2LIWA

Nmr structure of hmg-acpi domain from cura module from lyngbya majuscula
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CurA
publication title Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2liwA01
2FVAA 2K0XA 2FVFA 4PXHB 4HKGA 2FACA 2KWLA 2LKIA 2XZ1C 2M5RA 4PWVB 2JQ4A 2KOQA 2LOLA 2LMLA 3EJDA 2KG9A 2GDXA 3RG2A 2DNWA 2JU2A 4R0MA 2L22A 2K2QA 1F80D 2XZ0D 2FQ2A 2KG8A 4BPFA 2KGCA 2MVUA 2FHSC 4IZ6A 2EHSA 1X3OA 2KGAA 1L0HA 2AFEA 2KOOA 4H2WC 1DV5A 2KG6A 2KOPA 5KP7B 3GZLA 3LMOA 3NY7B 1NQ4A 1KLPA 2K92A 2L0QA 2LL8A 2N50A 2ROQA 2EHTA 2GDYA 2FADA 2N5IA 5HV8A 1DNYA 2QNWA 2FQ1A 5EJDA 4BPHA 2AF8A 2AFDA 2LTEA 4H2XC 4DG9A 5KP8B 1T8KA 1AF8A 1HQBA 1VKUA 2K93A 2KOSA 2PNGA 2CGQA 3CE7A 2LPKA 2KGEA 2MVVA 2CQ8A 2FQ0A 2MF4A 2LIWA 2MR7A 2KORA 2L4BA 2VSQA 2KR5A 4MRTC 1OR5A 2AVAA 2GDWA 1HY8A 2K94A 2N6ZA 5KP6B 4BPGA 2MR8A 4NEOA 2MY5A 3EJEA 1L0IA 2X2BA 2JU1A 2CNRA 4CA3A 2CG5B 2N98A 2KW2A 2JGPA 1ACPA 5HVCA 2K0YA 2FAEA 2L9FA 2MD9A 3GZMA 2N5HA 2KGDA 3EJBA 5CZDB 4H2YC 2N6YA 2FVEA 2LIUA
chains in the Genus database with same CATH superfamily
1VQ8P 1UJZA 2FVAA 2K0XA 1M1KQ 1M90Q 7CEIA 2OTLP 2KWLA 2L6EA 3Q20A 2LMLA 3H4EA 1Q86Q 1K73Q 3G0VA 2DNWA 2Z45A 4R0MA 2PEOA 2K2QA 1F80D 2E1MA 2XZ0D 2KG8A 2MVUA 4IZ6A 2PEQA 3LRYA 1VQ5P 3DS4A 4U0EA 1Q82Q 2AFEA 3G26A 2LF4A 1DV5A 1YJNP 5KP7B 2CWOA 3NY7B 1NQ4A 2N50A 2ROQA 3GJNA 3CMEP 1QVGO 1BAJA 2FQ1A 4BPHA 5DCKA 1W2BO 2JYGA 2LTEA 2PEJA 2K5XA 1HQBA 1YJ9P 5F2NA 2LPKA 2MVVA 3DS2A 2FQ0A 1VQ9P 2JBGA 4M0IA 2DGYA 3CCQP 2L4BA 1M6NA 3OW2O 4XRQA 1EMVA 1OR5A 4BPGA 2MY5A 3DS0A 2JGPA 1NJIQ 2K0YA 1YIJP 2PEKA 3M1MA 2MD9A 3G6EP 1IMQA 2KGDA 3HZQA 2JO0A 3G1GA 5CZDB 1CEIA 2GYKA 4PH1A 4PXHB 1IUQA 2FVFA 2XV6A 5BS2A 1VQ4P 2FACA 3GKLC 4PWVB 2PEMA 3EJDA 2KG9A 1KD1Q 3CCRP 2GDXA 3RG2A 2JU2A 1ZMBA 2JYLA 4XFZA 1K9MQ 4GR2A 3MGEA 3E2DA 4XFXA 1QVFO 1YHQP 1QRJA 2EIAA 2EHSA 1L0HA 2GZEA 1S72P 2KOOA 2KOPA 2L0QA 2ONTA 4XROA 2Z44A 2N5IA 5HV8A 1VQKP 1A43A 2QNWA 1GXGA 2AFDA 2VLNA 5F2OA 4DG9A 1T8KA 1YITP 2K93A 2PNGA 2KGEA 2MF4A 2LIWA 2MR7A 1IMPA 5I4TG 1KQSO 2KORA 2KODA 2P9XA 1RO2A 4MRTC 2N6ZA 1E6JP 2VLOA 5KP6B 3CCVP 1GXHA 3EJEA 2JU1A 2GZIA 2Z46A 3CC2P 3DPHA 2CG5B 4U0BA 1ACPA 1RNIA 1EOQA 3CXCO 2L9FA 2N5HA 2EG5A 3CCSP 2OTJP 1BXIA 3G28A 5HGNA 3G4SP 4HKGA 3I55P 3B5IA 2LKIA 2M5RA 2KOQA 2LOLA 4PH0A 1UNKA 2JAZA 2VLQA 2EFJA 4U0AA 4UHPB 2L22A 1EIAA 4BPFA 2GZFA 3CPWO 2FHSC 1ZNVA 3DS3A 2GZGA 1M6EX 2KGAA 3G71P 1K8AQ 3CCJP 2NO8A 3CCUP 4H2WC 2KG6A 4COPA 4QNBA 1KLPA 2EHTA 2GDYA 4U0FA 3H47A 2JB0A 1VQPP 1DNYA 4U0DA 2PEIA 3DS5A 1VHNA 5HGMA 2OARA 5KP8B 1AF8A 5EW5E 1VKUA 2KOSA 3CMAP 2PY8A 1D1DA 2CQ8A 3G1IA 1YJWP 2PENA 1GPJA 2KR5A 2AVAA 2XXMA 2GDWA 1HY8A 2K94A 2GZJA 3G29A 1VQ7P 5JPAA 1E0HA 2MR8A 4NEOA 1L0IA 2X2BA 2CNRA 2KW2A 2M8NA 1Z6MA 1VQOP 3VRLC 1MZ8A 3CD6P 3GZMA 4U0CA 1FR2A 4H2YC 2N6YA 2FVEA 5BS1A 3RG6C 1JJ2O 3G21A 1A8OA 3P05A 1YI2P 2XZ1C 3U43A 2JQ4A 1VQMP 2VLPA 1VQ6P 4IPYA 2FQ2A 2KGCA 4F37A 3NTEA 3HYBA 1KC8Q 1X3OA 3CCEP 1N8RQ 3GZLA 3LMOA 4QKOA 1VQNP 2K92A 2LL8A 2M8LA 2K0DX 2FADA 3DS1A 5F2KA 4XFYA 5EJDA 3CC7P 1K30A 2AF8A 4WYMA 4H2XC 3CC4P 1M74A 2CGQA 3CE7A 2WPTA 2QA4P 3CCMP 2ERHA 2BHVA 3WBHA 1Q7YQ 3CCLP 2VSQA 1VQLP 5HGOA 1AUMA 1AYIA 1Q81Q 3DTJA 2M8PA 4CA3A 2N98A 4GR6A 1RO0A 5HVCA 5HGLA 2FAEA 4COCA 2XT1A 3I56P 3H0DA 3B4QA 2BUOA 3EJBA 2QEXP 2LIUA
chains in the Genus database with same CATH topology
2FVAA 2K0XA 2FVFA 4PXHB 4HKGA 2FACA 2KWLA 2LKIA 2XZ1C 2M5RA 4PWVB 2JQ4A 2KOQA 2LOLA 2LMLA 3EJDA 2KG9A 2GDXA 3RG2A 2DNWA 2JU2A 4R0MA 2L22A 2K2QA 1F80D 2XZ0D 2FQ2A 2KG8A 4BPFA 2KGCA 2MVUA 2FHSC 4IZ6A 2EHSA 1X3OA 2KGAA 1L0HA 2AFEA 2KOOA 4H2WC 1DV5A 2KG6A 2KOPA 5KP7B 3GZLA 3LMOA 3NY7B 1NQ4A 1KLPA 2K92A 2L0QA 2LL8A 2N50A 2ROQA 2EHTA 2GDYA 2FADA 2N5IA 5HV8A 1DNYA 2QNWA 2FQ1A 5EJDA 4BPHA 2AF8A 2AFDA 2LTEA 4H2XC 4DG9A 5KP8B 1T8KA 1AF8A 1HQBA 1VKUA 2K93A 2KOSA 2PNGA 2CGQA 3CE7A 2LPKA 2KGEA 2MVVA 2CQ8A 2FQ0A 2MF4A 2LIWA 2MR7A 2KORA 2L4BA 2VSQA 2KR5A 4MRTC 1OR5A 2AVAA 2GDWA 1HY8A 2K94A 2N6ZA 5KP6B 4BPGA 2MR8A 4NEOA 2MY5A 3EJEA 1L0IA 2X2BA 2JU1A 2CNRA 4CA3A 2CG5B 2N98A 2KW2A 2JGPA 1ACPA 5HVCA 2K0YA 2FAEA 2L9FA 2MD9A 3GZMA 2N5HA 2KGDA 3EJBA 5CZDB 4H2YC 2N6YA 2FVEA 2LIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FVA A;  2K0X A;  2FVF A;  4PXH B;  4HKG A;  2FAC A;  2KWL A;  2LKI A;  2XZ1 C;  2M5R A;  4PWV B;  2JQ4 A;  2KOQ A;  2LOL A;  2LML A;  3EJD A;  2KG9 A;  2GDX A;  3RG2 A;  2DNW A;  2JU2 A;  4R0M A;  2L22 A;  2K2Q A;  1F80 D;  2XZ0 D;  2FQ2 A;  2KG8 A;  4BPF A;  2KGC A;  2MVU A;  2FHS C;  4IZ6 A;  2EHS A;  1X3O A;  2KGA A;  1L0H A;  2AFE A;  2KOO A;  4H2W C;  1DV5 A;  2KG6 A;  2KOP A;  5KP7 B;  3GZL A;  3LMO A;  3NY7 B;  1NQ4 A;  1KLP A;  2K92 A;  2L0Q A;  2LL8 A;  2N50 A;  2ROQ A;  2EHT A;  2GDY A;  2FAD A;  2N5I A;  5HV8 A;  1DNY A;  2QNW A;  2FQ1 A;  5EJD A;  4BPH A;  2AF8 A;  2AFD A;  2LTE A;  4H2X C;  4DG9 A;  5KP8 B;  1T8K A;  1AF8 A;  1HQB A;  1VKU A;  2K93 A;  2KOS A;  2PNG A;  2CGQ A;  3CE7 A;  2LPK A;  2KGE A;  2MVV A;  2CQ8 A;  2FQ0 A;  2MF4 A;  2LIW A;  2MR7 A;  2KOR A;  2L4B A;  2VSQ A;  2KR5 A;  4MRT C;  1OR5 A;  2AVA A;  2GDW A;  1HY8 A;  2K94 A;  2N6Z A;  5KP6 B;  4BPG A;  2MR8 A;  4NEO A;  2MY5 A;  3EJE A;  1L0I A;  2X2B A;  2JU1 A;  2CNR A;  4CA3 A;  2CG5 B;  2N98 A;  2KW2 A;  2JGP A;  1ACP A;  5HVC A;  2K0Y A;  2FAE A;  2L9F A;  2MD9 A;  3GZM A;  2N5H A;  2KGD A;  3EJB A;  5CZD B;  4H2Y C;  2N6Y A;  2FVE A;  2LIU A; 
#chains in the Genus database with same CATH topology
 1VQ8 P;  1UJZ A;  2FVA A;  2K0X A;  1M1K Q;  1M90 Q;  7CEI A;  2OTL P;  2KWL A;  2L6E A;  3Q20 A;  2LML A;  3H4E A;  1Q86 Q;  1K73 Q;  3G0V A;  2DNW A;  2Z45 A;  4R0M A;  2PEO A;  2K2Q A;  1F80 D;  2E1M A;  2XZ0 D;  2KG8 A;  2MVU A;  4IZ6 A;  2PEQ A;  3LRY A;  1VQ5 P;  3DS4 A;  4U0E A;  1Q82 Q;  2AFE A;  3G26 A;  2LF4 A;  1DV5 A;  1YJN P;  5KP7 B;  2CWO A;  3NY7 B;  1NQ4 A;  2N50 A;  2ROQ A;  3GJN A;  3CME P;  1QVG O;  1BAJ A;  2FQ1 A;  4BPH A;  5DCK A;  1W2B O;  2JYG A;  2LTE A;  2PEJ A;  2K5X A;  1HQB A;  1YJ9 P;  5F2N A;  2LPK A;  2MVV A;  3DS2 A;  2FQ0 A;  1VQ9 P;  2JBG A;  4M0I A;  2DGY A;  3CCQ P;  2L4B A;  1M6N A;  3OW2 O;  4XRQ A;  1EMV A;  1OR5 A;  4BPG A;  2MY5 A;  3DS0 A;  2JGP A;  1NJI Q;  2K0Y A;  1YIJ P;  2PEK A;  3M1M A;  2MD9 A;  3G6E P;  1IMQ A;  2KGD A;  3HZQ A;  2JO0 A;  3G1G A;  5CZD B;  1CEI A;  2GYK A;  4PH1 A;  4PXH B;  1IUQ A;  2FVF A;  2XV6 A;  5BS2 A;  1VQ4 P;  2FAC A;  3GKL C;  4PWV B;  2PEM A;  3EJD A;  2KG9 A;  1KD1 Q;  3CCR P;  2GDX A;  3RG2 A;  2JU2 A;  1ZMB A;  2JYL A;  4XFZ A;  1K9M Q;  4GR2 A;  3MGE A;  3E2D A;  4XFX A;  1QVF O;  1YHQ P;  1QRJ A;  2EIA A;  2EHS A;  1L0H A;  2GZE A;  1S72 P;  2KOO A;  2KOP A;  2L0Q A;  2ONT A;  4XRO A;  2Z44 A;  2N5I A;  5HV8 A;  1VQK P;  1A43 A;  2QNW A;  1GXG A;  2AFD A;  2VLN A;  5F2O A;  4DG9 A;  1T8K A;  1YIT P;  2K93 A;  2PNG A;  2KGE A;  2MF4 A;  2LIW A;  2MR7 A;  1IMP A;  5I4T G;  1KQS O;  2KOR A;  2KOD A;  2P9X A;  1RO2 A;  4MRT C;  2N6Z A;  1E6J P;  2VLO A;  5KP6 B;  3CCV P;  1GXH A;  3EJE A;  2JU1 A;  2GZI A;  2Z46 A;  3CC2 P;  3DPH A;  2CG5 B;  4U0B A;  1ACP A;  1RNI A;  1EOQ A;  3CXC O;  2L9F A;  2N5H A;  2EG5 A;  3CCS P;  2OTJ P;  1BXI A;  3G28 A;  5HGN A;  3G4S P;  4HKG A;  3I55 P;  3B5I A;  2LKI A;  2M5R A;  2KOQ A;  2LOL A;  4PH0 A;  1UNK A;  2JAZ A;  2VLQ A;  2EFJ A;  4U0A A;  4UHP B;  2L22 A;  1EIA A;  4BPF A;  2GZF A;  3CPW O;  2FHS C;  1ZNV A;  3DS3 A;  2GZG A;  1M6E X;  2KGA A;  3G71 P;  1K8A Q;  3CCJ P;  2NO8 A;  3CCU P;  4H2W C;  2KG6 A;  4COP A;  4QNB A;  1KLP A;  2EHT A;  2GDY A;  4U0F A;  3H47 A;  2JB0 A;  1VQP P;  1DNY A;  4U0D A;  2PEI A;  3DS5 A;  1VHN A;  5HGM A;  2OAR A;  5KP8 B;  1AF8 A;  5EW5 E;  1VKU A;  2KOS A;  3CMA P;  2PY8 A;  1D1D A;  2CQ8 A;  3G1I A;  1YJW P;  2PEN A;  1GPJ A;  2KR5 A;  2AVA A;  2XXM A;  2GDW A;  1HY8 A;  2K94 A;  2GZJ A;  3G29 A;  1VQ7 P;  5JPA A;  1E0H A;  2MR8 A;  4NEO A;  1L0I A;  2X2B A;  2CNR A;  2KW2 A;  2M8N A;  1Z6M A;  1VQO P;  3VRL C;  1MZ8 A;  3CD6 P;  3GZM A;  4U0C A;  1FR2 A;  4H2Y C;  2N6Y A;  2FVE A;  5BS1 A;  3RG6 C;  1JJ2 O;  3G21 A;  1A8O A;  3P05 A;  1YI2 P;  2XZ1 C;  3U43 A;  2JQ4 A;  1VQM P;  2VLP A;  1VQ6 P;  4IPY A;  2FQ2 A;  2KGC A;  4F37 A;  3NTE A;  3HYB A;  1KC8 Q;  1X3O A;  3CCE P;  1N8R Q;  3GZL A;  3LMO A;  4QKO A;  1VQN P;  2K92 A;  2LL8 A;  2M8L A;  2K0D X;  2FAD A;  3DS1 A;  5F2K A;  4XFY A;  5EJD A;  3CC7 P;  1K30 A;  2AF8 A;  4WYM A;  4H2X C;  3CC4 P;  1M74 A;  2CGQ A;  3CE7 A;  2WPT A;  2QA4 P;  3CCM P;  2ERH A;  2BHV A;  3WBH A;  1Q7Y Q;  3CCL P;  2VSQ A;  1VQL P;  5HGO A;  1AUM A;  1AYI A;  1Q81 Q;  3DTJ A;  2M8P A;  4CA3 A;  2N98 A;  4GR6 A;  1RO0 A;  5HVC A;  5HGL A;  2FAE A;  4COC A;  2XT1 A;  3I56 P;  3H0D A;  3B4Q A;  2BUO A;  3EJB A;  2QEX P;  2LIU A; 
#chains in the Genus database with same CATH homology
 2FVA A;  2K0X A;  2FVF A;  4PXH B;  4HKG A;  2FAC A;  2KWL A;  2LKI A;  2XZ1 C;  2M5R A;  4PWV B;  2JQ4 A;  2KOQ A;  2LOL A;  2LML A;  3EJD A;  2KG9 A;  2GDX A;  3RG2 A;  2DNW A;  2JU2 A;  4R0M A;  2L22 A;  2K2Q A;  1F80 D;  2XZ0 D;  2FQ2 A;  2KG8 A;  4BPF A;  2KGC A;  2MVU A;  2FHS C;  4IZ6 A;  2EHS A;  1X3O A;  2KGA A;  1L0H A;  2AFE A;  2KOO A;  4H2W C;  1DV5 A;  2KG6 A;  2KOP A;  5KP7 B;  3GZL A;  3LMO A;  3NY7 B;  1NQ4 A;  1KLP A;  2K92 A;  2L0Q A;  2LL8 A;  2N50 A;  2ROQ A;  2EHT A;  2GDY A;  2FAD A;  2N5I A;  5HV8 A;  1DNY A;  2QNW A;  2FQ1 A;  5EJD A;  4BPH A;  2AF8 A;  2AFD A;  2LTE A;  4H2X C;  4DG9 A;  5KP8 B;  1T8K A;  1AF8 A;  1HQB A;  1VKU A;  2K93 A;  2KOS A;  2PNG A;  2CGQ A;  3CE7 A;  2LPK A;  2KGE A;  2MVV A;  2CQ8 A;  2FQ0 A;  2MF4 A;  2LIW A;  2MR7 A;  2KOR A;  2L4B A;  2VSQ A;  2KR5 A;  4MRT C;  1OR5 A;  2AVA A;  2GDW A;  1HY8 A;  2K94 A;  2N6Z A;  5KP6 B;  4BPG A;  2MR8 A;  4NEO A;  2MY5 A;  3EJE A;  1L0I A;  2X2B A;  2JU1 A;  2CNR A;  4CA3 A;  2CG5 B;  2N98 A;  2KW2 A;  2JGP A;  1ACP A;  5HVC A;  2K0Y A;  2FAE A;  2L9F A;  2MD9 A;  3GZM A;  2N5H A;  2KGD A;  3EJB A;  5CZD B;  4H2Y C;  2N6Y A;  2FVE A;  2LIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...