5CZDB

The complex structure of vink with vinl
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
MWDAQFENLLRRYLPFLSADQPLEQDINLRDIGLDSLGTVELLSELENTYDVHFQDEALTKETFETPGVLWKTLSQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based analysis of the molecular interactions between acyltransferase and acyl carrier protein in vicenistatin biosynthesis.
pubmed doi rcsb
source organism Streptomyces halstedii
molecule tags Transferase
molecule keywords Malonyl-CoA-[acyl-carrier-protein] transacylase
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5czdB00
2FAEA 2KG6A 2ROQA 4BPGA 2LOLA 2L0QA 2L9FA 2K0YA 2FVEA 2VSQA 4H2WC 1KLPA 4MRTC 1HQBA 2LKIA 2KW2A 2LIUA 4NEOA 2FHSC 2CG5B 3EJEA 2K93A 2DNWA 2GDWA 2AFDA 5KP7B 1AF8A 2KGEA 1L0HA 1F80D 2FQ1A 2N5HA 2CGQA 2KWLA 2KGAA 2JU2A 3RG2A 2LPKA 5EJDA 2MR8A 2MR7A 2M5RA 1T8KA 2KGCA 2FVFA 2N6YA 2QNWA 3EJBA 2KOOA 2KR5A 2N6ZA 1L0IA 3NY7B 2CNRA 1DNYA 2K2QA 4H2XC 4PWVB 2FQ2A 2KOPA 2KOSA 4HKGA 2N50A 3CE7A 2LMLA 4BPHA 2AFEA 2MVVA 2XZ0D 2N5IA 2KG8A 2FQ0A 2L22A 2MF4A 2KG9A 2EHTA 2JU1A 2L4BA 4DG9A 2GDXA 5HV8A 2AVAA 1X3OA 2JGPA 4CA3A 2K0XA 2PNGA 2MD9A 3EJDA 2KGDA 5CZDB 2K94A 4H2YC 5KP8B 2CQ8A 3GZMA 2FVAA 4BPFA 2FACA 2LIWA 2FADA 2XZ1C 1OR5A 1ACPA 3GZLA 4R0MA 2MY5A 3LMOA 4PXHB 2JQ4A 5KP6B 2MVUA 2X2BA 1NQ4A 4IZ6A 2EHSA 2GDYA 1DV5A 2KORA 2LTEA 2LL8A 1HY8A 2AF8A 2KOQA 2K92A 5HVCA 1VKUA 2N98A
chains in the Genus database with same CATH superfamily
2GZGA 4GR6A 3H47A 2JYLA 1VQ8P 2ROQA 2L9FA 3I55P 1GXGA 2JB0A 5HGNA 4MRTC 2LKIA 2M8NA 1KD1Q 1VQLP 2CG5B 3G4SP 2GZIA 1M6EX 1IUQA 1F80D 3NTEA 3G26A 1IMQA 1FR2A 1VQ7P 2MR7A 2EIAA 2FVFA 2PEOA 4IPYA 3NY7B 2N6ZA 1L0IA 3DS1A 3G0VA 2FQ2A 7CEIA 4XROA 4U0BA 3G1IA 4BPHA 1ZNVA 2MVVA 3CD6P 5HV8A 3OW2O 2OTJP 2PENA 1UJZA 1IMPA 2MD9A 2DGYA 1MZ8A 3M1MA 2VLOA 4UHPB 4BPFA 2LIWA 1RO0A 1Q86Q 5BS1A 1OR5A 3CCSP 3U43A 1Q7YQ 1A8OA 2GZFA 3G6EP 2PEKA 1VQ5P 3DS4A 2MVUA 2X2BA 4GR2A 5HGMA 3WBHA 2GDYA 2LTEA 2K5XA 2K92A 4U0FA 1QRJA 3H4EA 3CCUP 3G71P 2XV6A 2K0YA 2JAZA 3DS2A 5HGOA 3HYBA 5HGLA 1VQ4P 4F37A 2M8PA 1KC8Q 3G21A 3CC7P 1HQBA 4U0AA 2LIUA 3DTJA 1YITP 2PEJA 3CCJP 1EIAA 2DNWA 2GDWA 2AFDA 2XXMA 2FQ1A 3B4QA 2N5HA 2KGAA 2VLPA 1E6JP 2LPKA 3CCRP 2GYKA 5EW5E 2QNWA 2KR5A 1K30A 4PH1A 1DNYA 1RO2A 4PWVB 1N8RQ 2N50A 1M90Q 2AFEA 3CMAP 2N5IA 5BS2A 2MF4A 4PH0A 2KG9A 3CC4P 2NO8A 2L4BA 4DG9A 1YJNP 2AVAA 2JGPA 1D1DA 2PNGA 1VQ9P 2KGDA 3HZQA 5CZDB 1BXIA 4H2YC 2CQ8A 1GPJA 2FVAA 3E2DA 2FACA 4XFXA 1YHQP 1VQOP 3G29A 2XZ1C 3CCVP 1ACPA 4R0MA 2MY5A 3I56P 1GXHA 2EHSA 1DV5A 2KORA 1ZMBA 2L6EA 2LL8A 2Z45A 3CMEP 2XT1A 1VKUA 1E0HA 1A43A 2KG6A 1CEIA 1AUMA 4BPGA 1Q82Q 1Z6MA 4H2WC 3P05A 1KLPA 1M74A 3DS5A 2KW2A 2M8LA 1QVFO 3Q20A 3LRYA 1EMVA 2K0DX 2Z46A 2BUOA 2K93A 5KP7B 3G1GA 2KGEA 1EOQA 2QA4P 4XRQA 1QVGO 1RNIA 5EJDA 2M5RA 2CNRA 2E1MA 4H2XC 2KOPA 2KOSA 4HKGA 3DS3A 3DS0A 2XZ0D 2FQ0A 2L22A 3VRLC 4COCA 3GKLC 3CCQP 2JYGA 2GZEA 3G28A 4XFYA 1VQMP 2JU1A 4XFZA 2Z44A 3MGEA 2GDXA 3RG6C 2K0XA 4QNBA 2PEQA 2GZJA 2K94A 5KP8B 3GZMA 5F2KA 3CXCO 2OTLP 1K73Q 2LF4A 1K8AQ 1VQNP 2JQ4A 3DPHA 1NQ4A 4IZ6A 2EFJA 1Q81Q 2P9XA 5I4TG 2KOQA 3CC2P 5HVCA 2CWOA 2N98A 2EG5A 2FAEA 5JPAA 2LOLA 2L0QA 2JBGA 2FVEA 2VSQA 1NJIQ 2QEXP 3CCMP 1M6NA 4M0IA 1JJ2O 4NEOA 2FHSC 5DCKA 3CPWO 3EJEA 1M1KQ 1W2BO 1K9MQ 2KODA 1AF8A 2VLQA 1L0HA 1VQKP 2VLNA 2CGQA 2BHVA 3CCLP 2KWLA 3B5IA 2JU2A 1AYIA 1YJWP 3RG2A 2PEMA 2MR8A 1VHNA 1T8KA 2KGCA 2N6YA 3EJBA 2ERHA 2KOOA 2K2QA 4U0CA 1KQSO 2WPTA 3CE7A 2LMLA 4U0DA 5F2OA 2KG8A 2ONTA 1YJ9P 2PY8A 2EHTA 4COPA 1VQPP 1S72P 2OARA 1X3OA 4CA3A 3CCEP 3EJDA 1UNKA 5F2NA 2FADA 3H0DA 1YIJP 3GJNA 3GZLA 4U0EA 2JO0A 3LMOA 4PXHB 5KP6B 4WYMA 1BAJA 1HY8A 2AF8A 1VQ6P 2PEIA 1YI2P 4QKOA
chains in the Genus database with same CATH topology
2FAEA 2KG6A 2ROQA 4BPGA 2LOLA 2L0QA 2L9FA 2K0YA 2FVEA 2VSQA 4H2WC 1KLPA 4MRTC 1HQBA 2LKIA 2KW2A 2LIUA 4NEOA 2FHSC 2CG5B 3EJEA 2K93A 2DNWA 2GDWA 2AFDA 5KP7B 1AF8A 2KGEA 1L0HA 1F80D 2FQ1A 2N5HA 2CGQA 2KWLA 2KGAA 2JU2A 3RG2A 2LPKA 5EJDA 2MR8A 2MR7A 2M5RA 1T8KA 2KGCA 2FVFA 2N6YA 2QNWA 3EJBA 2KOOA 2KR5A 2N6ZA 1L0IA 3NY7B 2CNRA 1DNYA 2K2QA 4H2XC 4PWVB 2FQ2A 2KOPA 2KOSA 4HKGA 2N50A 3CE7A 2LMLA 4BPHA 2AFEA 2MVVA 2XZ0D 2N5IA 2KG8A 2FQ0A 2L22A 2MF4A 2KG9A 2EHTA 2JU1A 2L4BA 4DG9A 2GDXA 5HV8A 2AVAA 1X3OA 2JGPA 4CA3A 2K0XA 2PNGA 2MD9A 3EJDA 2KGDA 5CZDB 2K94A 4H2YC 5KP8B 2CQ8A 3GZMA 2FVAA 4BPFA 2FACA 2LIWA 2FADA 2XZ1C 1OR5A 1ACPA 3GZLA 4R0MA 2MY5A 3LMOA 4PXHB 2JQ4A 5KP6B 2MVUA 2X2BA 1NQ4A 4IZ6A 2EHSA 2GDYA 1DV5A 2KORA 2LTEA 2LL8A 1HY8A 2AF8A 2KOQA 2K92A 5HVCA 1VKUA 2N98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAE A;  2KG6 A;  2ROQ A;  4BPG A;  2LOL A;  2L0Q A;  2L9F A;  2K0Y A;  2FVE A;  2VSQ A;  4H2W C;  1KLP A;  4MRT C;  1HQB A;  2LKI A;  2KW2 A;  2LIU A;  4NEO A;  2FHS C;  2CG5 B;  3EJE A;  2K93 A;  2DNW A;  2GDW A;  2AFD A;  5KP7 B;  1AF8 A;  2KGE A;  1L0H A;  1F80 D;  2FQ1 A;  2N5H A;  2CGQ A;  2KWL A;  2KGA A;  2JU2 A;  3RG2 A;  2LPK A;  5EJD A;  2MR8 A;  2MR7 A;  2M5R A;  1T8K A;  2KGC A;  2FVF A;  2N6Y A;  2QNW A;  3EJB A;  2KOO A;  2KR5 A;  2N6Z A;  1L0I A;  3NY7 B;  2CNR A;  1DNY A;  2K2Q A;  4H2X C;  4PWV B;  2FQ2 A;  2KOP A;  2KOS A;  4HKG A;  2N50 A;  3CE7 A;  2LML A;  4BPH A;  2AFE A;  2MVV A;  2XZ0 D;  2N5I A;  2KG8 A;  2FQ0 A;  2L22 A;  2MF4 A;  2KG9 A;  2EHT A;  2JU1 A;  2L4B A;  4DG9 A;  2GDX A;  5HV8 A;  2AVA A;  1X3O A;  2JGP A;  4CA3 A;  2K0X A;  2PNG A;  2MD9 A;  3EJD A;  2KGD A;  5CZD B;  2K94 A;  4H2Y C;  5KP8 B;  2CQ8 A;  3GZM A;  2FVA A;  4BPF A;  2FAC A;  2LIW A;  2FAD A;  2XZ1 C;  1OR5 A;  1ACP A;  3GZL A;  4R0M A;  2MY5 A;  3LMO A;  4PXH B;  2JQ4 A;  5KP6 B;  2MVU A;  2X2B A;  1NQ4 A;  4IZ6 A;  2EHS A;  2GDY A;  1DV5 A;  2KOR A;  2LTE A;  2LL8 A;  1HY8 A;  2AF8 A;  2KOQ A;  2K92 A;  5HVC A;  1VKU A;  2N98 A; 
#chains in the Genus database with same CATH topology
 2GZG A;  4GR6 A;  3H47 A;  2JYL A;  1VQ8 P;  2ROQ A;  2L9F A;  3I55 P;  1GXG A;  2JB0 A;  5HGN A;  4MRT C;  2LKI A;  2M8N A;  1KD1 Q;  1VQL P;  2CG5 B;  3G4S P;  2GZI A;  1M6E X;  1IUQ A;  1F80 D;  3NTE A;  3G26 A;  1IMQ A;  1FR2 A;  1VQ7 P;  2MR7 A;  2EIA A;  2FVF A;  2PEO A;  4IPY A;  3NY7 B;  2N6Z A;  1L0I A;  3DS1 A;  3G0V A;  2FQ2 A;  7CEI A;  4XRO A;  4U0B A;  3G1I A;  4BPH A;  1ZNV A;  2MVV A;  3CD6 P;  5HV8 A;  3OW2 O;  2OTJ P;  2PEN A;  1UJZ A;  1IMP A;  2MD9 A;  2DGY A;  1MZ8 A;  3M1M A;  2VLO A;  4UHP B;  4BPF A;  2LIW A;  1RO0 A;  1Q86 Q;  5BS1 A;  1OR5 A;  3CCS P;  3U43 A;  1Q7Y Q;  1A8O A;  2GZF A;  3G6E P;  2PEK A;  1VQ5 P;  3DS4 A;  2MVU A;  2X2B A;  4GR2 A;  5HGM A;  3WBH A;  2GDY A;  2LTE A;  2K5X A;  2K92 A;  4U0F A;  1QRJ A;  3H4E A;  3CCU P;  3G71 P;  2XV6 A;  2K0Y A;  2JAZ A;  3DS2 A;  5HGO A;  3HYB A;  5HGL A;  1VQ4 P;  4F37 A;  2M8P A;  1KC8 Q;  3G21 A;  3CC7 P;  1HQB A;  4U0A A;  2LIU A;  3DTJ A;  1YIT P;  2PEJ A;  3CCJ P;  1EIA A;  2DNW A;  2GDW A;  2AFD A;  2XXM A;  2FQ1 A;  3B4Q A;  2N5H A;  2KGA A;  2VLP A;  1E6J P;  2LPK A;  3CCR P;  2GYK A;  5EW5 E;  2QNW A;  2KR5 A;  1K30 A;  4PH1 A;  1DNY A;  1RO2 A;  4PWV B;  1N8R Q;  2N50 A;  1M90 Q;  2AFE A;  3CMA P;  2N5I A;  5BS2 A;  2MF4 A;  4PH0 A;  2KG9 A;  3CC4 P;  2NO8 A;  2L4B A;  4DG9 A;  1YJN P;  2AVA A;  2JGP A;  1D1D A;  2PNG A;  1VQ9 P;  2KGD A;  3HZQ A;  5CZD B;  1BXI A;  4H2Y C;  2CQ8 A;  1GPJ A;  2FVA A;  3E2D A;  2FAC A;  4XFX A;  1YHQ P;  1VQO P;  3G29 A;  2XZ1 C;  3CCV P;  1ACP A;  4R0M A;  2MY5 A;  3I56 P;  1GXH A;  2EHS A;  1DV5 A;  2KOR A;  1ZMB A;  2L6E A;  2LL8 A;  2Z45 A;  3CME P;  2XT1 A;  1VKU A;  1E0H A;  1A43 A;  2KG6 A;  1CEI A;  1AUM A;  4BPG A;  1Q82 Q;  1Z6M A;  4H2W C;  3P05 A;  1KLP A;  1M74 A;  3DS5 A;  2KW2 A;  2M8L A;  1QVF O;  3Q20 A;  3LRY A;  1EMV A;  2K0D X;  2Z46 A;  2BUO A;  2K93 A;  5KP7 B;  3G1G A;  2KGE A;  1EOQ A;  2QA4 P;  4XRQ A;  1QVG O;  1RNI A;  5EJD A;  2M5R A;  2CNR A;  2E1M A;  4H2X C;  2KOP A;  2KOS A;  4HKG A;  3DS3 A;  3DS0 A;  2XZ0 D;  2FQ0 A;  2L22 A;  3VRL C;  4COC A;  3GKL C;  3CCQ P;  2JYG A;  2GZE A;  3G28 A;  4XFY A;  1VQM P;  2JU1 A;  4XFZ A;  2Z44 A;  3MGE A;  2GDX A;  3RG6 C;  2K0X A;  4QNB A;  2PEQ A;  2GZJ A;  2K94 A;  5KP8 B;  3GZM A;  5F2K A;  3CXC O;  2OTL P;  1K73 Q;  2LF4 A;  1K8A Q;  1VQN P;  2JQ4 A;  3DPH A;  1NQ4 A;  4IZ6 A;  2EFJ A;  1Q81 Q;  2P9X A;  5I4T G;  2KOQ A;  3CC2 P;  5HVC A;  2CWO A;  2N98 A;  2EG5 A;  2FAE A;  5JPA A;  2LOL A;  2L0Q A;  2JBG A;  2FVE A;  2VSQ A;  1NJI Q;  2QEX P;  3CCM P;  1M6N A;  4M0I A;  1JJ2 O;  4NEO A;  2FHS C;  5DCK A;  3CPW O;  3EJE A;  1M1K Q;  1W2B O;  1K9M Q;  2KOD A;  1AF8 A;  2VLQ A;  1L0H A;  1VQK P;  2VLN A;  2CGQ A;  2BHV A;  3CCL P;  2KWL A;  3B5I A;  2JU2 A;  1AYI A;  1YJW P;  3RG2 A;  2PEM A;  2MR8 A;  1VHN A;  1T8K A;  2KGC A;  2N6Y A;  3EJB A;  2ERH A;  2KOO A;  2K2Q A;  4U0C A;  1KQS O;  2WPT A;  3CE7 A;  2LML A;  4U0D A;  5F2O A;  2KG8 A;  2ONT A;  1YJ9 P;  2PY8 A;  2EHT A;  4COP A;  1VQP P;  1S72 P;  2OAR A;  1X3O A;  4CA3 A;  3CCE P;  3EJD A;  1UNK A;  5F2N A;  2FAD A;  3H0D A;  1YIJ P;  3GJN A;  3GZL A;  4U0E A;  2JO0 A;  3LMO A;  4PXH B;  5KP6 B;  4WYM A;  1BAJ A;  1HY8 A;  2AF8 A;  1VQ6 P;  2PEI A;  1YI2 P;  4QKO A; 
#chains in the Genus database with same CATH homology
 2FAE A;  2KG6 A;  2ROQ A;  4BPG A;  2LOL A;  2L0Q A;  2L9F A;  2K0Y A;  2FVE A;  2VSQ A;  4H2W C;  1KLP A;  4MRT C;  1HQB A;  2LKI A;  2KW2 A;  2LIU A;  4NEO A;  2FHS C;  2CG5 B;  3EJE A;  2K93 A;  2DNW A;  2GDW A;  2AFD A;  5KP7 B;  1AF8 A;  2KGE A;  1L0H A;  1F80 D;  2FQ1 A;  2N5H A;  2CGQ A;  2KWL A;  2KGA A;  2JU2 A;  3RG2 A;  2LPK A;  5EJD A;  2MR8 A;  2MR7 A;  2M5R A;  1T8K A;  2KGC A;  2FVF A;  2N6Y A;  2QNW A;  3EJB A;  2KOO A;  2KR5 A;  2N6Z A;  1L0I A;  3NY7 B;  2CNR A;  1DNY A;  2K2Q A;  4H2X C;  4PWV B;  2FQ2 A;  2KOP A;  2KOS A;  4HKG A;  2N50 A;  3CE7 A;  2LML A;  4BPH A;  2AFE A;  2MVV A;  2XZ0 D;  2N5I A;  2KG8 A;  2FQ0 A;  2L22 A;  2MF4 A;  2KG9 A;  2EHT A;  2JU1 A;  2L4B A;  4DG9 A;  2GDX A;  5HV8 A;  2AVA A;  1X3O A;  2JGP A;  4CA3 A;  2K0X A;  2PNG A;  2MD9 A;  3EJD A;  2KGD A;  5CZD B;  2K94 A;  4H2Y C;  5KP8 B;  2CQ8 A;  3GZM A;  2FVA A;  4BPF A;  2FAC A;  2LIW A;  2FAD A;  2XZ1 C;  1OR5 A;  1ACP A;  3GZL A;  4R0M A;  2MY5 A;  3LMO A;  4PXH B;  2JQ4 A;  5KP6 B;  2MVU A;  2X2B A;  1NQ4 A;  4IZ6 A;  2EHS A;  2GDY A;  1DV5 A;  2KOR A;  2LTE A;  2LL8 A;  1HY8 A;  2AF8 A;  2KOQ A;  2K92 A;  5HVC A;  1VKU A;  2N98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...