2LIWA

Nmr structure of hmg-acpi domain from cura module from lyngbya majuscula
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
b'SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CurA
publication title Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2liwA01
2AVAA 2JU2A 2K94A 2JQ4A 5HV8A 2LKIA 2KG8A 2L4BA 1HY8A 2N98A 2CQ8A 5HVCA 2LMLA 2FADA 2KOPA 2L0QA 3CE7A 2K0YA 3GZMA 2FAEA 2FVFA 2VSQA 2KGDA 1L0IA 2KOOA 4H2XC 1VKUA 4IZ6A 4NEOA 2AFEA 2FHSC 2KG6A 3LMOA 2K93A 2FQ1A 3RG2A 4HKGA 2LL8A 1DNYA 2K2QA 1NQ4A 2K92A 2N6ZA 2KW2A 2N6YA 1T8KA 5KP6B 2MVUA 2FVAA 2FACA 1L0HA 4PWVB 2MD9A 2FQ2A 1F80D 2K0XA 2M5RA 2XZ0D 2N5IA 5EJDA 2EHSA 2JGPA 2JU1A 2LOLA 2LIWA 4BPHA 5KP7B 5CZDB 1AF8A 2PNGA 4BPGA 2MVVA 2N5HA 2L9FA 4CA3A 2AFDA 2KOQA 1OR5A 2MY5A 3EJBA 2GDWA 2MR8A 3GZLA 2ROQA 2LPKA 2LTEA 2CGQA 2EHTA 2CNRA 2KGEA 2KGCA 2X2BA 4BPFA 2QNWA 2XZ1C 2KOSA 3NY7B 3EJEA 2L22A 1X3OA 2DNWA 1ACPA 2N50A 4R0MA 2GDYA 2KG9A 2FQ0A 5KP8B 2CG5B 4PXHB 4MRTC 2KGAA 2LIUA 1HQBA 1DV5A 2GDXA 2AF8A 2MR7A 1KLPA 4DG9A 2KR5A 3EJDA 4H2WC 4H2YC 2KWLA 2MF4A 2KORA 2FVEA
chains in the Genus database with same CATH superfamily
2M8PA 1FR2A 2CWOA 2L4BA 2N98A 4XROA 1QRJA 2XV6A 2LMLA 2L0QA 3CE7A 4QKOA 3CCRP 3I56P 4IZ6A 3DS4A 2KG6A 4GR6A 4M0IA 1IMPA 1DNYA 3CC2P 2KODA 2KW2A 1GXGA 3CCLP 1T8KA 4COCA 3H4EA 2VLOA 3G71P 3DS3A 2MD9A 4IPYA 4U0CA 3G6EP 1M1KQ 2JGPA 2JU1A 1CEIA 1GXHA 3G26A 1VQMP 4BPHA 5KP7B 2PNGA 4BPGA 1IUQA 2N5HA 1EMVA 1OR5A 1K9MQ 1QVFO 1VQ5P 2EG5A 2PEQA 3NY7B 3DS1A 5I4TG 3DS2A 2WPTA 1MZ8A 4U0BA 2PEKA 1ACPA 2VLNA 1KC8Q 2NO8A 5KP8B 1YJ9P 2M8NA 2GZEA 2PEIA 2MR7A 4XFYA 3G21A 2Z44A 3EJDA 1S72P 5HGNA 2PEOA 2KORA 2GYKA 3G29A 4F37A 2JQ4A 5HV8A 2ERHA 2LKIA 3CMAP 2CQ8A 3G28A 1BAJA 1E0HA 3G4SP 1YI2P 2FADA 3GZMA 2OTJP 2QEXP 2GZJA 2VSQA 3H47A 1JJ2O 5HGMA 2KOOA 1AYIA 4U0EA 4NEOA 1M6EX 1YHQP 1KQSO 2FHSC 4XRQA 2JBGA 1M90Q 1RO2A 2E1MA 2K93A 4U0FA 5F2NA 4HKGA 3G0VA 2BUOA 2N6ZA 1VQKP 3CD6P 2N6YA 3DS5A 1D1DA 3DS0A 1VQPP 3B4QA 2EFJA 2MVUA 2FACA 2JYGA 1F80D 2XZ0D 1IMQA 2QA4P 2MY5A 3EJBA 2GDWA 3GZLA 2JYLA 2LTEA 2EHTA 2CNRA 1UJZA 2PENA 1UNKA 4BPFA 2Z45A 2KOSA 5HGLA 1VQLP 3GKLC 2DNWA 1E6JP 3NTEA 3HYBA 1K30A 4R0MA 2GDYA 2KG9A 3WBHA 2K0DX 1BXIA 3OW2O 2KR5A 4H2YC 1EIAA 2KWLA 1AUMA 2MF4A 1YIJP 7CEIA 2K94A 2KG8A 1Z6MA 1VQNP 3Q20A 2K0YA 2FAEA 3E2DA 2KGDA 5EW5E 1VKUA 2PEJA 4U0AA 2AFEA 2PEMA 1M74A 3CCMP 3LMOA 3CXCO 3VRLC 2FQ1A 3RG2A 2LL8A 2DGYA 2JO0A 1VQOP 1A8OA 1A43A 4PWVB 1ZMBA 2K0XA 2M5RA 2N5IA 5EJDA 2EHSA 2VLQA 1VHNA 1RNIA 5CZDB 1AF8A 1K8AQ 2P9XA 4WYMA 5JPAA 2MVVA 3DTJA 3MGEA 4CA3A 2KOQA 5HGOA 2MR8A 1VQ4P 2CGQA 2KGEA 1KD1Q 1VQ6P 2X2BA 2QNWA 1VQ9P 3EJEA 2L22A 1X3OA 3U43A 2GZGA 1Q81Q 2JAZA 3CCQP 2M8LA 5BS2A 3GJNA 2CG5B 4PXHB 4MRTC 3CMEP 2LIUA 3G1GA 2LF4A 2JB0A 3CCUP 3CCSP 1K73Q 3HZQA 5BS1A 3CC4P 1Q86Q 4H2WC 4GR2A 2ONTA 2FVEA 2AVAA 1M6NA 2JU2A 4UHPB 1HY8A 2Z46A 5HVCA 2OTLP 2KOPA 1YJNP 2PY8A 3CCJP 2FVFA 1L0IA 1VQ7P 3LRYA 4H2XC 4XFZA 1Q82Q 2EIAA 3G1IA 3CC7P 1VQ8P 2L6EA 2BHVA 2K2QA 1W2BO 1NQ4A 4PH1A 5F2KA 2K92A 1RO0A 3CPWO 5KP6B 4QNBA 2GZIA 2FVAA 3B5IA 2K5XA 1L0HA 1EOQA 1GPJA 4PH0A 2FQ2A 1NJIQ 2LOLA 1N8RQ 5F2OA 2XT1A 1Q7YQ 4XFXA 2LIWA 3P05A 1ZNVA 4COPA 3CCEP 3RG6C 2L9FA 2AFDA 2ROQA 2GZFA 2LPKA 2XXMA 2KGCA 1QVGO 3M1MA 2XZ1C 3H0DA 2OARA 3DPHA 2N50A 2FQ0A 2VLPA 1YITP 2KGAA 1HQBA 1DV5A 2GDXA 2AF8A 5DCKA 3I55P 1KLPA 4DG9A 1YJWP 3CCVP 4U0DA
chains in the Genus database with same CATH topology
2AVAA 2JU2A 2K94A 2JQ4A 5HV8A 2LKIA 2KG8A 2L4BA 1HY8A 2N98A 2CQ8A 5HVCA 2LMLA 2FADA 2KOPA 2L0QA 3CE7A 2K0YA 3GZMA 2FAEA 2FVFA 2VSQA 2KGDA 1L0IA 2KOOA 4H2XC 1VKUA 4IZ6A 4NEOA 2AFEA 2FHSC 2KG6A 3LMOA 2K93A 2FQ1A 3RG2A 4HKGA 2LL8A 1DNYA 2K2QA 1NQ4A 2K92A 2N6ZA 2KW2A 2N6YA 1T8KA 5KP6B 2MVUA 2FVAA 2FACA 1L0HA 4PWVB 2MD9A 2FQ2A 1F80D 2K0XA 2M5RA 2XZ0D 2N5IA 5EJDA 2EHSA 2JGPA 2JU1A 2LOLA 2LIWA 4BPHA 5KP7B 5CZDB 1AF8A 2PNGA 4BPGA 2MVVA 2N5HA 2L9FA 4CA3A 2AFDA 2KOQA 1OR5A 2MY5A 3EJBA 2GDWA 2MR8A 3GZLA 2ROQA 2LPKA 2LTEA 2CGQA 2EHTA 2CNRA 2KGEA 2KGCA 2X2BA 4BPFA 2QNWA 2XZ1C 2KOSA 3NY7B 3EJEA 2L22A 1X3OA 2DNWA 1ACPA 2N50A 4R0MA 2GDYA 2KG9A 2FQ0A 5KP8B 2CG5B 4PXHB 4MRTC 2KGAA 2LIUA 1HQBA 1DV5A 2GDXA 2AF8A 2MR7A 1KLPA 4DG9A 2KR5A 3EJDA 4H2WC 4H2YC 2KWLA 2MF4A 2KORA 2FVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVA A;  2JU2 A;  2K94 A;  2JQ4 A;  5HV8 A;  2LKI A;  2KG8 A;  2L4B A;  1HY8 A;  2N98 A;  2CQ8 A;  5HVC A;  2LML A;  2FAD A;  2KOP A;  2L0Q A;  3CE7 A;  2K0Y A;  3GZM A;  2FAE A;  2FVF A;  2VSQ A;  2KGD A;  1L0I A;  2KOO A;  4H2X C;  1VKU A;  4IZ6 A;  4NEO A;  2AFE A;  2FHS C;  2KG6 A;  3LMO A;  2K93 A;  2FQ1 A;  3RG2 A;  4HKG A;  2LL8 A;  1DNY A;  2K2Q A;  1NQ4 A;  2K92 A;  2N6Z A;  2KW2 A;  2N6Y A;  1T8K A;  5KP6 B;  2MVU A;  2FVA A;  2FAC A;  1L0H A;  4PWV B;  2MD9 A;  2FQ2 A;  1F80 D;  2K0X A;  2M5R A;  2XZ0 D;  2N5I A;  5EJD A;  2EHS A;  2JGP A;  2JU1 A;  2LOL A;  2LIW A;  4BPH A;  5KP7 B;  5CZD B;  1AF8 A;  2PNG A;  4BPG A;  2MVV A;  2N5H A;  2L9F A;  4CA3 A;  2AFD A;  2KOQ A;  1OR5 A;  2MY5 A;  3EJB A;  2GDW A;  2MR8 A;  3GZL A;  2ROQ A;  2LPK A;  2LTE A;  2CGQ A;  2EHT A;  2CNR A;  2KGE A;  2KGC A;  2X2B A;  4BPF A;  2QNW A;  2XZ1 C;  2KOS A;  3NY7 B;  3EJE A;  2L22 A;  1X3O A;  2DNW A;  1ACP A;  2N50 A;  4R0M A;  2GDY A;  2KG9 A;  2FQ0 A;  5KP8 B;  2CG5 B;  4PXH B;  4MRT C;  2KGA A;  2LIU A;  1HQB A;  1DV5 A;  2GDX A;  2AF8 A;  2MR7 A;  1KLP A;  4DG9 A;  2KR5 A;  3EJD A;  4H2W C;  4H2Y C;  2KWL A;  2MF4 A;  2KOR A;  2FVE A; 
#chains in the Genus database with same CATH topology
 2M8P A;  1FR2 A;  2CWO A;  2L4B A;  2N98 A;  4XRO A;  1QRJ A;  2XV6 A;  2LML A;  2L0Q A;  3CE7 A;  4QKO A;  3CCR P;  3I56 P;  4IZ6 A;  3DS4 A;  2KG6 A;  4GR6 A;  4M0I A;  1IMP A;  1DNY A;  3CC2 P;  2KOD A;  2KW2 A;  1GXG A;  3CCL P;  1T8K A;  4COC A;  3H4E A;  2VLO A;  3G71 P;  3DS3 A;  2MD9 A;  4IPY A;  4U0C A;  3G6E P;  1M1K Q;  2JGP A;  2JU1 A;  1CEI A;  1GXH A;  3G26 A;  1VQM P;  4BPH A;  5KP7 B;  2PNG A;  4BPG A;  1IUQ A;  2N5H A;  1EMV A;  1OR5 A;  1K9M Q;  1QVF O;  1VQ5 P;  2EG5 A;  2PEQ A;  3NY7 B;  3DS1 A;  5I4T G;  3DS2 A;  2WPT A;  1MZ8 A;  4U0B A;  2PEK A;  1ACP A;  2VLN A;  1KC8 Q;  2NO8 A;  5KP8 B;  1YJ9 P;  2M8N A;  2GZE A;  2PEI A;  2MR7 A;  4XFY A;  3G21 A;  2Z44 A;  3EJD A;  1S72 P;  5HGN A;  2PEO A;  2KOR A;  2GYK A;  3G29 A;  4F37 A;  2JQ4 A;  5HV8 A;  2ERH A;  2LKI A;  3CMA P;  2CQ8 A;  3G28 A;  1BAJ A;  1E0H A;  3G4S P;  1YI2 P;  2FAD A;  3GZM A;  2OTJ P;  2QEX P;  2GZJ A;  2VSQ A;  3H47 A;  1JJ2 O;  5HGM A;  2KOO A;  1AYI A;  4U0E A;  4NEO A;  1M6E X;  1YHQ P;  1KQS O;  2FHS C;  4XRQ A;  2JBG A;  1M90 Q;  1RO2 A;  2E1M A;  2K93 A;  4U0F A;  5F2N A;  4HKG A;  3G0V A;  2BUO A;  2N6Z A;  1VQK P;  3CD6 P;  2N6Y A;  3DS5 A;  1D1D A;  3DS0 A;  1VQP P;  3B4Q A;  2EFJ A;  2MVU A;  2FAC A;  2JYG A;  1F80 D;  2XZ0 D;  1IMQ A;  2QA4 P;  2MY5 A;  3EJB A;  2GDW A;  3GZL A;  2JYL A;  2LTE A;  2EHT A;  2CNR A;  1UJZ A;  2PEN A;  1UNK A;  4BPF A;  2Z45 A;  2KOS A;  5HGL A;  1VQL P;  3GKL C;  2DNW A;  1E6J P;  3NTE A;  3HYB A;  1K30 A;  4R0M A;  2GDY A;  2KG9 A;  3WBH A;  2K0D X;  1BXI A;  3OW2 O;  2KR5 A;  4H2Y C;  1EIA A;  2KWL A;  1AUM A;  2MF4 A;  1YIJ P;  7CEI A;  2K94 A;  2KG8 A;  1Z6M A;  1VQN P;  3Q20 A;  2K0Y A;  2FAE A;  3E2D A;  2KGD A;  5EW5 E;  1VKU A;  2PEJ A;  4U0A A;  2AFE A;  2PEM A;  1M74 A;  3CCM P;  3LMO A;  3CXC O;  3VRL C;  2FQ1 A;  3RG2 A;  2LL8 A;  2DGY A;  2JO0 A;  1VQO P;  1A8O A;  1A43 A;  4PWV B;  1ZMB A;  2K0X A;  2M5R A;  2N5I A;  5EJD A;  2EHS A;  2VLQ A;  1VHN A;  1RNI A;  5CZD B;  1AF8 A;  1K8A Q;  2P9X A;  4WYM A;  5JPA A;  2MVV A;  3DTJ A;  3MGE A;  4CA3 A;  2KOQ A;  5HGO A;  2MR8 A;  1VQ4 P;  2CGQ A;  2KGE A;  1KD1 Q;  1VQ6 P;  2X2B A;  2QNW A;  1VQ9 P;  3EJE A;  2L22 A;  1X3O A;  3U43 A;  2GZG A;  1Q81 Q;  2JAZ A;  3CCQ P;  2M8L A;  5BS2 A;  3GJN A;  2CG5 B;  4PXH B;  4MRT C;  3CME P;  2LIU A;  3G1G A;  2LF4 A;  2JB0 A;  3CCU P;  3CCS P;  1K73 Q;  3HZQ A;  5BS1 A;  3CC4 P;  1Q86 Q;  4H2W C;  4GR2 A;  2ONT A;  2FVE A;  2AVA A;  1M6N A;  2JU2 A;  4UHP B;  1HY8 A;  2Z46 A;  5HVC A;  2OTL P;  2KOP A;  1YJN P;  2PY8 A;  3CCJ P;  2FVF A;  1L0I A;  1VQ7 P;  3LRY A;  4H2X C;  4XFZ A;  1Q82 Q;  2EIA A;  3G1I A;  3CC7 P;  1VQ8 P;  2L6E A;  2BHV A;  2K2Q A;  1W2B O;  1NQ4 A;  4PH1 A;  5F2K A;  2K92 A;  1RO0 A;  3CPW O;  5KP6 B;  4QNB A;  2GZI A;  2FVA A;  3B5I A;  2K5X A;  1L0H A;  1EOQ A;  1GPJ A;  4PH0 A;  2FQ2 A;  1NJI Q;  2LOL A;  1N8R Q;  5F2O A;  2XT1 A;  1Q7Y Q;  4XFX A;  2LIW A;  3P05 A;  1ZNV A;  4COP A;  3CCE P;  3RG6 C;  2L9F A;  2AFD A;  2ROQ A;  2GZF A;  2LPK A;  2XXM A;  2KGC A;  1QVG O;  3M1M A;  2XZ1 C;  3H0D A;  2OAR A;  3DPH A;  2N50 A;  2FQ0 A;  2VLP A;  1YIT P;  2KGA A;  1HQB A;  1DV5 A;  2GDX A;  2AF8 A;  5DCK A;  3I55 P;  1KLP A;  4DG9 A;  1YJW P;  3CCV P;  4U0D A; 
#chains in the Genus database with same CATH homology
 2AVA A;  2JU2 A;  2K94 A;  2JQ4 A;  5HV8 A;  2LKI A;  2KG8 A;  2L4B A;  1HY8 A;  2N98 A;  2CQ8 A;  5HVC A;  2LML A;  2FAD A;  2KOP A;  2L0Q A;  3CE7 A;  2K0Y A;  3GZM A;  2FAE A;  2FVF A;  2VSQ A;  2KGD A;  1L0I A;  2KOO A;  4H2X C;  1VKU A;  4IZ6 A;  4NEO A;  2AFE A;  2FHS C;  2KG6 A;  3LMO A;  2K93 A;  2FQ1 A;  3RG2 A;  4HKG A;  2LL8 A;  1DNY A;  2K2Q A;  1NQ4 A;  2K92 A;  2N6Z A;  2KW2 A;  2N6Y A;  1T8K A;  5KP6 B;  2MVU A;  2FVA A;  2FAC A;  1L0H A;  4PWV B;  2MD9 A;  2FQ2 A;  1F80 D;  2K0X A;  2M5R A;  2XZ0 D;  2N5I A;  5EJD A;  2EHS A;  2JGP A;  2JU1 A;  2LOL A;  2LIW A;  4BPH A;  5KP7 B;  5CZD B;  1AF8 A;  2PNG A;  4BPG A;  2MVV A;  2N5H A;  2L9F A;  4CA3 A;  2AFD A;  2KOQ A;  1OR5 A;  2MY5 A;  3EJB A;  2GDW A;  2MR8 A;  3GZL A;  2ROQ A;  2LPK A;  2LTE A;  2CGQ A;  2EHT A;  2CNR A;  2KGE A;  2KGC A;  2X2B A;  4BPF A;  2QNW A;  2XZ1 C;  2KOS A;  3NY7 B;  3EJE A;  2L22 A;  1X3O A;  2DNW A;  1ACP A;  2N50 A;  4R0M A;  2GDY A;  2KG9 A;  2FQ0 A;  5KP8 B;  2CG5 B;  4PXH B;  4MRT C;  2KGA A;  2LIU A;  1HQB A;  1DV5 A;  2GDX A;  2AF8 A;  2MR7 A;  1KLP A;  4DG9 A;  2KR5 A;  3EJD A;  4H2W C;  4H2Y C;  2KWL A;  2MF4 A;  2KOR A;  2FVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...