5KP6B

Crystal structure of the curacin biosynthetic pathway hmg synthase in complex with apo donor-acp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVMEDLSLNIPRIELAGAKNIGELADLFAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CurD
publication title Anatomy of the beta-branching enzyme of polyketide biosynthesis and its interaction with an acyl-ACP substrate.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Transferase
total genus 27
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5kp6B00
2KGCA 2MY5A 2MF4A 2AFEA 2KW2A 2JGPA 2KORA 3LMOA 2K0XA 2CG5B 1HY8A 2KGEA 1L0HA 5CZDB 4H2XC 4H2WC 3RG2A 2MR8A 2N98A 4BPGA 2FQ2A 1VKUA 2N50A 1AF8A 1NQ4A 2GDWA 2LIWA 2MD9A 5KP6B 1DV5A 2FVFA 2EHSA 2FAEA 1HQBA 2L4BA 4MRTC 2L9FA 2FQ0A 5HVCA 2MVUA 2JQ4A 1OR5A 4CA3A 2FACA 2DNWA 2KWLA 2KG6A 4BPFA 1KLPA 2ROQA 2PNGA 2MR7A 4R0MA 2LL8A 2KG9A 4BPHA 2JU2A 4HKGA 2LKIA 2N5HA 2K93A 2KG8A 4PXHB 2CQ8A 2GDXA 5EJDA 2K0YA 2AF8A 2K2QA 2LPKA 2KGAA 2MVVA 2EHTA 2CNRA 2FHSC 2LTEA 2L22A 2XZ1C 5HV8A 2KOQA 2LIUA 1F80D 2X2BA 2CGQA 2KOSA 2FVAA 5KP7B 2K92A 4PWVB 3EJEA 2FVEA 2XZ0D 4NEOA 2LMLA 1ACPA 4H2YC 4DG9A 1T8KA 2AVAA 2FADA 2KGDA 3CE7A 2KR5A 1X3OA 3GZMA 2QNWA 2KOOA 2VSQA 2N6YA 4IZ6A 3NY7B 5KP8B 3EJBA 2GDYA 2M5RA 2N6ZA 1DNYA 2FQ1A 2KOPA 2JU1A 2K94A 2N5IA 1L0IA 2LOLA 2AFDA 3EJDA 2L0QA 3GZLA
chains in the Genus database with same CATH superfamily
1BAJA 2CWOA 4F37A 2L6EA 2MY5A 1VQ5P 2MF4A 3CC2P 3NTEA 2KW2A 2JGPA 2K0XA 2EFJA 1HY8A 2KGEA 4H2XC 4H2WC 3RG2A 2MR8A 3DS2A 4IPYA 2VLNA 2FQ2A 2PEMA 3CPWO 2Z46A 4U0AA 2N50A 1AF8A 1YJNP 2DGYA 3P05A 1JJ2O 1HQBA 1VQ4P 3HYBA 2K5XA 3G26A 3CCQP 3G0VA 4COCA 4XFXA 1ZNVA 2FACA 2DNWA 1BXIA 2PEQA 2LL8A 2JO0A 4BPHA 3G6EP 2P9XA 4QKOA 4PXHB 2JBGA 5EJDA 2ERHA 2LPKA 3DS5A 2L22A 1UJZA 2KOQA 1EOQA 1F80D 5HGMA 3WBHA 4QNBA 2KOSA 4U0BA 1MZ8A 3G1IA 2LMLA 5HGNA 2QA4P 2BUOA 3CXCO 3DS4A 1X3OA 2N6YA 2GZGA 5KP8B 1M90Q 2GDYA 3GKLC 4UHPB 2KOPA 2JU1A 2K94A 2OTLP 2AFDA 2Z45A 4U0DA 3EJDA 3GZLA 2KGCA 1A8OA 1AUMA 4M0IA 3DS1A 2VLPA 1VQMP 1S72P 2AFEA 2KORA 3U43A 1UNKA 2N98A 1YI2P 2LIWA 2XT1A 1M6NA 2FVFA 2EHSA 2NO8A 2FAEA 3VRLC 3CCUP 1YJ9P 3G1GA 2M8NA 5HVCA 2E1MA 4U0CA 2JQ4A 3H47A 1IUQA 1M6EX 2KWLA 2ROQA 2BHVA 1FR2A 5F2NA 1VQ8P 1Q86Q 3CCLP 1KC8Q 5F2OA 2N5HA 1A43A 2K93A 3CCSP 3CCRP 1AYIA 1E6JP 1VQ9P 2K2QA 2KGAA 3E2DA 1QVFO 2EHTA 2FHSC 2GZFA 3G29A 3OW2O 2LIUA 2X2BA 1ZMBA 4U0EA 3CC7P 3EJEA 1Q82Q 2FVEA 2XZ0D 1Z6MA 1ACPA 4H2YC 5BS1A 4DG9A 2AVAA 2QEXP 3RG6C 3G28A 5I4TG 4COPA 2WPTA 4PH1A 3GZMA 3NY7B 3EJBA 4XFZA 2PEKA 1Q81Q 2VLQA 2PEJA 3B4QA 2GZJA 2GZEA 3LMOA 1GXGA 1L0HA 2EG5A 1QVGO 1IMQA 1NQ4A 4GR2A 1K9MQ 5KP6B 2L4BA 1M1KQ 1VQKP 4U0FA 3DS3A 2FQ0A 4GR6A 2MVUA 1IMPA 1K73Q 1OR5A 2K0DX 4CA3A 2PY8A 3G4SP 2KG6A 1N8RQ 3Q20A 3LRYA 2PNGA 3H0DA 2JU2A 3CMAP 2LKIA 4XFYA 1VQLP 2KG8A 4XROA 2K0YA 4PH0A 2AF8A 5EW5E 2CNRA 1E0HA 3M1MA 1VQ6P 3B5IA 5KP7B 2K92A 2JB0A 1K8AQ 2PEOA 2M8PA 1GXHA 4NEOA 1Q7YQ 3CCMP 2OARA 5HGLA 3MGEA 3DTJA 1RO0A 1CEIA 2KOOA 7CEIA 2GYKA 2M5RA 2KODA 1GPJA 2N6ZA 1DNYA 2FQ1A 1YHQP 2N5IA 3CCVP 2LOLA 2XV6A 1YITP 1W2BO 2L0QA 1KQSO 2JYGA 3GJNA 2CG5B 5CZDB 2JAZA 5DCKA 3H4EA 4BPGA 1VKUA 1YJWP 5HGOA 2VLOA 2GDWA 2MD9A 1DV5A 1VHNA 1NJIQ 2ONTA 3G71P 1VQNP 4MRTC 1K30A 2L9FA 3CCEP 2PEIA 3CMEP 1KLPA 4BPFA 1VQOP 4R0MA 2MR7A 3DPHA 2XXMA 2KG9A 1M74A 4HKGA 4WYMA 3HZQA 2PENA 3G21A 1EMVA 2CQ8A 2GDXA 1KD1Q 2GZIA 2MVVA 1VQ7P 1EIAA 2XZ1C 2LTEA 4XRQA 3CD6P 5HV8A 5BS2A 1YIJP 2CGQA 2OTJP 5F2KA 2FVAA 1RNIA 4PWVB 3I56P 2EIAA 3CCJP 1RO2A 3I55P 1T8KA 2FADA 1D1DA 3DS0A 2KGDA 3CE7A 2KR5A 2M8LA 1VQPP 2QNWA 2VSQA 2Z44A 5JPAA 4IZ6A 2JYLA 1L0IA 2LF4A 3CC4P 1QRJA
chains in the Genus database with same CATH topology
2KGCA 2MY5A 2MF4A 2AFEA 2KW2A 2JGPA 2KORA 3LMOA 2K0XA 2CG5B 1HY8A 2KGEA 1L0HA 5CZDB 4H2XC 4H2WC 3RG2A 2MR8A 2N98A 4BPGA 2FQ2A 1VKUA 2N50A 1AF8A 1NQ4A 2GDWA 2LIWA 2MD9A 5KP6B 1DV5A 2FVFA 2EHSA 2FAEA 1HQBA 2L4BA 4MRTC 2L9FA 2FQ0A 5HVCA 2MVUA 2JQ4A 1OR5A 4CA3A 2FACA 2DNWA 2KWLA 2KG6A 4BPFA 1KLPA 2ROQA 2PNGA 2MR7A 4R0MA 2LL8A 2KG9A 4BPHA 2JU2A 4HKGA 2LKIA 2N5HA 2K93A 2KG8A 4PXHB 2CQ8A 2GDXA 5EJDA 2K0YA 2AF8A 2K2QA 2LPKA 2KGAA 2MVVA 2EHTA 2CNRA 2FHSC 2LTEA 2L22A 2XZ1C 5HV8A 2KOQA 2LIUA 1F80D 2X2BA 2CGQA 2KOSA 2FVAA 5KP7B 2K92A 4PWVB 3EJEA 2FVEA 2XZ0D 4NEOA 2LMLA 1ACPA 4H2YC 4DG9A 1T8KA 2AVAA 2FADA 2KGDA 3CE7A 2KR5A 1X3OA 3GZMA 2QNWA 2KOOA 2VSQA 2N6YA 4IZ6A 3NY7B 5KP8B 3EJBA 2GDYA 2M5RA 2N6ZA 1DNYA 2FQ1A 2KOPA 2JU1A 2K94A 2N5IA 1L0IA 2LOLA 2AFDA 3EJDA 2L0QA 3GZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGC A;  2MY5 A;  2MF4 A;  2AFE A;  2KW2 A;  2JGP A;  2KOR A;  3LMO A;  2K0X A;  2CG5 B;  1HY8 A;  2KGE A;  1L0H A;  5CZD B;  4H2X C;  4H2W C;  3RG2 A;  2MR8 A;  2N98 A;  4BPG A;  2FQ2 A;  1VKU A;  2N50 A;  1AF8 A;  1NQ4 A;  2GDW A;  2LIW A;  2MD9 A;  5KP6 B;  1DV5 A;  2FVF A;  2EHS A;  2FAE A;  1HQB A;  2L4B A;  4MRT C;  2L9F A;  2FQ0 A;  5HVC A;  2MVU A;  2JQ4 A;  1OR5 A;  4CA3 A;  2FAC A;  2DNW A;  2KWL A;  2KG6 A;  4BPF A;  1KLP A;  2ROQ A;  2PNG A;  2MR7 A;  4R0M A;  2LL8 A;  2KG9 A;  4BPH A;  2JU2 A;  4HKG A;  2LKI A;  2N5H A;  2K93 A;  2KG8 A;  4PXH B;  2CQ8 A;  2GDX A;  5EJD A;  2K0Y A;  2AF8 A;  2K2Q A;  2LPK A;  2KGA A;  2MVV A;  2EHT A;  2CNR A;  2FHS C;  2LTE A;  2L22 A;  2XZ1 C;  5HV8 A;  2KOQ A;  2LIU A;  1F80 D;  2X2B A;  2CGQ A;  2KOS A;  2FVA A;  5KP7 B;  2K92 A;  4PWV B;  3EJE A;  2FVE A;  2XZ0 D;  4NEO A;  2LML A;  1ACP A;  4H2Y C;  4DG9 A;  1T8K A;  2AVA A;  2FAD A;  2KGD A;  3CE7 A;  2KR5 A;  1X3O A;  3GZM A;  2QNW A;  2KOO A;  2VSQ A;  2N6Y A;  4IZ6 A;  3NY7 B;  5KP8 B;  3EJB A;  2GDY A;  2M5R A;  2N6Z A;  1DNY A;  2FQ1 A;  2KOP A;  2JU1 A;  2K94 A;  2N5I A;  1L0I A;  2LOL A;  2AFD A;  3EJD A;  2L0Q A;  3GZL A; 
#chains in the Genus database with same CATH topology
 1BAJ A;  2CWO A;  4F37 A;  2L6E A;  2MY5 A;  1VQ5 P;  2MF4 A;  3CC2 P;  3NTE A;  2KW2 A;  2JGP A;  2K0X A;  2EFJ A;  1HY8 A;  2KGE A;  4H2X C;  4H2W C;  3RG2 A;  2MR8 A;  3DS2 A;  4IPY A;  2VLN A;  2FQ2 A;  2PEM A;  3CPW O;  2Z46 A;  4U0A A;  2N50 A;  1AF8 A;  1YJN P;  2DGY A;  3P05 A;  1JJ2 O;  1HQB A;  1VQ4 P;  3HYB A;  2K5X A;  3G26 A;  3CCQ P;  3G0V A;  4COC A;  4XFX A;  1ZNV A;  2FAC A;  2DNW A;  1BXI A;  2PEQ A;  2LL8 A;  2JO0 A;  4BPH A;  3G6E P;  2P9X A;  4QKO A;  4PXH B;  2JBG A;  5EJD A;  2ERH A;  2LPK A;  3DS5 A;  2L22 A;  1UJZ A;  2KOQ A;  1EOQ A;  1F80 D;  5HGM A;  3WBH A;  4QNB A;  2KOS A;  4U0B A;  1MZ8 A;  3G1I A;  2LML A;  5HGN A;  2QA4 P;  2BUO A;  3CXC O;  3DS4 A;  1X3O A;  2N6Y A;  2GZG A;  5KP8 B;  1M90 Q;  2GDY A;  3GKL C;  4UHP B;  2KOP A;  2JU1 A;  2K94 A;  2OTL P;  2AFD A;  2Z45 A;  4U0D A;  3EJD A;  3GZL A;  2KGC A;  1A8O A;  1AUM A;  4M0I A;  3DS1 A;  2VLP A;  1VQM P;  1S72 P;  2AFE A;  2KOR A;  3U43 A;  1UNK A;  2N98 A;  1YI2 P;  2LIW A;  2XT1 A;  1M6N A;  2FVF A;  2EHS A;  2NO8 A;  2FAE A;  3VRL C;  3CCU P;  1YJ9 P;  3G1G A;  2M8N A;  5HVC A;  2E1M A;  4U0C A;  2JQ4 A;  3H47 A;  1IUQ A;  1M6E X;  2KWL A;  2ROQ A;  2BHV A;  1FR2 A;  5F2N A;  1VQ8 P;  1Q86 Q;  3CCL P;  1KC8 Q;  5F2O A;  2N5H A;  1A43 A;  2K93 A;  3CCS P;  3CCR P;  1AYI A;  1E6J P;  1VQ9 P;  2K2Q A;  2KGA A;  3E2D A;  1QVF O;  2EHT A;  2FHS C;  2GZF A;  3G29 A;  3OW2 O;  2LIU A;  2X2B A;  1ZMB A;  4U0E A;  3CC7 P;  3EJE A;  1Q82 Q;  2FVE A;  2XZ0 D;  1Z6M A;  1ACP A;  4H2Y C;  5BS1 A;  4DG9 A;  2AVA A;  2QEX P;  3RG6 C;  3G28 A;  5I4T G;  4COP A;  2WPT A;  4PH1 A;  3GZM A;  3NY7 B;  3EJB A;  4XFZ A;  2PEK A;  1Q81 Q;  2VLQ A;  2PEJ A;  3B4Q A;  2GZJ A;  2GZE A;  3LMO A;  1GXG A;  1L0H A;  2EG5 A;  1QVG O;  1IMQ A;  1NQ4 A;  4GR2 A;  1K9M Q;  5KP6 B;  2L4B A;  1M1K Q;  1VQK P;  4U0F A;  3DS3 A;  2FQ0 A;  4GR6 A;  2MVU A;  1IMP A;  1K73 Q;  1OR5 A;  2K0D X;  4CA3 A;  2PY8 A;  3G4S P;  2KG6 A;  1N8R Q;  3Q20 A;  3LRY A;  2PNG A;  3H0D A;  2JU2 A;  3CMA P;  2LKI A;  4XFY A;  1VQL P;  2KG8 A;  4XRO A;  2K0Y A;  4PH0 A;  2AF8 A;  5EW5 E;  2CNR A;  1E0H A;  3M1M A;  1VQ6 P;  3B5I A;  5KP7 B;  2K92 A;  2JB0 A;  1K8A Q;  2PEO A;  2M8P A;  1GXH A;  4NEO A;  1Q7Y Q;  3CCM P;  2OAR A;  5HGL A;  3MGE A;  3DTJ A;  1RO0 A;  1CEI A;  2KOO A;  7CEI A;  2GYK A;  2M5R A;  2KOD A;  1GPJ A;  2N6Z A;  1DNY A;  2FQ1 A;  1YHQ P;  2N5I A;  3CCV P;  2LOL A;  2XV6 A;  1YIT P;  1W2B O;  2L0Q A;  1KQS O;  2JYG A;  3GJN A;  2CG5 B;  5CZD B;  2JAZ A;  5DCK A;  3H4E A;  4BPG A;  1VKU A;  1YJW P;  5HGO A;  2VLO A;  2GDW A;  2MD9 A;  1DV5 A;  1VHN A;  1NJI Q;  2ONT A;  3G71 P;  1VQN P;  4MRT C;  1K30 A;  2L9F A;  3CCE P;  2PEI A;  3CME P;  1KLP A;  4BPF A;  1VQO P;  4R0M A;  2MR7 A;  3DPH A;  2XXM A;  2KG9 A;  1M74 A;  4HKG A;  4WYM A;  3HZQ A;  2PEN A;  3G21 A;  1EMV A;  2CQ8 A;  2GDX A;  1KD1 Q;  2GZI A;  2MVV A;  1VQ7 P;  1EIA A;  2XZ1 C;  2LTE A;  4XRQ A;  3CD6 P;  5HV8 A;  5BS2 A;  1YIJ P;  2CGQ A;  2OTJ P;  5F2K A;  2FVA A;  1RNI A;  4PWV B;  3I56 P;  2EIA A;  3CCJ P;  1RO2 A;  3I55 P;  1T8K A;  2FAD A;  1D1D A;  3DS0 A;  2KGD A;  3CE7 A;  2KR5 A;  2M8L A;  1VQP P;  2QNW A;  2VSQ A;  2Z44 A;  5JPA A;  4IZ6 A;  2JYL A;  1L0I A;  2LF4 A;  3CC4 P;  1QRJ A; 
#chains in the Genus database with same CATH homology
 2KGC A;  2MY5 A;  2MF4 A;  2AFE A;  2KW2 A;  2JGP A;  2KOR A;  3LMO A;  2K0X A;  2CG5 B;  1HY8 A;  2KGE A;  1L0H A;  5CZD B;  4H2X C;  4H2W C;  3RG2 A;  2MR8 A;  2N98 A;  4BPG A;  2FQ2 A;  1VKU A;  2N50 A;  1AF8 A;  1NQ4 A;  2GDW A;  2LIW A;  2MD9 A;  5KP6 B;  1DV5 A;  2FVF A;  2EHS A;  2FAE A;  1HQB A;  2L4B A;  4MRT C;  2L9F A;  2FQ0 A;  5HVC A;  2MVU A;  2JQ4 A;  1OR5 A;  4CA3 A;  2FAC A;  2DNW A;  2KWL A;  2KG6 A;  4BPF A;  1KLP A;  2ROQ A;  2PNG A;  2MR7 A;  4R0M A;  2LL8 A;  2KG9 A;  4BPH A;  2JU2 A;  4HKG A;  2LKI A;  2N5H A;  2K93 A;  2KG8 A;  4PXH B;  2CQ8 A;  2GDX A;  5EJD A;  2K0Y A;  2AF8 A;  2K2Q A;  2LPK A;  2KGA A;  2MVV A;  2EHT A;  2CNR A;  2FHS C;  2LTE A;  2L22 A;  2XZ1 C;  5HV8 A;  2KOQ A;  2LIU A;  1F80 D;  2X2B A;  2CGQ A;  2KOS A;  2FVA A;  5KP7 B;  2K92 A;  4PWV B;  3EJE A;  2FVE A;  2XZ0 D;  4NEO A;  2LML A;  1ACP A;  4H2Y C;  4DG9 A;  1T8K A;  2AVA A;  2FAD A;  2KGD A;  3CE7 A;  2KR5 A;  1X3O A;  3GZM A;  2QNW A;  2KOO A;  2VSQ A;  2N6Y A;  4IZ6 A;  3NY7 B;  5KP8 B;  3EJB A;  2GDY A;  2M5R A;  2N6Z A;  1DNY A;  2FQ1 A;  2KOP A;  2JU1 A;  2K94 A;  2N5I A;  1L0I A;  2LOL A;  2AFD A;  3EJD A;  2L0Q A;  3GZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...