA 4UHPB 4U0EA 2WPTA 3G1IA 2FQ0A 2KOQA 5F2KA 2MD9A 3CC2P 2ONTA 3CCRP 1ZMBA 2XXMA 2KG8A 1Q82Q 1A8OA 2VLOA 1AUMA 2KWLA 5HGMA 2EIAA 4R0MA 1D1DA 3LMOA 1ZNVA 2JAZA 2KGDA 5I4TG 1NJIQ 2DNWA 4U0BA 3GZLA 1M1KQ 2LIUA 2KOSA 2GZIA 3B4QA 1ACPA 4WYMA 2AF8A 4GR6A 2FACA 1N8RQ 2L4BA 1MZ8A 1VQPP 3DS2A 2JYLA 2AFEA 2FADA 5HV8A 2KR5A 2FHSC 3MGEA 3CCEP 4PXHB 5BS1A 3G1GA 2DGYA 3CCMP 1L0IA 3H47A 3CD6P 1VQLP 2AVAA 1E6JP 2KG6A 1YIJP 2KGEA 1K9MQ 2FQ1A 1K8AQ 4H2WC 1QVFO 2N50A 2LIWA 2KGAA 2KG9A 5HVCA 2K0DX 1HY8A 3I56P 2QA4P 1YI2P 5HGNA 4U0FA 2JYGA 1FR2A 2XT1A 2GZFA 5HGLA 2N6ZA 1KC8Q 2JBGA 4U0DA 2JU1A 2ERHA 4M0IA 2PEIA 5EW5E 1BAJA 2XZ1C 3CMEP 3M1MA 3CCLP 2KW2A 5F2NA 4F37A 1VQ9P 2QEXP 1S72P 2EG5A 1YJ9P 2GDWA 1L0HA 4BPFA 1K73Q 2FQ2A 3DS3A 1VQ5P 1QVGO 2M8LA 3OW2O 4U0AA 4COCA 4QKOA 2FVFA 4NEOA 2MR8A 4GR2A 3E2DA 2FVEA 1KQSO 3G6EP 2KOOA 1Q86Q 4IZ6A 3DS4A 2CG5B 2E1MA 3CCVP 4H2XC 1EIAA 2X2BA 2FVAA 3I55P 1OR5A 2PEOA 5KP8B 1EMVA 2L22A 2P9XA 3B5IA 2JU2A 4PH0A 2ROQA 1T8KA 5CZDB 2MVUA 3EJBA 2PNGA 2KOPA 2N5IA 3H4EA 1IMQA 1Z6MA 2MF4A 3G0VA 2K2QA 7CEIA 3RG2A 1VQMP 2K5XA 1RNIA 2NO8A 1A43A 1UNKA 3G4SP 4CA3A 3DS0A 2GZGA 2VLQA 1E0HA 1JJ2O 2XZ0D 2GYKA 3H0DA 1EOQA 3G28A 2K0YA 3DS1A 4BPGA 5F2OA 3G71P 1IMPA 4XFXA 1VQKP 3NY7B 2N6YA 2MVVA 3NTEA 4PWVB 3CPWO 2OARA 4IPYA 2KODA 2M8NA 1RO2A 2N98A 2JQ4A 4HKGA 2M5RA 2PEQA 2PY8A 2L9FA 1BXIA 1NQ4A 4DG9A 1VQNP 4PH1A 2GZJA 3GZMA 1KD1Q 2KORA 2GZEA 3LRYA 1M90Q 4QNBA 3CCSP 1VHNA 3CCJP 5JPAA 2EHTA 1Q81Q 3CXCO
chains in the Genus database with same CATH topology
3EJEA 2AFEA 2FADA 5HV8A 1KLPA 2KR5A 2LTEA 2FHSC 2K94A 2JU2A 2LMLA 2ROQA 2LPKA 1T8KA 5CZDB 4PXHB 2MVUA 2GDXA 3EJBA 2GDYA 2PNGA 2KOPA 1DV5A 2LKIA 1L0IA 1VKUA 2N5IA 2K93A 1AF8A 2AFDA 2K0XA 2AVAA 2MF4A 4MRTC 2CQ8A 2KG6A 2K2QA 2KGEA 3RG2A 2FQ1A 4H2WC 2N50A 1HQBA 2LIWA 2L0QA 2KGAA 4CA3A 2KG9A 5HVCA 2MY5A 1HY8A 2XZ0D 5KP6B 3EJDA 2QNWA 1F80D 2K0YA 4BPGA 2N6ZA 2VSQA 3CE7A 2JU1A 2XZ1C 3NY7B 2CGQA 2N6YA 2MVVA 4PWVB 2FQ0A 2KW2A 2KOQA 4BPHA 2MD9A 2LL8A 2GDWA 1L0HA 4BPFA 2FQ2A 2KG8A 2N5HA 2N98A 4H2YC 2KWLA 2JQ4A 4HKGA 2M5RA 4R0MA 1X3OA 3LMOA 5EJDA 5KP7B 2FVFA 4NEOA 2L9FA 2FAEA 2MR8A 1NQ4A 4DG9A 2KGDA 2MR7A 2FVEA 2KGCA 3GZMA 2DNWA 2KOOA 3GZLA 2K92A 4IZ6A 2LIUA 2KOSA 2KORA 2CG5B 1ACPA 2EHSA 1DNYA 2AF8A 4H2XC 2FACA 2JGPA 2X2BA 2LOLA 2FVAA 2CNRA 2L4BA 2EHTA 1OR5A 5KP8B 2L22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJE A;  2AFE A;  2FAD A;  5HV8 A;  1KLP A;  2KR5 A;  2LTE A;  2FHS C;  2K94 A;  2JU2 A;  2LML A;  2ROQ A;  2LPK A;  1T8K A;  5CZD B;  4PXH B;  2MVU A;  2GDX A;  3EJB A;  2GDY A;  2PNG A;  2KOP A;  1DV5 A;  2LKI A;  1L0I A;  1VKU A;  2N5I A;  2K93 A;  1AF8 A;  2AFD A;  2K0X A;  2AVA A;  2MF4 A;  4MRT C;  2CQ8 A;  2KG6 A;  2K2Q A;  2KGE A;  3RG2 A;  2FQ1 A;  4H2W C;  2N50 A;  1HQB A;  2LIW A;  2L0Q A;  2KGA A;  4CA3 A;  2KG9 A;  5HVC A;  2MY5 A;  1HY8 A;  2XZ0 D;  5KP6 B;  3EJD A;  2QNW A;  1F80 D;  2K0Y A;  4BPG A;  2N6Z A;  2VSQ A;  3CE7 A;  2JU1 A;  2XZ1 C;  3NY7 B;  2CGQ A;  2N6Y A;  2MVV A;  4PWV B;  2FQ0 A;  2KW2 A;  2KOQ A;  4BPH A;  2MD9 A;  2LL8 A;  2GDW A;  1L0H A;  4BPF A;  2FQ2 A;  2KG8 A;  2N5H A;  2N98 A;  4H2Y C;  2KWL A;  2JQ4 A;  4HKG A;  2M5R A;  4R0M A;  1X3O A;  3LMO A;  5EJD A;  5KP7 B;  2FVF A;  4NEO A;  2L9F A;  2FAE A;  2MR8 A;  1NQ4 A;  4DG9 A;  2KGD A;  2MR7 A;  2FVE A;  2KGC A;  3GZM A;  2DNW A;  2KOO A;  3GZL A;  2K92 A;  4IZ6 A;  2LIU A;  2KOS A;  2KOR A;  2CG5 B;  1ACP A;  2EHS A;  1DNY A;  2AF8 A;  4H2X C;  2FAC A;  2JGP A;  2X2B A;  2LOL A;  2FVA A;  2CNR A;  2L4B A;  2EHT A;  1OR5 A;  5KP8 B;  2L22 A; 
#chains in the Genus database with same CATH topology
 1GXG A;  2PEM A;  2LTE A;  4XRO A;  2LML A;  2PEK A;  4XFY A;  2OTJ P;  1VQ7 P;  4XRQ A;  3CCQ P;  2GDX A;  1Q7Y Q;  2OTL P;  2GDY A;  1DV5 A;  2LKI A;  1VQO P;  2BUO A;  2CQ8 A;  1GXH A;  1M74 A;  1M6N A;  3G26 A;  3DTJ A;  3U43 A;  2M8P A;  1M6E X;  1F80 D;  3HZQ A;  5HGO A;  2LF4 A;  3CE7 A;  3WBH A;  3VRL C;  3Q20 A;  2CGQ A;  3CCU P;  4XFZ A;  3CC4 P;  1UJZ A;  4BPH A;  3G21 A;  4U0C A;  1YHQ P;  2LL8 A;  2N5H A;  4H2Y C;  1VQ8 P;  1RO0 A;  2EFJ A;  1X3O A;  2BHV A;  3CC7 P;  5EJD A;  5KP7 B;  3RG6 C;  2FAE A;  2VLP A;  2MR7 A;  2KGC A;  2K92 A;  3GJN A;  3G29 A;  3DS5 A;  1K30 A;  2Z44 A;  2EHS A;  1DNY A;  1VQ4 P;  2JGP A;  2LOL A;  2CNR A;  2Z45 A;  3P05 A;  2JO0 A;  3CMA P;  3EJE A;  1KLP A;  2K94 A;  3DPH A;  4COP A;  1YJN P;  2LPK A;  5DCK A;  1VKU A;  1CEI A;  2K93 A;  1AF8 A;  2AFD A;  1YJW P;  2K0X A;  4MRT C;  2VLN A;  2XV6 A;  2Z46 A;  2CWO A;  1QRJ A;  2L6E A;  1HQB A;  1W2B O;  2L0Q A;  2MY5 A;  1YIT P;  3HYB A;  3EJD A;  5KP6 B;  2QNW A;  1IUQ A;  1AYI A;  1VQ6 P;  2PEJ A;  5BS2 A;  1GPJ A;  3GKL C;  2JB0 A;  2PEN A;  2VSQ A;  4UHP B;  4U0E A;  2WPT A;  3G1I A;  2FQ0 A;  2KOQ A;  5F2K A;  2MD9 A;  3CC2 P;  2ONT A;  3CCR P;  1ZMB A;  2XXM A;  2KG8 A;  1Q82 Q;  1A8O A;  2VLO A;  1AUM A;  2KWL A;  5HGM A;  2EIA A;  4R0M A;  1D1D A;  3LMO A;  1ZNV A;  2JAZ A;  2KGD A;  5I4T G;  1NJI Q;  2DNW A;  4U0B A;  3GZL A;  1M1K Q;  2LIU A;  2KOS A;  2GZI A;  3B4Q A;  1ACP A;  4WYM A;  2AF8 A;  4GR6 A;  2FAC A;  1N8R Q;  2L4B A;  1MZ8 A;  1VQP P;  3DS2 A;  2JYL A;  2AFE A;  2FAD A;  5HV8 A;  2KR5 A;  2FHS C;  3MGE A;  3CCE P;  4PXH B;  5BS1 A;  3G1G A;  2DGY A;  3CCM P;  1L0I A;  3H47 A;  3CD6 P;  1VQL P;  2AVA A;  1E6J P;  2KG6 A;  1YIJ P;  2KGE A;  1K9M Q;  2FQ1 A;  1K8A Q;  4H2W C;  1QVF O;  2N50 A;  2LIW A;  2KGA A;  2KG9 A;  5HVC A;  2K0D X;  1HY8 A;  3I56 P;  2QA4 P;  1YI2 P;  5HGN A;  4U0F A;  2JYG A;  1FR2 A;  2XT1 A;  2GZF A;  5HGL A;  2N6Z A;  1KC8 Q;  2JBG A;  4U0D A;  2JU1 A;  2ERH A;  4M0I A;  2PEI A;  5EW5 E;  1BAJ A;  2XZ1 C;  3CME P;  3M1M A;  3CCL P;  2KW2 A;  5F2N A;  4F37 A;  1VQ9 P;  2QEX P;  1S72 P;  2EG5 A;  1YJ9 P;  2GDW A;  1L0H A;  4BPF A;  1K73 Q;  2FQ2 A;  3DS3 A;  1VQ5 P;  1QVG O;  2M8L A;  3OW2 O;  4U0A A;  4COC A;  4QKO A;  2FVF A;  4NEO A;  2MR8 A;  4GR2 A;  3E2D A;  2FVE A;  1KQS O;  3G6E P;  2KOO A;  1Q86 Q;  4IZ6 A;  3DS4 A;  2CG5 B;  2E1M A;  3CCV P;  4H2X C;  1EIA A;  2X2B A;  2FVA A;  3I55 P;  1OR5 A;  2PEO A;  5KP8 B;  1EMV A;  2L22 A;  2P9X A;  3B5I A;  2JU2 A;  4PH0 A;  2ROQ A;  1T8K A;  5CZD B;  2MVU A;  3EJB A;  2PNG A;  2KOP A;  2N5I A;  3H4E A;  1IMQ A;  1Z6M A;  2MF4 A;  3G0V A;  2K2Q A;  7CEI A;  3RG2 A;  1VQM P;  2K5X A;  1RNI A;  2NO8 A;  1A43 A;  1UNK A;  3G4S P;  4CA3 A;  3DS0 A;  2GZG A;  2VLQ A;  1E0H A;  1JJ2 O;  2XZ0 D;  2GYK A;  3H0D A;  1EOQ A;  3G28 A;  2K0Y A;  3DS1 A;  4BPG A;  5F2O A;  3G71 P;  1IMP A;  4XFX A;  1VQK P;  3NY7 B;  2N6Y A;  2MVV A;  3NTE A;  4PWV B;  3CPW O;  2OAR A;  4IPY A;  2KOD A;  2M8N A;  1RO2 A;  2N98 A;  2JQ4 A;  4HKG A;  2M5R A;  2PEQ A;  2PY8 A;  2L9F A;  1BXI A;  1NQ4 A;  4DG9 A;  1VQN P;  4PH1 A;  2GZJ A;  3GZM A;  1KD1 Q;  2KOR A;  2GZE A;  3LRY A;  1M90 Q;  4QNB A;  3CCS P;  1VHN A;  3CCJ P;  5JPA A;  2EHT A;  1Q81 Q;  3CXC O; 
#chains in the Genus database with same CATH homology
 3EJE A;  2AFE A;  2FAD A;  5HV8 A;  1KLP A;  2KR5 A;  2LTE A;  2FHS C;  2K94 A;  2JU2 A;  2LML A;  2ROQ A;  2LPK A;  1T8K A;  5CZD B;  4PXH B;  2MVU A;  2GDX A;  3EJB A;  2GDY A;  2PNG A;  2KOP A;  1DV5 A;  2LKI A;  1L0I A;  1VKU A;  2N5I A;  2K93 A;  1AF8 A;  2AFD A;  2K0X A;  2AVA A;  2MF4 A;  4MRT C;  2CQ8 A;  2KG6 A;  2K2Q A;  2KGE A;  3RG2 A;  2FQ1 A;  4H2W C;  2N50 A;  1HQB A;  2LIW A;  2L0Q A;  2KGA A;  4CA3 A;  2KG9 A;  5HVC A;  2MY5 A;  1HY8 A;  2XZ0 D;  5KP6 B;  3EJD A;  2QNW A;  1F80 D;  2K0Y A;  4BPG A;  2N6Z A;  2VSQ A;  3CE7 A;  2JU1 A;  2XZ1 C;  3NY7 B;  2CGQ A;  2N6Y A;  2MVV A;  4PWV B;  2FQ0 A;  2KW2 A;  2KOQ A;  4BPH A;  2MD9 A;  2LL8 A;  2GDW A;  1L0H A;  4BPF A;  2FQ2 A;  2KG8 A;  2N5H A;  2N98 A;  4H2Y C;  2KWL A;  2JQ4 A;  4HKG A;  2M5R A;  4R0M A;  1X3O A;  3LMO A;  5EJD A;  5KP7 B;  2FVF A;  4NEO A;  2L9F A;  2FAE A;  2MR8 A;  1NQ4 A;  4DG9 A;  2KGD A;  2MR7 A;  2FVE A;  2KGC A;  3GZM A;  2DNW A;  2KOO A;  3GZL A;  2K92 A;  4IZ6 A;  2LIU A;  2KOS A;  2KOR A;  2CG5 B;  1ACP A;  2EHS A;  1DNY A;  2AF8 A;  4H2X C;  2FAC A;  2JGP A;  2X2B A;  2LOL A;  2FVA A;  2CNR A;  2L4B A;  2EHT A;  1OR5 A;  5KP8 B;  2L22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...