2LIWA

Nmr structure of hmg-acpi domain from cura module from lyngbya majuscula
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CurA
publication title Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2liwA01
2ROQA 1VKUA 3EJBA 5HVCA 2N98A 2FVEA 1L0HA 2GDYA 3NY7B 2LKIA 2K2QA 2KG9A 2KW2A 2N5HA 2KGEA 2JU1A 2FHSC 4PXHB 2LL8A 3GZLA 4NEOA 2FQ1A 2MY5A 2X2BA 2AVAA 2K0YA 2AFDA 2FQ0A 2LTEA 1DNYA 2EHTA 2K93A 2M5RA 1OR5A 5KP8B 4BPFA 2GDXA 2JGPA 2KGAA 2N6YA 2VSQA 1HY8A 2LIUA 2MVVA 2MR7A 3CE7A 2K92A 4H2YC 4HKGA 3EJEA 1DV5A 2FAEA 2FVFA 3LMOA 2PNGA 2KGDA 2KG6A 1ACPA 2N5IA 1HQBA 2KG8A 2L4BA 2N50A 4DG9A 2KORA 5KP7B 2AFEA 2FVAA 2DNWA 2KOSA 2K94A 4MRTC 4R0MA 2AF8A 2KOPA 2KOOA 4BPHA 1F80D 3GZMA 5CZDB 1NQ4A 2LPKA 2CGQA 2EHSA 2JU2A 3RG2A 2FACA 2XZ1C 2LIWA 2CG5B 2L9FA 5EJDA 3EJDA 2MF4A 2XZ0D 2JQ4A 4CA3A 4H2WC 4H2XC 2QNWA 2MVUA 1AF8A 2MR8A 2CQ8A 2KOQA 2L0QA 2MD9A 2LMLA 2KR5A 5KP6B 1L0IA 2KGCA 2L22A 4PWVB 2LOLA 4IZ6A 2GDWA 2FADA 2FQ2A 1X3OA 1T8KA 4BPGA 2KWLA 1KLPA 5HV8A 2N6ZA 2CNRA 2K0XA
chains in the Genus database with same CATH superfamily
1M90Q 1YITP 3DS0A 3EJBA 1K9MQ 1VQ7P 5HVCA 4COPA 1L0HA 2JO0A 3G21A 2P9XA 1VQMP 4PH1A 1GXHA 5HGOA 2JU1A 2LL8A 4WYMA 3GZLA 1ZMBA 2KODA 2X2BA 2FQ0A 5F2NA 1KQSO 2EIAA 2N6YA 1K30A 1UJZA 4HKGA 2FVFA 3LMOA 4XFYA 2L6EA 4PH0A 1AYIA 4GR2A 2GZEA 2PENA 4DG9A 2KORA 1VQ6P 3CPWO 2GYKA 3GJNA 3B4QA 4QNBA 2KOOA 1KD1Q 3GZMA 1UNKA 3CMAP 1Q86Q 4M0IA 1VQNP 1RO2A 3EJDA 3G1GA 2XZ0D 1FR2A 2Z44A 2LF4A 2E1MA 3CCVP 2MR8A 2KOQA 2LMLA 2KR5A 3H0DA 4PWVB 2LOLA 1JJ2O 1IMQA 2EG5A 4XFXA 2N6ZA 2K0XA 2OARA 1VQ9P 5BS1A 3G6EP 2N98A 3DPHA 1RO0A 2GDYA 1W2BO 2FHSC 4PXHB 3CCMP 2JAZA 3CCSP 2AVAA 5BS2A 2K0YA 2XT1A 3CXCO 2EHTA 3CC2P 5EW5E 2OTLP 1RNIA 2JGPA 1YIJP 2VSQA 1CEIA 3OW2O 2NO8A 1IMPA 2K92A 3EJEA 2FAEA 3G0VA 3P05A 3NTEA 3CCJP 3CCQP 5I4TG 1KC8Q 2AFEA 3H4EA 2DNWA 2XXMA 2KOSA 1IUQA 3G71P 2AF8A 4XRQA 2M8NA 4U0AA 2LPKA 1BXIA 2ERHA 2JU2A 3G1IA 3MGEA 2FACA 1Z6MA 1VQPP 2GZGA 2LIWA 3HYBA 1D1DA 1VQKP 4CA3A 3E2DA 5HGLA 1L0IA 2GZFA 2PEMA 2DGYA 2FADA 1EOQA 2VLQA 2QEXP 5HV8A 3CCEP 1EMVA 1E0HA 2OTJP 3CD6P 3DS1A 1K73Q 3U43A 3I55P 3NY7B 2LKIA 2K2QA 2KW2A 1M74A 1YJ9P 3G29A 1A8OA 2FQ1A 1K8AQ 2AFDA 2XV6A 2LTEA 1DNYA 2M5RA 2Z45A 5KP8B 1YHQP 4BPFA 3CCUP 5HGNA 1M6EX 2KGAA 1E6JP 4U0CA 1HY8A 2K5XA 2WPTA 1QVGO 2LIUA 3G4SP 2MVVA 2MR7A 4GR6A 4H2YC 3CCRP 1VQLP 2PEIA 2PNGA 2KGDA 3LRYA 2M8PA 2PEJA 2M8LA 1BAJA 4QKOA 4F37A 5KP7B 1M1KQ 2FVAA 2JB0A 4MRTC 4R0MA 2PEQA 2KOPA 2GZJA 4BPHA 2PEOA 3DS3A 1VQOP 1F80D 2BUOA 1Q82Q 2BHVA 1YI2P 1NQ4A 3GKLC 3B5IA 2CG5B 1QVFO 4U0FA 1VQ5P 2MF4A 4H2WC 5F2OA 2QNWA 4XFZA 2MVUA 4XROA 3HZQA 2MD9A 2QA4P 1S72P 3CC4P 3I56P 2L22A 1Q81Q 2FQ2A 1T8KA 4U0BA 1N8RQ 2KWLA 3DTJA 3RG6C 1NJIQ 1QRJA 2CNRA 2ROQA 1VKUA 1YJNP 4U0DA 2K0DX 1VQ8P 2FVEA 2VLPA 3CC7P 2JYGA 2KG9A 2N5HA 2KGEA 4NEOA 2Z46A 1YJWP 2MY5A 2EFJA 1ZNVA 1VQ4P 1EIAA 2K93A 3VRLC 3DS4A 1OR5A 3Q20A 2GDXA 3M1MA 4IPYA 3CE7A 2CWOA 2VLNA 1DV5A 3DS2A 2KG6A 1ACPA 2JBGA 2N5IA 3DS5A 1HQBA 2JYLA 2KG8A 2L4BA 2N50A 1AUMA 5HGMA 2PEKA 4UHPB 2GZIA 2K94A 5F2KA 3H47A 3G26A 1A43A 1GXGA 2PY8A 5CZDB 3G28A 2VLOA 5JPAA 2CGQA 2EHSA 3WBHA 3RG2A 2XZ1C 1M6NA 2L9FA 1GPJA 5EJDA 2JQ4A 4H2XC 3CMEP 1AF8A 2CQ8A 2L0QA 1VHNA 4U0EA 5KP6B 2KGCA 4IZ6A 2GDWA 3CCLP 1Q7YQ 1X3OA 4BPGA 1KLPA 4COCA 2ONTA 7CEIA 5DCKA 1MZ8A
chains in the Genus database with same CATH topology
2ROQA 1VKUA 3EJBA 5HVCA 2N98A 2FVEA 1L0HA 2GDYA 3NY7B 2LKIA 2K2QA 2KG9A 2KW2A 2N5HA 2KGEA 2JU1A 2FHSC 4PXHB 2LL8A 3GZLA 4NEOA 2FQ1A 2MY5A 2X2BA 2AVAA 2K0YA 2AFDA 2FQ0A 2LTEA 1DNYA 2EHTA 2K93A 2M5RA 1OR5A 5KP8B 4BPFA 2GDXA 2JGPA 2KGAA 2N6YA 2VSQA 1HY8A 2LIUA 2MVVA 2MR7A 3CE7A 2K92A 4H2YC 4HKGA 3EJEA 1DV5A 2FAEA 2FVFA 3LMOA 2PNGA 2KGDA 2KG6A 1ACPA 2N5IA 1HQBA 2KG8A 2L4BA 2N50A 4DG9A 2KORA 5KP7B 2AFEA 2FVAA 2DNWA 2KOSA 2K94A 4MRTC 4R0MA 2AF8A 2KOPA 2KOOA 4BPHA 1F80D 3GZMA 5CZDB 1NQ4A 2LPKA 2CGQA 2EHSA 2JU2A 3RG2A 2FACA 2XZ1C 2LIWA 2CG5B 2L9FA 5EJDA 3EJDA 2MF4A 2XZ0D 2JQ4A 4CA3A 4H2WC 4H2XC 2QNWA 2MVUA 1AF8A 2MR8A 2CQ8A 2KOQA 2L0QA 2MD9A 2LMLA 2KR5A 5KP6B 1L0IA 2KGCA 2L22A 4PWVB 2LOLA 4IZ6A 2GDWA 2FADA 2FQ2A 1X3OA 1T8KA 4BPGA 2KWLA 1KLPA 5HV8A 2N6ZA 2CNRA 2K0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROQ A;  1VKU A;  3EJB A;  5HVC A;  2N98 A;  2FVE A;  1L0H A;  2GDY A;  3NY7 B;  2LKI A;  2K2Q A;  2KG9 A;  2KW2 A;  2N5H A;  2KGE A;  2JU1 A;  2FHS C;  4PXH B;  2LL8 A;  3GZL A;  4NEO A;  2FQ1 A;  2MY5 A;  2X2B A;  2AVA A;  2K0Y A;  2AFD A;  2FQ0 A;  2LTE A;  1DNY A;  2EHT A;  2K93 A;  2M5R A;  1OR5 A;  5KP8 B;  4BPF A;  2GDX A;  2JGP A;  2KGA A;  2N6Y A;  2VSQ A;  1HY8 A;  2LIU A;  2MVV A;  2MR7 A;  3CE7 A;  2K92 A;  4H2Y C;  4HKG A;  3EJE A;  1DV5 A;  2FAE A;  2FVF A;  3LMO A;  2PNG A;  2KGD A;  2KG6 A;  1ACP A;  2N5I A;  1HQB A;  2KG8 A;  2L4B A;  2N50 A;  4DG9 A;  2KOR A;  5KP7 B;  2AFE A;  2FVA A;  2DNW A;  2KOS A;  2K94 A;  4MRT C;  4R0M A;  2AF8 A;  2KOP A;  2KOO A;  4BPH A;  1F80 D;  3GZM A;  5CZD B;  1NQ4 A;  2LPK A;  2CGQ A;  2EHS A;  2JU2 A;  3RG2 A;  2FAC A;  2XZ1 C;  2LIW A;  2CG5 B;  2L9F A;  5EJD A;  3EJD A;  2MF4 A;  2XZ0 D;  2JQ4 A;  4CA3 A;  4H2W C;  4H2X C;  2QNW A;  2MVU A;  1AF8 A;  2MR8 A;  2CQ8 A;  2KOQ A;  2L0Q A;  2MD9 A;  2LML A;  2KR5 A;  5KP6 B;  1L0I A;  2KGC A;  2L22 A;  4PWV B;  2LOL A;  4IZ6 A;  2GDW A;  2FAD A;  2FQ2 A;  1X3O A;  1T8K A;  4BPG A;  2KWL A;  1KLP A;  5HV8 A;  2N6Z A;  2CNR A;  2K0X A; 
#chains in the Genus database with same CATH topology
 1M90 Q;  1YIT P;  3DS0 A;  3EJB A;  1K9M Q;  1VQ7 P;  5HVC A;  4COP A;  1L0H A;  2JO0 A;  3G21 A;  2P9X A;  1VQM P;  4PH1 A;  1GXH A;  5HGO A;  2JU1 A;  2LL8 A;  4WYM A;  3GZL A;  1ZMB A;  2KOD A;  2X2B A;  2FQ0 A;  5F2N A;  1KQS O;  2EIA A;  2N6Y A;  1K30 A;  1UJZ A;  4HKG A;  2FVF A;  3LMO A;  4XFY A;  2L6E A;  4PH0 A;  1AYI A;  4GR2 A;  2GZE A;  2PEN A;  4DG9 A;  2KOR A;  1VQ6 P;  3CPW O;  2GYK A;  3GJN A;  3B4Q A;  4QNB A;  2KOO A;  1KD1 Q;  3GZM A;  1UNK A;  3CMA P;  1Q86 Q;  4M0I A;  1VQN P;  1RO2 A;  3EJD A;  3G1G A;  2XZ0 D;  1FR2 A;  2Z44 A;  2LF4 A;  2E1M A;  3CCV P;  2MR8 A;  2KOQ A;  2LML A;  2KR5 A;  3H0D A;  4PWV B;  2LOL A;  1JJ2 O;  1IMQ A;  2EG5 A;  4XFX A;  2N6Z A;  2K0X A;  2OAR A;  1VQ9 P;  5BS1 A;  3G6E P;  2N98 A;  3DPH A;  1RO0 A;  2GDY A;  1W2B O;  2FHS C;  4PXH B;  3CCM P;  2JAZ A;  3CCS P;  2AVA A;  5BS2 A;  2K0Y A;  2XT1 A;  3CXC O;  2EHT A;  3CC2 P;  5EW5 E;  2OTL P;  1RNI A;  2JGP A;  1YIJ P;  2VSQ A;  1CEI A;  3OW2 O;  2NO8 A;  1IMP A;  2K92 A;  3EJE A;  2FAE A;  3G0V A;  3P05 A;  3NTE A;  3CCJ P;  3CCQ P;  5I4T G;  1KC8 Q;  2AFE A;  3H4E A;  2DNW A;  2XXM A;  2KOS A;  1IUQ A;  3G71 P;  2AF8 A;  4XRQ A;  2M8N A;  4U0A A;  2LPK A;  1BXI A;  2ERH A;  2JU2 A;  3G1I A;  3MGE A;  2FAC A;  1Z6M A;  1VQP P;  2GZG A;  2LIW A;  3HYB A;  1D1D A;  1VQK P;  4CA3 A;  3E2D A;  5HGL A;  1L0I A;  2GZF A;  2PEM A;  2DGY A;  2FAD A;  1EOQ A;  2VLQ A;  2QEX P;  5HV8 A;  3CCE P;  1EMV A;  1E0H A;  2OTJ P;  3CD6 P;  3DS1 A;  1K73 Q;  3U43 A;  3I55 P;  3NY7 B;  2LKI A;  2K2Q A;  2KW2 A;  1M74 A;  1YJ9 P;  3G29 A;  1A8O A;  2FQ1 A;  1K8A Q;  2AFD A;  2XV6 A;  2LTE A;  1DNY A;  2M5R A;  2Z45 A;  5KP8 B;  1YHQ P;  4BPF A;  3CCU P;  5HGN A;  1M6E X;  2KGA A;  1E6J P;  4U0C A;  1HY8 A;  2K5X A;  2WPT A;  1QVG O;  2LIU A;  3G4S P;  2MVV A;  2MR7 A;  4GR6 A;  4H2Y C;  3CCR P;  1VQL P;  2PEI A;  2PNG A;  2KGD A;  3LRY A;  2M8P A;  2PEJ A;  2M8L A;  1BAJ A;  4QKO A;  4F37 A;  5KP7 B;  1M1K Q;  2FVA A;  2JB0 A;  4MRT C;  4R0M A;  2PEQ A;  2KOP A;  2GZJ A;  4BPH A;  2PEO A;  3DS3 A;  1VQO P;  1F80 D;  2BUO A;  1Q82 Q;  2BHV A;  1YI2 P;  1NQ4 A;  3GKL C;  3B5I A;  2CG5 B;  1QVF O;  4U0F A;  1VQ5 P;  2MF4 A;  4H2W C;  5F2O A;  2QNW A;  4XFZ A;  2MVU A;  4XRO A;  3HZQ A;  2MD9 A;  2QA4 P;  1S72 P;  3CC4 P;  3I56 P;  2L22 A;  1Q81 Q;  2FQ2 A;  1T8K A;  4U0B A;  1N8R Q;  2KWL A;  3DTJ A;  3RG6 C;  1NJI Q;  1QRJ A;  2CNR A;  2ROQ A;  1VKU A;  1YJN P;  4U0D A;  2K0D X;  1VQ8 P;  2FVE A;  2VLP A;  3CC7 P;  2JYG A;  2KG9 A;  2N5H A;  2KGE A;  4NEO A;  2Z46 A;  1YJW P;  2MY5 A;  2EFJ A;  1ZNV A;  1VQ4 P;  1EIA A;  2K93 A;  3VRL C;  3DS4 A;  1OR5 A;  3Q20 A;  2GDX A;  3M1M A;  4IPY A;  3CE7 A;  2CWO A;  2VLN A;  1DV5 A;  3DS2 A;  2KG6 A;  1ACP A;  2JBG A;  2N5I A;  3DS5 A;  1HQB A;  2JYL A;  2KG8 A;  2L4B A;  2N50 A;  1AUM A;  5HGM A;  2PEK A;  4UHP B;  2GZI A;  2K94 A;  5F2K A;  3H47 A;  3G26 A;  1A43 A;  1GXG A;  2PY8 A;  5CZD B;  3G28 A;  2VLO A;  5JPA A;  2CGQ A;  2EHS A;  3WBH A;  3RG2 A;  2XZ1 C;  1M6N A;  2L9F A;  1GPJ A;  5EJD A;  2JQ4 A;  4H2X C;  3CME P;  1AF8 A;  2CQ8 A;  2L0Q A;  1VHN A;  4U0E A;  5KP6 B;  2KGC A;  4IZ6 A;  2GDW A;  3CCL P;  1Q7Y Q;  1X3O A;  4BPG A;  1KLP A;  4COC A;  2ONT A;  7CEI A;  5DCK A;  1MZ8 A; 
#chains in the Genus database with same CATH homology
 2ROQ A;  1VKU A;  3EJB A;  5HVC A;  2N98 A;  2FVE A;  1L0H A;  2GDY A;  3NY7 B;  2LKI A;  2K2Q A;  2KG9 A;  2KW2 A;  2N5H A;  2KGE A;  2JU1 A;  2FHS C;  4PXH B;  2LL8 A;  3GZL A;  4NEO A;  2FQ1 A;  2MY5 A;  2X2B A;  2AVA A;  2K0Y A;  2AFD A;  2FQ0 A;  2LTE A;  1DNY A;  2EHT A;  2K93 A;  2M5R A;  1OR5 A;  5KP8 B;  4BPF A;  2GDX A;  2JGP A;  2KGA A;  2N6Y A;  2VSQ A;  1HY8 A;  2LIU A;  2MVV A;  2MR7 A;  3CE7 A;  2K92 A;  4H2Y C;  4HKG A;  3EJE A;  1DV5 A;  2FAE A;  2FVF A;  3LMO A;  2PNG A;  2KGD A;  2KG6 A;  1ACP A;  2N5I A;  1HQB A;  2KG8 A;  2L4B A;  2N50 A;  4DG9 A;  2KOR A;  5KP7 B;  2AFE A;  2FVA A;  2DNW A;  2KOS A;  2K94 A;  4MRT C;  4R0M A;  2AF8 A;  2KOP A;  2KOO A;  4BPH A;  1F80 D;  3GZM A;  5CZD B;  1NQ4 A;  2LPK A;  2CGQ A;  2EHS A;  2JU2 A;  3RG2 A;  2FAC A;  2XZ1 C;  2LIW A;  2CG5 B;  2L9F A;  5EJD A;  3EJD A;  2MF4 A;  2XZ0 D;  2JQ4 A;  4CA3 A;  4H2W C;  4H2X C;  2QNW A;  2MVU A;  1AF8 A;  2MR8 A;  2CQ8 A;  2KOQ A;  2L0Q A;  2MD9 A;  2LML A;  2KR5 A;  5KP6 B;  1L0I A;  2KGC A;  2L22 A;  4PWV B;  2LOL A;  4IZ6 A;  2GDW A;  2FAD A;  2FQ2 A;  1X3O A;  1T8K A;  4BPG A;  2KWL A;  1KLP A;  5HV8 A;  2N6Z A;  2CNR A;  2K0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...