2LIWA

Nmr structure of hmg-acpi domain from cura module from lyngbya majuscula
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase
molecule keywords CurA
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2liwA01
2XZ1C 2M5RA 2ROQA 3EJEA 2KG6A 2FHSC 2MF4A 2JU1A 2JQ4A 5CZDB 2GDWA 2AVAA 5EJDA 2FQ1A 2LIWA 2KG9A 5KP8B 2LIUA 2N6ZA 2FAEA 2FVFA 1HY8A 3CE7A 2KOOA 2K0XA 2GDXA 2PNGA 2K0YA 5KP6B 3LMOA 2JGPA 2XZ0D 2L22A 3RG2A 1F80D 2EHTA 2JU2A 4BPGA 1NQ4A 2AF8A 4BPHA 2FACA 2K93A 2CG5B 2K2QA 1DV5A 2CNRA 2FQ2A 2KWLA 2KG8A 2KOSA 2N98A 1AF8A 2LPKA 3NY7B 4MRTC 2KW2A 4H2WC 2K94A 2KGEA 2MR7A 1KLPA 3GZMA 2MD9A 2L4BA 3EJBA 4H2XC 2L9FA 1HQBA 2KR5A 2LKIA 2AFDA 2GDYA 2LL8A 2N6YA 2N5HA 2MR8A 1T8KA 2K92A 2KGAA 4PXHB 1VKUA 2KGDA 2MVUA 2MVVA 4PWVB 1ACPA 4H2YC 3EJDA 2LOLA 4IZ6A 2FVEA 2FADA 4NEOA 2DNWA 2KOPA 1DNYA 2MY5A 2CQ8A 2LMLA 2FVAA 2LTEA 1X3OA 2N5IA 2FQ0A 5KP7B 2L0QA 4BPFA 5HVCA 3GZLA 2KGCA 5HV8A 2KOQA 1L0IA 2EHSA 2QNWA 4HKGA 4R0MA 4CA3A 2N50A 2VSQA 1L0HA 2X2BA 4DG9A 2KORA 1OR5A 2CGQA 2AFEA
chains in the Genus database with same CATH superfamily
2WPTA 3CC7P 3EJEA 2KG6A 2FHSC 2E1MA 5EJDA 5KP8B 2LIUA 2PY8A 4F37A 4U0DA 5I4TG 3DS5A 3CXCO 3DS1A 2K0YA 3G1GA 2VLOA 1YJNP 5KP6B 2OTJP 1KQSO 2XZ0D 3CC4P 2JU2A 2Z45A 4BPHA 3CCUP 1MZ8A 3H47A 1DV5A 2FQ2A 2LF4A 2KWLA 2GZFA 3H0DA 1YITP 3CD6P 4MRTC 1VQKP 3RG6C 2K94A 2XV6A 2KGEA 2GYKA 1Z6MA 1UNKA 5F2OA 1VQMP 4H2XC 2XT1A 2GZEA 2L9FA 1AUMA 2LKIA 2LL8A 2EFJA 3G4SP 2CWOA 2JYGA 2GZJA 1CEIA 4QNBA 2M8PA 3DS2A 2JB0A 3CC2P 2K0DX 2MVUA 3H4EA 5HGOA 2MVVA 1ACPA 2GZGA 2ONTA 2OARA 1RO2A 3EJDA 4IZ6A 1Q7YQ 1QVGO 1E0HA 1VQ7P 2PEKA 1FR2A 2DNWA 3G26A 3I56P 2PEMA 1S72P 3CCLP 3G29A 4XFYA 3GZLA 1VHNA 3DPHA 5HV8A 2KOQA 3LRYA 2EHSA 3CCEP 4U0FA 4QKOA 4DG9A 3CCSP 1EMVA 1OR5A 2CGQA 3CCRP 4BPFA 2XZ1C 2M5RA 2ROQA 2PEIA 1VQLP 2JU1A 2JQ4A 2Z44A 2AVAA 2LIWA 1RO0A 2N6ZA 1K8AQ 3G6EP 1A8OA 2FAEA 3DS4A 2PEQA 5F2KA 5JPAA 1YHQP 5EW5E 3U43A 3G28A 2EG5A 2KOOA 2K0XA 1KC8Q 1BAJA 3CCVP 3RG2A 1F80D 2EHTA 5HGNA 4XROA 2CG5B 4COCA 3I55P 1Q82Q 2PEOA 1AF8A 3M1MA 1GXHA 5DCKA 4PH0A 2JBGA 3MGEA 3HYBA 3CMAP 1W2BO 2OTLP 2N6YA 2M8LA 2K92A 4XRQA 4PH1A 2KODA 1VKUA 3G71P 2EIAA 4NEOA 2KOPA 2P9XA 4U0AA 1YI2P 2LMLA 4GR2A 2VLQA 2N5IA 2BHVA 3DS3A 3OW2O 5HVCA 2VLPA 1KD1Q 4GR6A 2QNWA 4HKGA 4R0MA 4CA3A 3CCQP 2X2BA 4U0BA 2KORA 2AFEA 1VQ5P 2MF4A 5CZDB 3WBHA 1M6EX 2KG9A 1EOQA 3HZQA 1UJZA 2FVFA 7CEIA 5F2NA 2NO8A 3CMEP 3CE7A 2PNGA 4M0IA 2JGPA 3B5IA 1JJ2O 1YJWP 4BPGA 1NQ4A 2AF8A 5BS2A 2FACA 3VRLC 3GJNA 2JYLA 2KG8A 2KOSA 3DS0A 2N98A 4XFZA 1N8RQ 2KW2A 4H2WC 3G0VA 4UHPB 1RNIA 3G1IA 2MR7A 1KLPA 3CCMP 4U0EA 1VQ6P 1HQBA 2KR5A 2AFDA 1VQNP 1M74A 2N5HA 1IMPA 1D1DA 1Q86Q 2GZIA 2JO0A 3CCJP 4PWVB 1A43A 1YIJP 1VQ8P 2L6EA 2LOLA 1EIAA 2FVEA 2CQ8A 3NTEA 2BUOA 1BXIA 1AYIA 2LTEA 3GKLC 1QRJA 2FQ0A 5KP7B 2L0QA 1NJIQ 2KGCA 1VQ9P 1K73Q 1L0HA 2PENA 2QA4P 1M90Q 5BS1A 2PEJA 2GDWA 1ZNVA 2FQ1A 3CPWO 1HY8A 2ERHA 2GDXA 3LMOA 2L22A 1K30A 1E6JP 4IPYA 4XFXA 2K93A 1VQOP 3Q20A 2K2QA 2CNRA 1K9MQ 5HGLA 3DTJA 2LPKA 1GXGA 3NY7B 4U0CA 3G21A 1M1KQ 3GZMA 2MD9A 2L4BA 3EJBA 2GDYA 1VQ4P 1GPJA 1QVFO 1M6NA 2MR8A 1T8KA 3E2DA 2KGAA 4PXHB 2KGDA 5HGMA 4H2YC 2VLNA 1IMQA 2FADA 2XXMA 2M8NA 1DNYA 2MY5A 3P05A 4COPA 2QEXP 1VQPP 1ZMBA 2FVAA 1X3OA 2Z46A 2DGYA 2K5XA 3B4QA 1IUQA 2JAZA 1Q81Q 1YJ9P 1L0IA 2N50A 2VSQA 4WYMA
chains in the Genus database with same CATH topology
2XZ1C 2M5RA 2ROQA 3EJEA 2KG6A 2FHSC 2MF4A 2JU1A 2JQ4A 5CZDB 2GDWA 2AVAA 5EJDA 2FQ1A 2LIWA 2KG9A 5KP8B 2LIUA 2N6ZA 2FAEA 2FVFA 1HY8A 3CE7A 2KOOA 2K0XA 2GDXA 2PNGA 2K0YA 5KP6B 3LMOA 2JGPA 2XZ0D 2L22A 3RG2A 1F80D 2EHTA 2JU2A 4BPGA 1NQ4A 2AF8A 4BPHA 2FACA 2K93A 2CG5B 2K2QA 1DV5A 2CNRA 2FQ2A 2KWLA 2KG8A 2KOSA 2N98A 1AF8A 2LPKA 3NY7B 4MRTC 2KW2A 4H2WC 2K94A 2KGEA 2MR7A 1KLPA 3GZMA 2MD9A 2L4BA 3EJBA 4H2XC 2L9FA 1HQBA 2KR5A 2LKIA 2AFDA 2GDYA 2LL8A 2N6YA 2N5HA 2MR8A 1T8KA 2K92A 2KGAA 4PXHB 1VKUA 2KGDA 2MVUA 2MVVA 4PWVB 1ACPA 4H2YC 3EJDA 2LOLA 4IZ6A 2FVEA 2FADA 4NEOA 2DNWA 2KOPA 1DNYA 2MY5A 2CQ8A 2LMLA 2FVAA 2LTEA 1X3OA 2N5IA 2FQ0A 5KP7B 2L0QA 4BPFA 5HVCA 3GZLA 2KGCA 5HV8A 2KOQA 1L0IA 2EHSA 2QNWA 4HKGA 4R0MA 4CA3A 2N50A 2VSQA 1L0HA 2X2BA 4DG9A 2KORA 1OR5A 2CGQA 2AFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZ1 C;  2M5R A;  2ROQ A;  3EJE A;  2KG6 A;  2FHS C;  2MF4 A;  2JU1 A;  2JQ4 A;  5CZD B;  2GDW A;  2AVA A;  5EJD A;  2FQ1 A;  2LIW A;  2KG9 A;  5KP8 B;  2LIU A;  2N6Z A;  2FAE A;  2FVF A;  1HY8 A;  3CE7 A;  2KOO A;  2K0X A;  2GDX A;  2PNG A;  2K0Y A;  5KP6 B;  3LMO A;  2JGP A;  2XZ0 D;  2L22 A;  3RG2 A;  1F80 D;  2EHT A;  2JU2 A;  4BPG A;  1NQ4 A;  2AF8 A;  4BPH A;  2FAC A;  2K93 A;  2CG5 B;  2K2Q A;  1DV5 A;  2CNR A;  2FQ2 A;  2KWL A;  2KG8 A;  2KOS A;  2N98 A;  1AF8 A;  2LPK A;  3NY7 B;  4MRT C;  2KW2 A;  4H2W C;  2K94 A;  2KGE A;  2MR7 A;  1KLP A;  3GZM A;  2MD9 A;  2L4B A;  3EJB A;  4H2X C;  2L9F A;  1HQB A;  2KR5 A;  2LKI A;  2AFD A;  2GDY A;  2LL8 A;  2N6Y A;  2N5H A;  2MR8 A;  1T8K A;  2K92 A;  2KGA A;  4PXH B;  1VKU A;  2KGD A;  2MVU A;  2MVV A;  4PWV B;  1ACP A;  4H2Y C;  3EJD A;  2LOL A;  4IZ6 A;  2FVE A;  2FAD A;  4NEO A;  2DNW A;  2KOP A;  1DNY A;  2MY5 A;  2CQ8 A;  2LML A;  2FVA A;  2LTE A;  1X3O A;  2N5I A;  2FQ0 A;  5KP7 B;  2L0Q A;  4BPF A;  5HVC A;  3GZL A;  2KGC A;  5HV8 A;  2KOQ A;  1L0I A;  2EHS A;  2QNW A;  4HKG A;  4R0M A;  4CA3 A;  2N50 A;  2VSQ A;  1L0H A;  2X2B A;  4DG9 A;  2KOR A;  1OR5 A;  2CGQ A;  2AFE A; 
#chains in the Genus database with same CATH topology
 2WPT A;  3CC7 P;  3EJE A;  2KG6 A;  2FHS C;  2E1M A;  5EJD A;  5KP8 B;  2LIU A;  2PY8 A;  4F37 A;  4U0D A;  5I4T G;  3DS5 A;  3CXC O;  3DS1 A;  2K0Y A;  3G1G A;  2VLO A;  1YJN P;  5KP6 B;  2OTJ P;  1KQS O;  2XZ0 D;  3CC4 P;  2JU2 A;  2Z45 A;  4BPH A;  3CCU P;  1MZ8 A;  3H47 A;  1DV5 A;  2FQ2 A;  2LF4 A;  2KWL A;  2GZF A;  3H0D A;  1YIT P;  3CD6 P;  4MRT C;  1VQK P;  3RG6 C;  2K94 A;  2XV6 A;  2KGE A;  2GYK A;  1Z6M A;  1UNK A;  5F2O A;  1VQM P;  4H2X C;  2XT1 A;  2GZE A;  2L9F A;  1AUM A;  2LKI A;  2LL8 A;  2EFJ A;  3G4S P;  2CWO A;  2JYG A;  2GZJ A;  1CEI A;  4QNB A;  2M8P A;  3DS2 A;  2JB0 A;  3CC2 P;  2K0D X;  2MVU A;  3H4E A;  5HGO A;  2MVV A;  1ACP A;  2GZG A;  2ONT A;  2OAR A;  1RO2 A;  3EJD A;  4IZ6 A;  1Q7Y Q;  1QVG O;  1E0H A;  1VQ7 P;  2PEK A;  1FR2 A;  2DNW A;  3G26 A;  3I56 P;  2PEM A;  1S72 P;  3CCL P;  3G29 A;  4XFY A;  3GZL A;  1VHN A;  3DPH A;  5HV8 A;  2KOQ A;  3LRY A;  2EHS A;  3CCE P;  4U0F A;  4QKO A;  4DG9 A;  3CCS P;  1EMV A;  1OR5 A;  2CGQ A;  3CCR P;  4BPF A;  2XZ1 C;  2M5R A;  2ROQ A;  2PEI A;  1VQL P;  2JU1 A;  2JQ4 A;  2Z44 A;  2AVA A;  2LIW A;  1RO0 A;  2N6Z A;  1K8A Q;  3G6E P;  1A8O A;  2FAE A;  3DS4 A;  2PEQ A;  5F2K A;  5JPA A;  1YHQ P;  5EW5 E;  3U43 A;  3G28 A;  2EG5 A;  2KOO A;  2K0X A;  1KC8 Q;  1BAJ A;  3CCV P;  3RG2 A;  1F80 D;  2EHT A;  5HGN A;  4XRO A;  2CG5 B;  4COC A;  3I55 P;  1Q82 Q;  2PEO A;  1AF8 A;  3M1M A;  1GXH A;  5DCK A;  4PH0 A;  2JBG A;  3MGE A;  3HYB A;  3CMA P;  1W2B O;  2OTL P;  2N6Y A;  2M8L A;  2K92 A;  4XRQ A;  4PH1 A;  2KOD A;  1VKU A;  3G71 P;  2EIA A;  4NEO A;  2KOP A;  2P9X A;  4U0A A;  1YI2 P;  2LML A;  4GR2 A;  2VLQ A;  2N5I A;  2BHV A;  3DS3 A;  3OW2 O;  5HVC A;  2VLP A;  1KD1 Q;  4GR6 A;  2QNW A;  4HKG A;  4R0M A;  4CA3 A;  3CCQ P;  2X2B A;  4U0B A;  2KOR A;  2AFE A;  1VQ5 P;  2MF4 A;  5CZD B;  3WBH A;  1M6E X;  2KG9 A;  1EOQ A;  3HZQ A;  1UJZ A;  2FVF A;  7CEI A;  5F2N A;  2NO8 A;  3CME P;  3CE7 A;  2PNG A;  4M0I A;  2JGP A;  3B5I A;  1JJ2 O;  1YJW P;  4BPG A;  1NQ4 A;  2AF8 A;  5BS2 A;  2FAC A;  3VRL C;  3GJN A;  2JYL A;  2KG8 A;  2KOS A;  3DS0 A;  2N98 A;  4XFZ A;  1N8R Q;  2KW2 A;  4H2W C;  3G0V A;  4UHP B;  1RNI A;  3G1I A;  2MR7 A;  1KLP A;  3CCM P;  4U0E A;  1VQ6 P;  1HQB A;  2KR5 A;  2AFD A;  1VQN P;  1M74 A;  2N5H A;  1IMP A;  1D1D A;  1Q86 Q;  2GZI A;  2JO0 A;  3CCJ P;  4PWV B;  1A43 A;  1YIJ P;  1VQ8 P;  2L6E A;  2LOL A;  1EIA A;  2FVE A;  2CQ8 A;  3NTE A;  2BUO A;  1BXI A;  1AYI A;  2LTE A;  3GKL C;  1QRJ A;  2FQ0 A;  5KP7 B;  2L0Q A;  1NJI Q;  2KGC A;  1VQ9 P;  1K73 Q;  1L0H A;  2PEN A;  2QA4 P;  1M90 Q;  5BS1 A;  2PEJ A;  2GDW A;  1ZNV A;  2FQ1 A;  3CPW O;  1HY8 A;  2ERH A;  2GDX A;  3LMO A;  2L22 A;  1K30 A;  1E6J P;  4IPY A;  4XFX A;  2K93 A;  1VQO P;  3Q20 A;  2K2Q A;  2CNR A;  1K9M Q;  5HGL A;  3DTJ A;  2LPK A;  1GXG A;  3NY7 B;  4U0C A;  3G21 A;  1M1K Q;  3GZM A;  2MD9 A;  2L4B A;  3EJB A;  2GDY A;  1VQ4 P;  1GPJ A;  1QVF O;  1M6N A;  2MR8 A;  1T8K A;  3E2D A;  2KGA A;  4PXH B;  2KGD A;  5HGM A;  4H2Y C;  2VLN A;  1IMQ A;  2FAD A;  2XXM A;  2M8N A;  1DNY A;  2MY5 A;  3P05 A;  4COP A;  2QEX P;  1VQP P;  1ZMB A;  2FVA A;  1X3O A;  2Z46 A;  2DGY A;  2K5X A;  3B4Q A;  1IUQ A;  2JAZ A;  1Q81 Q;  1YJ9 P;  1L0I A;  2N50 A;  2VSQ A;  4WYM A; 
#chains in the Genus database with same CATH homology
 2XZ1 C;  2M5R A;  2ROQ A;  3EJE A;  2KG6 A;  2FHS C;  2MF4 A;  2JU1 A;  2JQ4 A;  5CZD B;  2GDW A;  2AVA A;  5EJD A;  2FQ1 A;  2LIW A;  2KG9 A;  5KP8 B;  2LIU A;  2N6Z A;  2FAE A;  2FVF A;  1HY8 A;  3CE7 A;  2KOO A;  2K0X A;  2GDX A;  2PNG A;  2K0Y A;  5KP6 B;  3LMO A;  2JGP A;  2XZ0 D;  2L22 A;  3RG2 A;  1F80 D;  2EHT A;  2JU2 A;  4BPG A;  1NQ4 A;  2AF8 A;  4BPH A;  2FAC A;  2K93 A;  2CG5 B;  2K2Q A;  1DV5 A;  2CNR A;  2FQ2 A;  2KWL A;  2KG8 A;  2KOS A;  2N98 A;  1AF8 A;  2LPK A;  3NY7 B;  4MRT C;  2KW2 A;  4H2W C;  2K94 A;  2KGE A;  2MR7 A;  1KLP A;  3GZM A;  2MD9 A;  2L4B A;  3EJB A;  4H2X C;  2L9F A;  1HQB A;  2KR5 A;  2LKI A;  2AFD A;  2GDY A;  2LL8 A;  2N6Y A;  2N5H A;  2MR8 A;  1T8K A;  2K92 A;  2KGA A;  4PXH B;  1VKU A;  2KGD A;  2MVU A;  2MVV A;  4PWV B;  1ACP A;  4H2Y C;  3EJD A;  2LOL A;  4IZ6 A;  2FVE A;  2FAD A;  4NEO A;  2DNW A;  2KOP A;  1DNY A;  2MY5 A;  2CQ8 A;  2LML A;  2FVA A;  2LTE A;  1X3O A;  2N5I A;  2FQ0 A;  5KP7 B;  2L0Q A;  4BPF A;  5HVC A;  3GZL A;  2KGC A;  5HV8 A;  2KOQ A;  1L0I A;  2EHS A;  2QNW A;  4HKG A;  4R0M A;  4CA3 A;  2N50 A;  2VSQ A;  1L0H A;  2X2B A;  4DG9 A;  2KOR A;  1OR5 A;  2CGQ A;  2AFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...