2LIWA

Nmr structure of hmg-acpi domain from cura module from lyngbya majuscula
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CurA
publication title Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.
pubmed doi rcsb
source organism Lyngbya majuscula
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2liwA01
4PXHB 3NY7B 5KP7B 2L9FA 2KORA 2N50A 2K0YA 2GDWA 2L0QA 1X3OA 4IZ6A 2FACA 2GDXA 2LMLA 1NQ4A 1ACPA 2L4BA 5KP6B 1DNYA 2KG6A 2FQ0A 2K92A 2KG8A 2K0XA 2FVAA 2DNWA 2CGQA 3GZMA 2JU2A 2K94A 2KW2A 5HVCA 2FVFA 2MR8A 2M5RA 2KOPA 2GDYA 2AFEA 2L22A 2KGEA 1L0IA 2FAEA 2MD9A 3EJBA 2LIWA 1HQBA 2QNWA 2AF8A 1AF8A 2KGCA 1L0HA 3EJDA 2LKIA 5EJDA 2JGPA 2CG5B 2N6ZA 2ROQA 2MVVA 2KWLA 3EJEA 2EHTA 4BPFA 2JU1A 2MF4A 2LOLA 2N6YA 1T8KA 2KOSA 4DG9A 2KOOA 2MVUA 4H2XC 2KGAA 1DV5A 2LIUA 2VSQA 4CA3A 1F80D 1KLPA 4BPHA 2KGDA 2MR7A 2N5HA 2FVEA 5CZDB 2LL8A 3LMOA 2KOQA 5HV8A 2MY5A 2N5IA 2JQ4A 4HKGA 1OR5A 2XZ0D 3CE7A 2CQ8A 4NEOA 2K2QA 2LTEA 4H2WC 2N98A 1VKUA 4H2YC 2FQ1A 2CNRA 2XZ1C 2KR5A 2K93A 3GZLA 2EHSA 4MRTC 2AFDA 1HY8A 2LPKA 2KG9A 2PNGA 5KP8B 4PWVB 4BPGA 2FADA 2AVAA 3RG2A 2FHSC 4R0MA 2X2BA 2FQ2A
chains in the Genus database with same CATH superfamily
4PXHB 5KP7B 2L9FA 5JPAA 4U0DA 1VQ5P 2NO8A 5HGOA 1E0HA 1M6NA 2GDXA 2Z45A 3H0DA 2KG6A 3G6EP 3GZMA 1VQ6P 5HVCA 5HGLA 1YITP 3DS3A 1KD1Q 3EJBA 1K30A 1KQSO 3M1MA 2GZFA 4M0IA 2Z44A 2KGCA 3DPHA 2JAZA 3G4SP 1L0HA 1M6EX 3CMEP 2N6ZA 3G1GA 7CEIA 2GYKA 1QRJA 3G28A 3DS1A 2OTJP 2KOOA 2MVUA 1YHQP 4QNBA 2KGAA 2VSQA 2QA4P 1F80D 4BPHA 3G71P 5EW5E 2GZEA 3CCLP 3CMAP 3MGEA 2M8LA 5CZDB 2LL8A 2PEOA 3CCSP 2MY5A 4COCA 3HZQA 2BUOA 2K2QA 3CXCO 1CEIA 3HYBA 2LTEA 1IMQA 2N98A 1K9MQ 2FQ1A 2CNRA 1Q81Q 2PY8A 5F2KA 2PEMA 2AFDA 1RO0A 2OARA 4XROA 4COPA 2K0DX 5KP8B 2FADA 2JB0A 1IMPA 2X2BA 3NY7B 1GXHA 2GDWA 2XT1A 4F37A 3CCEP 1NQ4A 1YIJP 2GZJA 2FQ0A 4U0FA 1M1KQ 2FVAA 2CGQA 2XV6A 2JU2A 2MR8A 2M5RA 2WPTA 3CCJP 2GDYA 2L22A 2KGEA 5I4TG 1L0IA 2MD9A 4XRQA 2QNWA 4WYMA 1EIAA 1E6JP 2JBGA 3H47A 2ROQA 1BAJA 2ERHA 2MVVA 3CCMP 2JYLA 2Z46A 1RNIA 2M8PA 1RO2A 1Q86Q 4GR2A 1DV5A 1YJWP 3G1IA 1A8OA 4CA3A 4QKOA 1KLPA 1S72P 1QVFO 2KGDA 3LMOA 5HV8A 2ONTA 2N5IA 3G0VA 2GZIA 4HKGA 1VQ7P 4NEOA 3U43A 4H2WC 1Q82Q 4H2YC 2VLQA 1ZMBA 1VQ4P 2JYGA 2KR5A 5BS1A 1VQPP 2EIAA 2VLOA 3Q20A 1IUQA 3DS5A 3CD6P 4GR6A 1K73Q 1Q7YQ 3CCUP 2FHSC 4R0MA 1N8RQ 2KORA 3B5IA 2N50A 1X3OA 2FACA 3I56P 3CCVP 1M90Q 2L4BA 1A43A 2K92A 3G29A 3DS4A 3H4EA 2K94A 3OW2O 2AFEA 1BXIA 1AUMA 1VQ9P 4UHPB 4U0BA 1AF8A 1VQOP 3RG6C 3G26A 2CWOA 3P05A 3EJDA 2PEQA 2JGPA 2CG5B 2KWLA 2EHTA 1NJIQ 5HGMA 4BPFA 3GJNA 1YJ9P 2LOLA 2N6YA 1T8KA 2KOSA 4H2XC 3VRLC 2JO0A 2PENA 2E1MA 1VHNA 3G21A 3CC2P 4XFXA 2XXMA 2K5XA 1FR2A 2N5HA 1EMVA 2EG5A 2LF4A 5BS2A 3DS0A 1VQKP 2XZ0D 1K8AQ 3CE7A 1VKUA 4IPYA 5F2NA 1AYIA 1VQMP 2QEXP 1EOQA 1HY8A 2LPKA 2KG9A 3WBHA 2PNGA 3CC4P 3CPWO 4PWVB 5DCKA 2AVAA 1UJZA 2DGYA 2K0YA 2L0QA 4IZ6A 5HGNA 3GKLC 2LMLA 1ACPA 5KP6B 1DNYA 2BHVA 3CCRP 4XFZA 2KG8A 2K0XA 2DNWA 4U0EA 1W2BO 2KW2A 2FVFA 2KOPA 2EFJA 2FAEA 2LIWA 2P9XA 1HQBA 4PH0A 3E2DA 2AF8A 2GZGA 4U0AA 2LKIA 5EJDA 1GPJA 3LRYA 1UNKA 3DS2A 2PEJA 3I55P 3EJEA 2JU1A 2MF4A 3CC7P 3NTEA 1VQLP 3CCQP 4DG9A 2VLPA 2LIUA 1MZ8A 1VQNP 2MR7A 1YJNP 2FVEA 2PEKA 4U0CA 2M8NA 1JJ2O 2KOQA 3DTJA 4PH1A 2JQ4A 2KODA 1OR5A 1KC8Q 2OTLP 2CQ8A 1VQ8P 1D1DA 1YI2P 2XZ1C 2PEIA 3B4QA 1GXGA 4MRTC 1Z6MA 2K93A 2EHSA 3GZLA 5F2OA 4XFYA 1ZNVA 4BPGA 1QVGO 2L6EA 1M74A 2VLNA 3RG2A 2FQ2A
chains in the Genus database with same CATH topology
4PXHB 3NY7B 5KP7B 2L9FA 2KORA 2N50A 2K0YA 2GDWA 2L0QA 1X3OA 4IZ6A 2FACA 2GDXA 2LMLA 1NQ4A 1ACPA 2L4BA 5KP6B 1DNYA 2KG6A 2FQ0A 2K92A 2KG8A 2K0XA 2FVAA 2DNWA 2CGQA 3GZMA 2JU2A 2K94A 2KW2A 5HVCA 2FVFA 2MR8A 2M5RA 2KOPA 2GDYA 2AFEA 2L22A 2KGEA 1L0IA 2FAEA 2MD9A 3EJBA 2LIWA 1HQBA 2QNWA 2AF8A 1AF8A 2KGCA 1L0HA 3EJDA 2LKIA 5EJDA 2JGPA 2CG5B 2N6ZA 2ROQA 2MVVA 2KWLA 3EJEA 2EHTA 4BPFA 2JU1A 2MF4A 2LOLA 2N6YA 1T8KA 2KOSA 4DG9A 2KOOA 2MVUA 4H2XC 2KGAA 1DV5A 2LIUA 2VSQA 4CA3A 1F80D 1KLPA 4BPHA 2KGDA 2MR7A 2N5HA 2FVEA 5CZDB 2LL8A 3LMOA 2KOQA 5HV8A 2MY5A 2N5IA 2JQ4A 4HKGA 1OR5A 2XZ0D 3CE7A 2CQ8A 4NEOA 2K2QA 2LTEA 4H2WC 2N98A 1VKUA 4H2YC 2FQ1A 2CNRA 2XZ1C 2KR5A 2K93A 3GZLA 2EHSA 4MRTC 2AFDA 1HY8A 2LPKA 2KG9A 2PNGA 5KP8B 4PWVB 4BPGA 2FADA 2AVAA 3RG2A 2FHSC 4R0MA 2X2BA 2FQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXH B;  3NY7 B;  5KP7 B;  2L9F A;  2KOR A;  2N50 A;  2K0Y A;  2GDW A;  2L0Q A;  1X3O A;  4IZ6 A;  2FAC A;  2GDX A;  2LML A;  1NQ4 A;  1ACP A;  2L4B A;  5KP6 B;  1DNY A;  2KG6 A;  2FQ0 A;  2K92 A;  2KG8 A;  2K0X A;  2FVA A;  2DNW A;  2CGQ A;  3GZM A;  2JU2 A;  2K94 A;  2KW2 A;  5HVC A;  2FVF A;  2MR8 A;  2M5R A;  2KOP A;  2GDY A;  2AFE A;  2L22 A;  2KGE A;  1L0I A;  2FAE A;  2MD9 A;  3EJB A;  2LIW A;  1HQB A;  2QNW A;  2AF8 A;  1AF8 A;  2KGC A;  1L0H A;  3EJD A;  2LKI A;  5EJD A;  2JGP A;  2CG5 B;  2N6Z A;  2ROQ A;  2MVV A;  2KWL A;  3EJE A;  2EHT A;  4BPF A;  2JU1 A;  2MF4 A;  2LOL A;  2N6Y A;  1T8K A;  2KOS A;  4DG9 A;  2KOO A;  2MVU A;  4H2X C;  2KGA A;  1DV5 A;  2LIU A;  2VSQ A;  4CA3 A;  1F80 D;  1KLP A;  4BPH A;  2KGD A;  2MR7 A;  2N5H A;  2FVE A;  5CZD B;  2LL8 A;  3LMO A;  2KOQ A;  5HV8 A;  2MY5 A;  2N5I A;  2JQ4 A;  4HKG A;  1OR5 A;  2XZ0 D;  3CE7 A;  2CQ8 A;  4NEO A;  2K2Q A;  2LTE A;  4H2W C;  2N98 A;  1VKU A;  4H2Y C;  2FQ1 A;  2CNR A;  2XZ1 C;  2KR5 A;  2K93 A;  3GZL A;  2EHS A;  4MRT C;  2AFD A;  1HY8 A;  2LPK A;  2KG9 A;  2PNG A;  5KP8 B;  4PWV B;  4BPG A;  2FAD A;  2AVA A;  3RG2 A;  2FHS C;  4R0M A;  2X2B A;  2FQ2 A; 
#chains in the Genus database with same CATH topology
 4PXH B;  5KP7 B;  2L9F A;  5JPA A;  4U0D A;  1VQ5 P;  2NO8 A;  5HGO A;  1E0H A;  1M6N A;  2GDX A;  2Z45 A;  3H0D A;  2KG6 A;  3G6E P;  3GZM A;  1VQ6 P;  5HVC A;  5HGL A;  1YIT P;  3DS3 A;  1KD1 Q;  3EJB A;  1K30 A;  1KQS O;  3M1M A;  2GZF A;  4M0I A;  2Z44 A;  2KGC A;  3DPH A;  2JAZ A;  3G4S P;  1L0H A;  1M6E X;  3CME P;  2N6Z A;  3G1G A;  7CEI A;  2GYK A;  1QRJ A;  3G28 A;  3DS1 A;  2OTJ P;  2KOO A;  2MVU A;  1YHQ P;  4QNB A;  2KGA A;  2VSQ A;  2QA4 P;  1F80 D;  4BPH A;  3G71 P;  5EW5 E;  2GZE A;  3CCL P;  3CMA P;  3MGE A;  2M8L A;  5CZD B;  2LL8 A;  2PEO A;  3CCS P;  2MY5 A;  4COC A;  3HZQ A;  2BUO A;  2K2Q A;  3CXC O;  1CEI A;  3HYB A;  2LTE A;  1IMQ A;  2N98 A;  1K9M Q;  2FQ1 A;  2CNR A;  1Q81 Q;  2PY8 A;  5F2K A;  2PEM A;  2AFD A;  1RO0 A;  2OAR A;  4XRO A;  4COP A;  2K0D X;  5KP8 B;  2FAD A;  2JB0 A;  1IMP A;  2X2B A;  3NY7 B;  1GXH A;  2GDW A;  2XT1 A;  4F37 A;  3CCE P;  1NQ4 A;  1YIJ P;  2GZJ A;  2FQ0 A;  4U0F A;  1M1K Q;  2FVA A;  2CGQ A;  2XV6 A;  2JU2 A;  2MR8 A;  2M5R A;  2WPT A;  3CCJ P;  2GDY A;  2L22 A;  2KGE A;  5I4T G;  1L0I A;  2MD9 A;  4XRQ A;  2QNW A;  4WYM A;  1EIA A;  1E6J P;  2JBG A;  3H47 A;  2ROQ A;  1BAJ A;  2ERH A;  2MVV A;  3CCM P;  2JYL A;  2Z46 A;  1RNI A;  2M8P A;  1RO2 A;  1Q86 Q;  4GR2 A;  1DV5 A;  1YJW P;  3G1I A;  1A8O A;  4CA3 A;  4QKO A;  1KLP A;  1S72 P;  1QVF O;  2KGD A;  3LMO A;  5HV8 A;  2ONT A;  2N5I A;  3G0V A;  2GZI A;  4HKG A;  1VQ7 P;  4NEO A;  3U43 A;  4H2W C;  1Q82 Q;  4H2Y C;  2VLQ A;  1ZMB A;  1VQ4 P;  2JYG A;  2KR5 A;  5BS1 A;  1VQP P;  2EIA A;  2VLO A;  3Q20 A;  1IUQ A;  3DS5 A;  3CD6 P;  4GR6 A;  1K73 Q;  1Q7Y Q;  3CCU P;  2FHS C;  4R0M A;  1N8R Q;  2KOR A;  3B5I A;  2N50 A;  1X3O A;  2FAC A;  3I56 P;  3CCV P;  1M90 Q;  2L4B A;  1A43 A;  2K92 A;  3G29 A;  3DS4 A;  3H4E A;  2K94 A;  3OW2 O;  2AFE A;  1BXI A;  1AUM A;  1VQ9 P;  4UHP B;  4U0B A;  1AF8 A;  1VQO P;  3RG6 C;  3G26 A;  2CWO A;  3P05 A;  3EJD A;  2PEQ A;  2JGP A;  2CG5 B;  2KWL A;  2EHT A;  1NJI Q;  5HGM A;  4BPF A;  3GJN A;  1YJ9 P;  2LOL A;  2N6Y A;  1T8K A;  2KOS A;  4H2X C;  3VRL C;  2JO0 A;  2PEN A;  2E1M A;  1VHN A;  3G21 A;  3CC2 P;  4XFX A;  2XXM A;  2K5X A;  1FR2 A;  2N5H A;  1EMV A;  2EG5 A;  2LF4 A;  5BS2 A;  3DS0 A;  1VQK P;  2XZ0 D;  1K8A Q;  3CE7 A;  1VKU A;  4IPY A;  5F2N A;  1AYI A;  1VQM P;  2QEX P;  1EOQ A;  1HY8 A;  2LPK A;  2KG9 A;  3WBH A;  2PNG A;  3CC4 P;  3CPW O;  4PWV B;  5DCK A;  2AVA A;  1UJZ A;  2DGY A;  2K0Y A;  2L0Q A;  4IZ6 A;  5HGN A;  3GKL C;  2LML A;  1ACP A;  5KP6 B;  1DNY A;  2BHV A;  3CCR P;  4XFZ A;  2KG8 A;  2K0X A;  2DNW A;  4U0E A;  1W2B O;  2KW2 A;  2FVF A;  2KOP A;  2EFJ A;  2FAE A;  2LIW A;  2P9X A;  1HQB A;  4PH0 A;  3E2D A;  2AF8 A;  2GZG A;  4U0A A;  2LKI A;  5EJD A;  1GPJ A;  3LRY A;  1UNK A;  3DS2 A;  2PEJ A;  3I55 P;  3EJE A;  2JU1 A;  2MF4 A;  3CC7 P;  3NTE A;  1VQL P;  3CCQ P;  4DG9 A;  2VLP A;  2LIU A;  1MZ8 A;  1VQN P;  2MR7 A;  1YJN P;  2FVE A;  2PEK A;  4U0C A;  2M8N A;  1JJ2 O;  2KOQ A;  3DTJ A;  4PH1 A;  2JQ4 A;  2KOD A;  1OR5 A;  1KC8 Q;  2OTL P;  2CQ8 A;  1VQ8 P;  1D1D A;  1YI2 P;  2XZ1 C;  2PEI A;  3B4Q A;  1GXG A;  4MRT C;  1Z6M A;  2K93 A;  2EHS A;  3GZL A;  5F2O A;  4XFY A;  1ZNV A;  4BPG A;  1QVG O;  2L6E A;  1M74 A;  2VLN A;  3RG2 A;  2FQ2 A; 
#chains in the Genus database with same CATH homology
 4PXH B;  3NY7 B;  5KP7 B;  2L9F A;  2KOR A;  2N50 A;  2K0Y A;  2GDW A;  2L0Q A;  1X3O A;  4IZ6 A;  2FAC A;  2GDX A;  2LML A;  1NQ4 A;  1ACP A;  2L4B A;  5KP6 B;  1DNY A;  2KG6 A;  2FQ0 A;  2K92 A;  2KG8 A;  2K0X A;  2FVA A;  2DNW A;  2CGQ A;  3GZM A;  2JU2 A;  2K94 A;  2KW2 A;  5HVC A;  2FVF A;  2MR8 A;  2M5R A;  2KOP A;  2GDY A;  2AFE A;  2L22 A;  2KGE A;  1L0I A;  2FAE A;  2MD9 A;  3EJB A;  2LIW A;  1HQB A;  2QNW A;  2AF8 A;  1AF8 A;  2KGC A;  1L0H A;  3EJD A;  2LKI A;  5EJD A;  2JGP A;  2CG5 B;  2N6Z A;  2ROQ A;  2MVV A;  2KWL A;  3EJE A;  2EHT A;  4BPF A;  2JU1 A;  2MF4 A;  2LOL A;  2N6Y A;  1T8K A;  2KOS A;  4DG9 A;  2KOO A;  2MVU A;  4H2X C;  2KGA A;  1DV5 A;  2LIU A;  2VSQ A;  4CA3 A;  1F80 D;  1KLP A;  4BPH A;  2KGD A;  2MR7 A;  2N5H A;  2FVE A;  5CZD B;  2LL8 A;  3LMO A;  2KOQ A;  5HV8 A;  2MY5 A;  2N5I A;  2JQ4 A;  4HKG A;  1OR5 A;  2XZ0 D;  3CE7 A;  2CQ8 A;  4NEO A;  2K2Q A;  2LTE A;  4H2W C;  2N98 A;  1VKU A;  4H2Y C;  2FQ1 A;  2CNR A;  2XZ1 C;  2KR5 A;  2K93 A;  3GZL A;  2EHS A;  4MRT C;  2AFD A;  1HY8 A;  2LPK A;  2KG9 A;  2PNG A;  5KP8 B;  4PWV B;  4BPG A;  2FAD A;  2AVA A;  3RG2 A;  2FHS C;  4R0M A;  2X2B A;  2FQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...