2LIWA

Nmr structure of hmg-acpi domain from cura module from lyngbya majuscula
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase
molecule keywords CurA
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2liwA01
2K92A 2KR5A 3GZLA 2MVUA 2K0XA 4R0MA 1KLPA 2KW2A 4CA3A 1NQ4A 2M5RA 2N98A 2KG9A 2AVAA 2L4BA 2N6ZA 1T8KA 2FAEA 2MR8A 5HV8A 2L0QA 1OR5A 2FVAA 4DG9A 2FVEA 5KP7B 2CNRA 1HQBA 2DNWA 2FQ2A 4BPHA 2K93A 3EJBA 2CGQA 2KG6A 2KG8A 2KOPA 5EJDA 1ACPA 2CG5B 1L0HA 2N5HA 2LL8A 2MD9A 1F80D 2JU1A 2LTEA 2K94A 2KGAA 2KWLA 2EHSA 2AFEA 2EHTA 3NY7B 2GDYA 2JU2A 2LIWA 2FQ0A 2KOQA 2KORA 5KP6B 2MY5A 3LMOA 4PWVB 2LMLA 2N50A 4IZ6A 4PXHB 2VSQA 4MRTC 2CQ8A 2GDWA 2FACA 2FQ1A 2MF4A 2X2BA 2K0YA 4BPFA 4HKGA 4BPGA 2N5IA 2MR7A 5CZDB 4H2WC 1DNYA 2XZ0D 4H2XC 2QNWA 1X3OA 2N6YA 1L0IA 2FHSC 2PNGA 2L22A 1VKUA 5HVCA 3RG2A 1HY8A 2KOOA 2KOSA 2LIUA 4NEOA 2LOLA 2FADA 1DV5A 2KGEA 2KGCA 1AF8A 2KGDA 2XZ1C 2LPKA 2AF8A 2MVVA 2JQ4A 3EJDA 4H2YC 3GZMA 2LKIA 2GDXA 2L9FA 2ROQA 3CE7A 2JGPA 2FVFA 5KP8B 3EJEA 2AFDA 2K2QA
chains in the Genus database with same CATH superfamily
2K92A 2KR5A 4XROA 2PEJA 1E6JP 2KODA 1Q81Q 5I4TG 3CMAP 1QVFO 5HGLA 2K0XA 3P05A 3CXCO 2CWOA 3DTJA 2N98A 2KG9A 1QRJA 3B4QA 2FAEA 1OR5A 5KP7B 2CNRA 1EOQA 1S72P 4XFXA 2Z46A 2KG8A 5HGNA 2EFJA 2LL8A 1MZ8A 2JO0A 2K94A 1VQ5P 1ZNVA 2EHSA 5F2KA 3G1IA 3DS2A 1N8RQ 2GDYA 2JU2A 5KP6B 1VQ7P 4XFYA 2PENA 4PWVB 1GXHA 2EIAA 2N50A 2VSQA 4MRTC 2GDWA 3HZQA 2FACA 2K0YA 5DCKA 4BPFA 1UNKA 4HKGA 4BPGA 1Q86Q 1YJNP 1VQ8P 1X3OA 2XXMA 2N6YA 1L0IA 2FHSC 1A8OA 5HVCA 1VHNA 2BUOA 4PH0A 4M0IA 2LIUA 2KGCA 2DGYA 3G21A 2XZ1C 3CCVP 1Q82Q 2JB0A 2VLOA 3LRYA 2GDXA 3OW2O 2ROQA 4WYMA 3G28A 2GYKA 2JGPA 2AFDA 5F2NA 2PEMA 4U0FA 1VQLP 2VLNA 3E2DA 2MVUA 4GR6A 4COCA 1K9MQ 2P9XA 3CC2P 1GXGA 4CA3A 3WBHA 2Z45A 1T8KA 1VQOP 2MR8A 5HV8A 1KC8Q 2DNWA 3G6EP 5JPAA 2BHVA 3B5IA 1YHQP 2K93A 4UHPB 3DS3A 1RNIA 3GJNA 2JBGA 4U0DA 1ACPA 4XRQA 2N5HA 2MD9A 2M8LA 2PY8A 3CD6P 2VLPA 3DS4A 1IMQA 1YI2P 2MY5A 4GR2A 2X2BA 2QA4P 2N5IA 2OTJP 2MR7A 3CC7P 1K30A 2XZ0D 4H2XC 2QNWA 3G71P 3CCMP 1VQMP 1VQ9P 3CCEP 2PNGA 5F2OA 1GPJA 1VQPP 3CCLP 2JAZA 5BS2A 2LPKA 2MVVA 1Z6MA 4H2YC 2FVFA 3RG6C 1AYIA 2VLQA 2K2QA 2LF4A 3H47A 3HYBA 1K73Q 4U0AA 2Z44A 1KLPA 2PEQA 2M5RA 1M74A 2M8PA 1BAJA 3G0VA 2NO8A 4DG9A 1HQBA 2GZIA 4BPHA 2XV6A 3Q20A 5BS1A 2CGQA 2KG6A 2EG5A 3DPHA 2KOPA 5EJDA 2CG5B 2WPTA 2JU1A 2LTEA 1JJ2O 3CCSP 2KGAA 1AUMA 3GKLC 1VQKP 2AFEA 3G1GA 2E1MA 1VQ4P 3CPWO 4QNBA 2OARA 2LIWA 2GZEA 2KORA 4PH1A 2PEOA 1EMVA 1UJZA 4IZ6A 4PXHB 2JYLA 1E0HA 1YITP 2GZFA 4QKOA 2ERHA 4IPYA 1CEIA 1RO0A 5CZDB 4H2WC 3CC4P 1A43A 2L22A 3RG2A 1HY8A 2KOSA 2LOLA 2FADA 2KGEA 1EIAA 1QVGO 3EJDA 2LKIA 2L9FA 1NJIQ 1IUQA 1W2BO 3CE7A 3CCRP 3EJEA 3G29A 3GZLA 4U0CA 3H0DA 1YIJP 2GZGA 3CCUP 4R0MA 2KW2A 1YJ9P 3DS1A 1KD1Q 2PEIA 1IMPA 1NQ4A 1RO2A 2AVAA 3DS0A 2L4BA 1K8AQ 2N6ZA 3G4SP 2L0QA 2FVAA 2FVEA 5EW5E 1VQNP 3CCQP 2FQ2A 3MGEA 2PEKA 4F37A 3NTEA 4U0EA 3EJBA 3DS5A 2GZJA 1D1DA 1M6NA 3H4EA 1M6EX 1L0HA 1KQSO 1F80D 1ZMBA 3G26A 2K5XA 2KWLA 2EHTA 3I55P 3NY7B 5HGOA 3CCJP 2FQ0A 2KOQA 3M1MA 1M90Q 3LMOA 2LMLA 1FR2A 1M1KQ 2CQ8A 2XT1A 3CMEP 4COPA 1BXIA 2FQ1A 2MF4A 1Q7YQ 3U43A 2K0DX 1DNYA 4XFZA 3VRLC 4U0BA 1VKUA 2JYGA 2L6EA 2KOOA 4NEOA 1DV5A 2OTLP 1AF8A 2KGDA 2AF8A 2JQ4A 3GZMA 1VQ6P 5KP8B 5HGMA 7CEIA 1YJWP 2ONTA 3I56P 2M8NA 2QEXP
chains in the Genus database with same CATH topology
2K92A 2KR5A 3GZLA 2MVUA 2K0XA 4R0MA 1KLPA 2KW2A 4CA3A 1NQ4A 2M5RA 2N98A 2KG9A 2AVAA 2L4BA 2N6ZA 1T8KA 2FAEA 2MR8A 5HV8A 2L0QA 1OR5A 2FVAA 4DG9A 2FVEA 5KP7B 2CNRA 1HQBA 2DNWA 2FQ2A 4BPHA 2K93A 3EJBA 2CGQA 2KG6A 2KG8A 2KOPA 5EJDA 1ACPA 2CG5B 1L0HA 2N5HA 2LL8A 2MD9A 1F80D 2JU1A 2LTEA 2K94A 2KGAA 2KWLA 2EHSA 2AFEA 2EHTA 3NY7B 2GDYA 2JU2A 2LIWA 2FQ0A 2KOQA 2KORA 5KP6B 2MY5A 3LMOA 4PWVB 2LMLA 2N50A 4IZ6A 4PXHB 2VSQA 4MRTC 2CQ8A 2GDWA 2FACA 2FQ1A 2MF4A 2X2BA 2K0YA 4BPFA 4HKGA 4BPGA 2N5IA 2MR7A 5CZDB 4H2WC 1DNYA 2XZ0D 4H2XC 2QNWA 1X3OA 2N6YA 1L0IA 2FHSC 2PNGA 2L22A 1VKUA 5HVCA 3RG2A 1HY8A 2KOOA 2KOSA 2LIUA 4NEOA 2LOLA 2FADA 1DV5A 2KGEA 2KGCA 1AF8A 2KGDA 2XZ1C 2LPKA 2AF8A 2MVVA 2JQ4A 3EJDA 4H2YC 3GZMA 2LKIA 2GDXA 2L9FA 2ROQA 3CE7A 2JGPA 2FVFA 5KP8B 3EJEA 2AFDA 2K2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K92 A;  2KR5 A;  3GZL A;  2MVU A;  2K0X A;  4R0M A;  1KLP A;  2KW2 A;  4CA3 A;  1NQ4 A;  2M5R A;  2N98 A;  2KG9 A;  2AVA A;  2L4B A;  2N6Z A;  1T8K A;  2FAE A;  2MR8 A;  5HV8 A;  2L0Q A;  1OR5 A;  2FVA A;  4DG9 A;  2FVE A;  5KP7 B;  2CNR A;  1HQB A;  2DNW A;  2FQ2 A;  4BPH A;  2K93 A;  3EJB A;  2CGQ A;  2KG6 A;  2KG8 A;  2KOP A;  5EJD A;  1ACP A;  2CG5 B;  1L0H A;  2N5H A;  2LL8 A;  2MD9 A;  1F80 D;  2JU1 A;  2LTE A;  2K94 A;  2KGA A;  2KWL A;  2EHS A;  2AFE A;  2EHT A;  3NY7 B;  2GDY A;  2JU2 A;  2LIW A;  2FQ0 A;  2KOQ A;  2KOR A;  5KP6 B;  2MY5 A;  3LMO A;  4PWV B;  2LML A;  2N50 A;  4IZ6 A;  4PXH B;  2VSQ A;  4MRT C;  2CQ8 A;  2GDW A;  2FAC A;  2FQ1 A;  2MF4 A;  2X2B A;  2K0Y A;  4BPF A;  4HKG A;  4BPG A;  2N5I A;  2MR7 A;  5CZD B;  4H2W C;  1DNY A;  2XZ0 D;  4H2X C;  2QNW A;  1X3O A;  2N6Y A;  1L0I A;  2FHS C;  2PNG A;  2L22 A;  1VKU A;  5HVC A;  3RG2 A;  1HY8 A;  2KOO A;  2KOS A;  2LIU A;  4NEO A;  2LOL A;  2FAD A;  1DV5 A;  2KGE A;  2KGC A;  1AF8 A;  2KGD A;  2XZ1 C;  2LPK A;  2AF8 A;  2MVV A;  2JQ4 A;  3EJD A;  4H2Y C;  3GZM A;  2LKI A;  2GDX A;  2L9F A;  2ROQ A;  3CE7 A;  2JGP A;  2FVF A;  5KP8 B;  3EJE A;  2AFD A;  2K2Q A; 
#chains in the Genus database with same CATH topology
 2K92 A;  2KR5 A;  4XRO A;  2PEJ A;  1E6J P;  2KOD A;  1Q81 Q;  5I4T G;  3CMA P;  1QVF O;  5HGL A;  2K0X A;  3P05 A;  3CXC O;  2CWO A;  3DTJ A;  2N98 A;  2KG9 A;  1QRJ A;  3B4Q A;  2FAE A;  1OR5 A;  5KP7 B;  2CNR A;  1EOQ A;  1S72 P;  4XFX A;  2Z46 A;  2KG8 A;  5HGN A;  2EFJ A;  2LL8 A;  1MZ8 A;  2JO0 A;  2K94 A;  1VQ5 P;  1ZNV A;  2EHS A;  5F2K A;  3G1I A;  3DS2 A;  1N8R Q;  2GDY A;  2JU2 A;  5KP6 B;  1VQ7 P;  4XFY A;  2PEN A;  4PWV B;  1GXH A;  2EIA A;  2N50 A;  2VSQ A;  4MRT C;  2GDW A;  3HZQ A;  2FAC A;  2K0Y A;  5DCK A;  4BPF A;  1UNK A;  4HKG A;  4BPG A;  1Q86 Q;  1YJN P;  1VQ8 P;  1X3O A;  2XXM A;  2N6Y A;  1L0I A;  2FHS C;  1A8O A;  5HVC A;  1VHN A;  2BUO A;  4PH0 A;  4M0I A;  2LIU A;  2KGC A;  2DGY A;  3G21 A;  2XZ1 C;  3CCV P;  1Q82 Q;  2JB0 A;  2VLO A;  3LRY A;  2GDX A;  3OW2 O;  2ROQ A;  4WYM A;  3G28 A;  2GYK A;  2JGP A;  2AFD A;  5F2N A;  2PEM A;  4U0F A;  1VQL P;  2VLN A;  3E2D A;  2MVU A;  4GR6 A;  4COC A;  1K9M Q;  2P9X A;  3CC2 P;  1GXG A;  4CA3 A;  3WBH A;  2Z45 A;  1T8K A;  1VQO P;  2MR8 A;  5HV8 A;  1KC8 Q;  2DNW A;  3G6E P;  5JPA A;  2BHV A;  3B5I A;  1YHQ P;  2K93 A;  4UHP B;  3DS3 A;  1RNI A;  3GJN A;  2JBG A;  4U0D A;  1ACP A;  4XRQ A;  2N5H A;  2MD9 A;  2M8L A;  2PY8 A;  3CD6 P;  2VLP A;  3DS4 A;  1IMQ A;  1YI2 P;  2MY5 A;  4GR2 A;  2X2B A;  2QA4 P;  2N5I A;  2OTJ P;  2MR7 A;  3CC7 P;  1K30 A;  2XZ0 D;  4H2X C;  2QNW A;  3G71 P;  3CCM P;  1VQM P;  1VQ9 P;  3CCE P;  2PNG A;  5F2O A;  1GPJ A;  1VQP P;  3CCL P;  2JAZ A;  5BS2 A;  2LPK A;  2MVV A;  1Z6M A;  4H2Y C;  2FVF A;  3RG6 C;  1AYI A;  2VLQ A;  2K2Q A;  2LF4 A;  3H47 A;  3HYB A;  1K73 Q;  4U0A A;  2Z44 A;  1KLP A;  2PEQ A;  2M5R A;  1M74 A;  2M8P A;  1BAJ A;  3G0V A;  2NO8 A;  4DG9 A;  1HQB A;  2GZI A;  4BPH A;  2XV6 A;  3Q20 A;  5BS1 A;  2CGQ A;  2KG6 A;  2EG5 A;  3DPH A;  2KOP A;  5EJD A;  2CG5 B;  2WPT A;  2JU1 A;  2LTE A;  1JJ2 O;  3CCS P;  2KGA A;  1AUM A;  3GKL C;  1VQK P;  2AFE A;  3G1G A;  2E1M A;  1VQ4 P;  3CPW O;  4QNB A;  2OAR A;  2LIW A;  2GZE A;  2KOR A;  4PH1 A;  2PEO A;  1EMV A;  1UJZ A;  4IZ6 A;  4PXH B;  2JYL A;  1E0H A;  1YIT P;  2GZF A;  4QKO A;  2ERH A;  4IPY A;  1CEI A;  1RO0 A;  5CZD B;  4H2W C;  3CC4 P;  1A43 A;  2L22 A;  3RG2 A;  1HY8 A;  2KOS A;  2LOL A;  2FAD A;  2KGE A;  1EIA A;  1QVG O;  3EJD A;  2LKI A;  2L9F A;  1NJI Q;  1IUQ A;  1W2B O;  3CE7 A;  3CCR P;  3EJE A;  3G29 A;  3GZL A;  4U0C A;  3H0D A;  1YIJ P;  2GZG A;  3CCU P;  4R0M A;  2KW2 A;  1YJ9 P;  3DS1 A;  1KD1 Q;  2PEI A;  1IMP A;  1NQ4 A;  1RO2 A;  2AVA A;  3DS0 A;  2L4B A;  1K8A Q;  2N6Z A;  3G4S P;  2L0Q A;  2FVA A;  2FVE A;  5EW5 E;  1VQN P;  3CCQ P;  2FQ2 A;  3MGE A;  2PEK A;  4F37 A;  3NTE A;  4U0E A;  3EJB A;  3DS5 A;  2GZJ A;  1D1D A;  1M6N A;  3H4E A;  1M6E X;  1L0H A;  1KQS O;  1F80 D;  1ZMB A;  3G26 A;  2K5X A;  2KWL A;  2EHT A;  3I55 P;  3NY7 B;  5HGO A;  3CCJ P;  2FQ0 A;  2KOQ A;  3M1M A;  1M90 Q;  3LMO A;  2LML A;  1FR2 A;  1M1K Q;  2CQ8 A;  2XT1 A;  3CME P;  4COP A;  1BXI A;  2FQ1 A;  2MF4 A;  1Q7Y Q;  3U43 A;  2K0D X;  1DNY A;  4XFZ A;  3VRL C;  4U0B A;  1VKU A;  2JYG A;  2L6E A;  2KOO A;  4NEO A;  1DV5 A;  2OTL P;  1AF8 A;  2KGD A;  2AF8 A;  2JQ4 A;  3GZM A;  1VQ6 P;  5KP8 B;  5HGM A;  7CEI A;  1YJW P;  2ONT A;  3I56 P;  2M8N A;  2QEX P; 
#chains in the Genus database with same CATH homology
 2K92 A;  2KR5 A;  3GZL A;  2MVU A;  2K0X A;  4R0M A;  1KLP A;  2KW2 A;  4CA3 A;  1NQ4 A;  2M5R A;  2N98 A;  2KG9 A;  2AVA A;  2L4B A;  2N6Z A;  1T8K A;  2FAE A;  2MR8 A;  5HV8 A;  2L0Q A;  1OR5 A;  2FVA A;  4DG9 A;  2FVE A;  5KP7 B;  2CNR A;  1HQB A;  2DNW A;  2FQ2 A;  4BPH A;  2K93 A;  3EJB A;  2CGQ A;  2KG6 A;  2KG8 A;  2KOP A;  5EJD A;  1ACP A;  2CG5 B;  1L0H A;  2N5H A;  2LL8 A;  2MD9 A;  1F80 D;  2JU1 A;  2LTE A;  2K94 A;  2KGA A;  2KWL A;  2EHS A;  2AFE A;  2EHT A;  3NY7 B;  2GDY A;  2JU2 A;  2LIW A;  2FQ0 A;  2KOQ A;  2KOR A;  5KP6 B;  2MY5 A;  3LMO A;  4PWV B;  2LML A;  2N50 A;  4IZ6 A;  4PXH B;  2VSQ A;  4MRT C;  2CQ8 A;  2GDW A;  2FAC A;  2FQ1 A;  2MF4 A;  2X2B A;  2K0Y A;  4BPF A;  4HKG A;  4BPG A;  2N5I A;  2MR7 A;  5CZD B;  4H2W C;  1DNY A;  2XZ0 D;  4H2X C;  2QNW A;  1X3O A;  2N6Y A;  1L0I A;  2FHS C;  2PNG A;  2L22 A;  1VKU A;  5HVC A;  3RG2 A;  1HY8 A;  2KOO A;  2KOS A;  2LIU A;  4NEO A;  2LOL A;  2FAD A;  1DV5 A;  2KGE A;  2KGC A;  1AF8 A;  2KGD A;  2XZ1 C;  2LPK A;  2AF8 A;  2MVV A;  2JQ4 A;  3EJD A;  4H2Y C;  3GZM A;  2LKI A;  2GDX A;  2L9F A;  2ROQ A;  3CE7 A;  2JGP A;  2FVF A;  5KP8 B;  3EJE A;  2AFD A;  2K2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...