5KP6B

Crystal structure of the curacin biosynthetic pathway hmg synthase in complex with apo donor-acp
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVMEDLSLNIPRIELAGAKNIGELADLFAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CurD
publication title Anatomy of the beta-branching enzyme of polyketide biosynthesis and its interaction with an acyl-ACP substrate.
pubmed doi rcsb
source organism Moorea producens 3l
total genus 27
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5kp6B00
5EJDA 5HV8A 2FVAA 2LOLA 2KOSA 2JGPA 2KG9A 1DNYA 5KP6B 2K92A 2FAEA 2KGAA 2N5HA 1X3OA 2K93A 2QNWA 3GZLA 1VKUA 2L4BA 5CZDB 4IZ6A 1HQBA 2GDYA 2LIWA 2M5RA 2N98A 2FVFA 1F80D 1AF8A 2XZ0D 2XZ1C 2FQ2A 2LTEA 2GDXA 4MRTC 2N6ZA 2K0XA 2LKIA 2K0YA 2LIUA 2JQ4A 2EHTA 4HKGA 2CGQA 2EHSA 2L9FA 1L0IA 2ROQA 2N6YA 2L22A 3NY7B 2VSQA 2KR5A 4PXHB 2KG8A 2JU2A 1KLPA 4H2XC 2KGCA 2AF8A 2K2QA 2KG6A 4BPFA 2KGDA 3EJEA 4PWVB 2MR8A 4H2YC 2FQ1A 2AFEA 5KP7B 3RG2A 2KOPA 4DG9A 1OR5A 5KP8B 2K94A 4BPGA 2MVVA 2KGEA 2LPKA 2DNWA 2PNGA 2CG5B 2AFDA 2FVEA 2N50A 2KORA 2KOQA 2FACA 2FQ0A 3GZMA 4R0MA 1NQ4A 1DV5A 3LMOA 4CA3A 2GDWA 2AVAA 2LMLA 2MF4A 2MVUA 2L0QA 2KWLA 2LL8A 5HVCA 4H2WC 2N5IA 2CQ8A 1ACPA 1HY8A 2MY5A 2FHSC 2KOOA 2X2BA 1T8KA 2FADA 2KW2A 3EJBA 4NEOA 3EJDA 2JU1A 1L0HA 2MR7A 3CE7A 2MD9A 2CNRA 4BPHA
chains in the Genus database with same CATH superfamily
4XROA 2JGPA 3CCEP 4U0EA 2FAEA 2KGAA 3G29A 1IMPA 3GZLA 5HGMA 1Q86Q 1VKUA 5CZDB 2LIWA 3G1GA 1VQ8P 2N98A 2ONTA 2DGYA 1E0HA 2PEQA 3CC7P 2EFJA 2CWOA 2EG5A 2VLOA 3GJNA 2K0DX 1K9MQ 2CGQA 2JYGA 3CC4P 3G1IA 3NY7B 2PEOA 4PXHB 4WYMA 2KG8A 2ERHA 2JU2A 1KLPA 4H2XC 2KGDA 4IPYA 5F2OA 4PWVB 4UHPB 1D1DA 2GZEA 3H47A 2E1MA 3CCJP 4U0DA 1GPJA 1AYIA 2KORA 2KOQA 3WBHA 4R0MA 4PH0A 4CA3A 1UNKA 5F2KA 1EOQA 3G21A 5F2NA 1W2BO 3DTJA 3NTEA 2Z46A 2L0QA 2LL8A 4GR6A 3I55P 3CCSP 1EIAA 2CQ8A 1QVFO 1HY8A 1T8KA 4COCA 3DS5A 2GZIA 2Z44A 1S72P 3VRLC 2MD9A 5HV8A 4QNBA 3CPWO 2PY8A 1VQ5P 2FVAA 3CMAP 3CD6P 3DS1A 2K92A 2JB0A 2K93A 2L4BA 2BHVA 4IZ6A 2M5RA 4PH1A 7CEIA 2XT1A 2WPTA 2K0XA 2LKIA 2K0YA 2LIUA 1YJ9P 1M6NA 2OTJP 4HKGA 2PEJA 2ROQA 1RNIA 1BXIA 1UJZA 1KQSO 2P9XA 2VSQA 4XFZA 3CCVP 2KGCA 2AF8A 2KG6A 4BPFA 3EJEA 1N8RQ 1MZ8A 1YITP 1CEIA 1VQLP 3RG2A 3G28A 1VQMP 1YJNP 2XXMA 2BUOA 2PNGA 2FVEA 1RO2A 3CCQP 1M74A 2M8PA 2FACA 4COPA 3CCRP 2AVAA 3U43A 2LMLA 4M0IA 1YI2P 2MVUA 1QRJA 3DS4A 1JJ2O 5HVCA 2X2BA 2FADA 1Z6MA 1VQ9P 4F37A 5EJDA 2K5XA 1M6EX 2KOSA 2VLNA 1A43A 1NJIQ 1VQKP 3CXCO 3Q20A 1AUMA 2JBGA 1VQ7P 1HQBA 2GDYA 2KODA 1K73Q 3DS3A 2EIAA 1F80D 2PENA 2XZ0D 1K8AQ 2LTEA 2GZJA 3CMEP 2GDXA 2M8NA 3DS2A 2OTLP 1ZNVA 5HGOA 3H4EA 2JQ4A 1VQOP 3B5IA 1L0IA 2N6YA 2PEMA 4QKOA 2K2QA 3M1MA 2MR8A 5HGLA 4U0AA 4DG9A 3E2DA 5KP8B 2MVVA 1ZMBA 1A8OA 1BAJA 2JYLA 2LPKA 2N50A 2FQ0A 2LF4A 1DV5A 3LMOA 1YJWP 3G6EP 3RG6C 1VQ4P 1GXGA 4XRQA 2NO8A 4H2WC 1ACPA 5HGNA 5DCKA 3G71P 1M1KQ 3CCLP 4NEOA 5JPAA 1L0HA 2MR7A 2CNRA 4BPHA 1Q82Q 2LOLA 3HYBA 2KG9A 1DNYA 3G0VA 3G26A 5KP6B 1VQNP 2N5HA 2JO0A 2VLPA 2XV6A 3OW2O 1X3OA 2QNWA 4U0CA 3MGEA 1Q7YQ 1YHQP 3CC2P 1KC8Q 2FVFA 1AF8A 2XZ1C 2FQ2A 2Z45A 4MRTC 5I4TG 2N6ZA 3DPHA 2VLQA 2EHTA 1M90Q 1KD1Q 2EHSA 2L9FA 3CCUP 4U0BA 2L22A 1FR2A 2OARA 4GR2A 2KR5A 3B4QA 1QVGO 4XFXA 5BS1A 2L6EA 2QA4P 4H2YC 1EMVA 2PEIA 2FQ1A 2AFEA 5KP7B 1IMQA 2GZFA 2KOPA 1OR5A 5BS2A 2K94A 4BPGA 3I56P 1VHNA 3P05A 2KGEA 1Q81Q 2DNWA 2PEKA 2CG5B 2AFDA 1IUQA 2M8LA 5EW5E 3H0DA 3G4SP 1RO0A 1VQPP 2QEXP 3GZMA 3HZQA 1NQ4A 2GYKA 3GKLC 2GDWA 1K30A 1GXHA 4U0FA 1VQ6P 2MF4A 2JAZA 2KWLA 4XFYA 2N5IA 3CCMP 2MY5A 2FHSC 2KOOA 3DS0A 1YIJP 2KW2A 3LRYA 3EJBA 3EJDA 2JU1A 1E6JP 2GZGA 3CE7A
chains in the Genus database with same CATH topology
5EJDA 5HV8A 2FVAA 2LOLA 2KOSA 2JGPA 2KG9A 1DNYA 5KP6B 2K92A 2FAEA 2KGAA 2N5HA 1X3OA 2K93A 2QNWA 3GZLA 1VKUA 2L4BA 5CZDB 4IZ6A 1HQBA 2GDYA 2LIWA 2M5RA 2N98A 2FVFA 1F80D 1AF8A 2XZ0D 2XZ1C 2FQ2A 2LTEA 2GDXA 4MRTC 2N6ZA 2K0XA 2LKIA 2K0YA 2LIUA 2JQ4A 2EHTA 4HKGA 2CGQA 2EHSA 2L9FA 1L0IA 2ROQA 2N6YA 2L22A 3NY7B 2VSQA 2KR5A 4PXHB 2KG8A 2JU2A 1KLPA 4H2XC 2KGCA 2AF8A 2K2QA 2KG6A 4BPFA 2KGDA 3EJEA 4PWVB 2MR8A 4H2YC 2FQ1A 2AFEA 5KP7B 3RG2A 2KOPA 4DG9A 1OR5A 5KP8B 2K94A 4BPGA 2MVVA 2KGEA 2LPKA 2DNWA 2PNGA 2CG5B 2AFDA 2FVEA 2N50A 2KORA 2KOQA 2FACA 2FQ0A 3GZMA 4R0MA 1NQ4A 1DV5A 3LMOA 4CA3A 2GDWA 2AVAA 2LMLA 2MF4A 2MVUA 2L0QA 2KWLA 2LL8A 5HVCA 4H2WC 2N5IA 2CQ8A 1ACPA 1HY8A 2MY5A 2FHSC 2KOOA 2X2BA 1T8KA 2FADA 2KW2A 3EJBA 4NEOA 3EJDA 2JU1A 1L0HA 2MR7A 3CE7A 2MD9A 2CNRA 4BPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJD A;  5HV8 A;  2FVA A;  2LOL A;  2KOS A;  2JGP A;  2KG9 A;  1DNY A;  5KP6 B;  2K92 A;  2FAE A;  2KGA A;  2N5H A;  1X3O A;  2K93 A;  2QNW A;  3GZL A;  1VKU A;  2L4B A;  5CZD B;  4IZ6 A;  1HQB A;  2GDY A;  2LIW A;  2M5R A;  2N98 A;  2FVF A;  1F80 D;  1AF8 A;  2XZ0 D;  2XZ1 C;  2FQ2 A;  2LTE A;  2GDX A;  4MRT C;  2N6Z A;  2K0X A;  2LKI A;  2K0Y A;  2LIU A;  2JQ4 A;  2EHT A;  4HKG A;  2CGQ A;  2EHS A;  2L9F A;  1L0I A;  2ROQ A;  2N6Y A;  2L22 A;  3NY7 B;  2VSQ A;  2KR5 A;  4PXH B;  2KG8 A;  2JU2 A;  1KLP A;  4H2X C;  2KGC A;  2AF8 A;  2K2Q A;  2KG6 A;  4BPF A;  2KGD A;  3EJE A;  4PWV B;  2MR8 A;  4H2Y C;  2FQ1 A;  2AFE A;  5KP7 B;  3RG2 A;  2KOP A;  4DG9 A;  1OR5 A;  5KP8 B;  2K94 A;  4BPG A;  2MVV A;  2KGE A;  2LPK A;  2DNW A;  2PNG A;  2CG5 B;  2AFD A;  2FVE A;  2N50 A;  2KOR A;  2KOQ A;  2FAC A;  2FQ0 A;  3GZM A;  4R0M A;  1NQ4 A;  1DV5 A;  3LMO A;  4CA3 A;  2GDW A;  2AVA A;  2LML A;  2MF4 A;  2MVU A;  2L0Q A;  2KWL A;  2LL8 A;  5HVC A;  4H2W C;  2N5I A;  2CQ8 A;  1ACP A;  1HY8 A;  2MY5 A;  2FHS C;  2KOO A;  2X2B A;  1T8K A;  2FAD A;  2KW2 A;  3EJB A;  4NEO A;  3EJD A;  2JU1 A;  1L0H A;  2MR7 A;  3CE7 A;  2MD9 A;  2CNR A;  4BPH A; 
#chains in the Genus database with same CATH topology
 4XRO A;  2JGP A;  3CCE P;  4U0E A;  2FAE A;  2KGA A;  3G29 A;  1IMP A;  3GZL A;  5HGM A;  1Q86 Q;  1VKU A;  5CZD B;  2LIW A;  3G1G A;  1VQ8 P;  2N98 A;  2ONT A;  2DGY A;  1E0H A;  2PEQ A;  3CC7 P;  2EFJ A;  2CWO A;  2EG5 A;  2VLO A;  3GJN A;  2K0D X;  1K9M Q;  2CGQ A;  2JYG A;  3CC4 P;  3G1I A;  3NY7 B;  2PEO A;  4PXH B;  4WYM A;  2KG8 A;  2ERH A;  2JU2 A;  1KLP A;  4H2X C;  2KGD A;  4IPY A;  5F2O A;  4PWV B;  4UHP B;  1D1D A;  2GZE A;  3H47 A;  2E1M A;  3CCJ P;  4U0D A;  1GPJ A;  1AYI A;  2KOR A;  2KOQ A;  3WBH A;  4R0M A;  4PH0 A;  4CA3 A;  1UNK A;  5F2K A;  1EOQ A;  3G21 A;  5F2N A;  1W2B O;  3DTJ A;  3NTE A;  2Z46 A;  2L0Q A;  2LL8 A;  4GR6 A;  3I55 P;  3CCS P;  1EIA A;  2CQ8 A;  1QVF O;  1HY8 A;  1T8K A;  4COC A;  3DS5 A;  2GZI A;  2Z44 A;  1S72 P;  3VRL C;  2MD9 A;  5HV8 A;  4QNB A;  3CPW O;  2PY8 A;  1VQ5 P;  2FVA A;  3CMA P;  3CD6 P;  3DS1 A;  2K92 A;  2JB0 A;  2K93 A;  2L4B A;  2BHV A;  4IZ6 A;  2M5R A;  4PH1 A;  7CEI A;  2XT1 A;  2WPT A;  2K0X A;  2LKI A;  2K0Y A;  2LIU A;  1YJ9 P;  1M6N A;  2OTJ P;  4HKG A;  2PEJ A;  2ROQ A;  1RNI A;  1BXI A;  1UJZ A;  1KQS O;  2P9X A;  2VSQ A;  4XFZ A;  3CCV P;  2KGC A;  2AF8 A;  2KG6 A;  4BPF A;  3EJE A;  1N8R Q;  1MZ8 A;  1YIT P;  1CEI A;  1VQL P;  3RG2 A;  3G28 A;  1VQM P;  1YJN P;  2XXM A;  2BUO A;  2PNG A;  2FVE A;  1RO2 A;  3CCQ P;  1M74 A;  2M8P A;  2FAC A;  4COP A;  3CCR P;  2AVA A;  3U43 A;  2LML A;  4M0I A;  1YI2 P;  2MVU A;  1QRJ A;  3DS4 A;  1JJ2 O;  5HVC A;  2X2B A;  2FAD A;  1Z6M A;  1VQ9 P;  4F37 A;  5EJD A;  2K5X A;  1M6E X;  2KOS A;  2VLN A;  1A43 A;  1NJI Q;  1VQK P;  3CXC O;  3Q20 A;  1AUM A;  2JBG A;  1VQ7 P;  1HQB A;  2GDY A;  2KOD A;  1K73 Q;  3DS3 A;  2EIA A;  1F80 D;  2PEN A;  2XZ0 D;  1K8A Q;  2LTE A;  2GZJ A;  3CME P;  2GDX A;  2M8N A;  3DS2 A;  2OTL P;  1ZNV A;  5HGO A;  3H4E A;  2JQ4 A;  1VQO P;  3B5I A;  1L0I A;  2N6Y A;  2PEM A;  4QKO A;  2K2Q A;  3M1M A;  2MR8 A;  5HGL A;  4U0A A;  4DG9 A;  3E2D A;  5KP8 B;  2MVV A;  1ZMB A;  1A8O A;  1BAJ A;  2JYL A;  2LPK A;  2N50 A;  2FQ0 A;  2LF4 A;  1DV5 A;  3LMO A;  1YJW P;  3G6E P;  3RG6 C;  1VQ4 P;  1GXG A;  4XRQ A;  2NO8 A;  4H2W C;  1ACP A;  5HGN A;  5DCK A;  3G71 P;  1M1K Q;  3CCL P;  4NEO A;  5JPA A;  1L0H A;  2MR7 A;  2CNR A;  4BPH A;  1Q82 Q;  2LOL A;  3HYB A;  2KG9 A;  1DNY A;  3G0V A;  3G26 A;  5KP6 B;  1VQN P;  2N5H A;  2JO0 A;  2VLP A;  2XV6 A;  3OW2 O;  1X3O A;  2QNW A;  4U0C A;  3MGE A;  1Q7Y Q;  1YHQ P;  3CC2 P;  1KC8 Q;  2FVF A;  1AF8 A;  2XZ1 C;  2FQ2 A;  2Z45 A;  4MRT C;  5I4T G;  2N6Z A;  3DPH A;  2VLQ A;  2EHT A;  1M90 Q;  1KD1 Q;  2EHS A;  2L9F A;  3CCU P;  4U0B A;  2L22 A;  1FR2 A;  2OAR A;  4GR2 A;  2KR5 A;  3B4Q A;  1QVG O;  4XFX A;  5BS1 A;  2L6E A;  2QA4 P;  4H2Y C;  1EMV A;  2PEI A;  2FQ1 A;  2AFE A;  5KP7 B;  1IMQ A;  2GZF A;  2KOP A;  1OR5 A;  5BS2 A;  2K94 A;  4BPG A;  3I56 P;  1VHN A;  3P05 A;  2KGE A;  1Q81 Q;  2DNW A;  2PEK A;  2CG5 B;  2AFD A;  1IUQ A;  2M8L A;  5EW5 E;  3H0D A;  3G4S P;  1RO0 A;  1VQP P;  2QEX P;  3GZM A;  3HZQ A;  1NQ4 A;  2GYK A;  3GKL C;  2GDW A;  1K30 A;  1GXH A;  4U0F A;  1VQ6 P;  2MF4 A;  2JAZ A;  2KWL A;  4XFY A;  2N5I A;  3CCM P;  2MY5 A;  2FHS C;  2KOO A;  3DS0 A;  1YIJ P;  2KW2 A;  3LRY A;  3EJB A;  3EJD A;  2JU1 A;  1E6J P;  2GZG A;  3CE7 A; 
#chains in the Genus database with same CATH homology
 5EJD A;  5HV8 A;  2FVA A;  2LOL A;  2KOS A;  2JGP A;  2KG9 A;  1DNY A;  5KP6 B;  2K92 A;  2FAE A;  2KGA A;  2N5H A;  1X3O A;  2K93 A;  2QNW A;  3GZL A;  1VKU A;  2L4B A;  5CZD B;  4IZ6 A;  1HQB A;  2GDY A;  2LIW A;  2M5R A;  2N98 A;  2FVF A;  1F80 D;  1AF8 A;  2XZ0 D;  2XZ1 C;  2FQ2 A;  2LTE A;  2GDX A;  4MRT C;  2N6Z A;  2K0X A;  2LKI A;  2K0Y A;  2LIU A;  2JQ4 A;  2EHT A;  4HKG A;  2CGQ A;  2EHS A;  2L9F A;  1L0I A;  2ROQ A;  2N6Y A;  2L22 A;  3NY7 B;  2VSQ A;  2KR5 A;  4PXH B;  2KG8 A;  2JU2 A;  1KLP A;  4H2X C;  2KGC A;  2AF8 A;  2K2Q A;  2KG6 A;  4BPF A;  2KGD A;  3EJE A;  4PWV B;  2MR8 A;  4H2Y C;  2FQ1 A;  2AFE A;  5KP7 B;  3RG2 A;  2KOP A;  4DG9 A;  1OR5 A;  5KP8 B;  2K94 A;  4BPG A;  2MVV A;  2KGE A;  2LPK A;  2DNW A;  2PNG A;  2CG5 B;  2AFD A;  2FVE A;  2N50 A;  2KOR A;  2KOQ A;  2FAC A;  2FQ0 A;  3GZM A;  4R0M A;  1NQ4 A;  1DV5 A;  3LMO A;  4CA3 A;  2GDW A;  2AVA A;  2LML A;  2MF4 A;  2MVU A;  2L0Q A;  2KWL A;  2LL8 A;  5HVC A;  4H2W C;  2N5I A;  2CQ8 A;  1ACP A;  1HY8 A;  2MY5 A;  2FHS C;  2KOO A;  2X2B A;  1T8K A;  2FAD A;  2KW2 A;  3EJB A;  4NEO A;  3EJD A;  2JU1 A;  1L0H A;  2MR7 A;  3CE7 A;  2MD9 A;  2CNR A;  4BPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...