5CZDB

The complex structure of vink with vinl
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
MWDAQFENLLRRYLPFLSADQPLEQDINLRDIGLDSLGTVELLSELENTYDVHFQDEALTKETFETPGVLWKTLSQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based analysis of the molecular interactions between acyltransferase and acyl carrier protein in vicenistatin biosynthesis.
pubmed doi rcsb
source organism Streptomyces halstedii
molecule tags Transferase
molecule keywords Malonyl-CoA-[acyl-carrier-protein] transacylase
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5czdB00
2MY5A 2EHTA 2N5IA 4PXHB 3EJBA 2L9FA 2LIUA 4MRTC 1L0IA 2KW2A 3CE7A 2FVEA 2KG8A 5CZDB 2JGPA 4H2WC 1VKUA 2LL8A 4R0MA 1AF8A 2VSQA 1F80D 2EHSA 1DV5A 2FVFA 4BPFA 3EJEA 2KOQA 1KLPA 2KOSA 1DNYA 2K0XA 1NQ4A 4H2XC 2LOLA 1HY8A 4BPGA 2KOPA 2AFDA 2GDXA 2FVAA 5HVCA 2JU1A 2LMLA 4NEOA 5EJDA 4H2YC 4IZ6A 4HKGA 1ACPA 5KP8B 2GDYA 2AFEA 2L22A 2K0YA 2ROQA 2FADA 2KGDA 2JU2A 2L0QA 2X2BA 2PNGA 2MD9A 2FACA 2MF4A 2FAEA 2KG6A 2KG9A 2KGAA 2FQ0A 2GDWA 2QNWA 2LPKA 3RG2A 2M5RA 2KGCA 5KP6B 4BPHA 2AF8A 2MR7A 2KR5A 4PWVB 2XZ0D 1X3OA 2K93A 1L0HA 2N98A 4DG9A 2N5HA 3EJDA 2KGEA 2CG5B 3LMOA 2K94A 1T8KA 2JQ4A 2L4BA 3GZLA 1HQBA 2CGQA 5HV8A 2LIWA 2KWLA 2N6ZA 2DNWA 2MR8A 2LTEA 2LKIA 1OR5A 2XZ1C 2MVVA 2KORA 2MVUA 4CA3A 3NY7B 2K2QA 2CQ8A 2N6YA 2KOOA 2FHSC 2FQ2A 5KP7B 2CNRA 2FQ1A 3GZMA 2N50A 2K92A 2AVAA
chains in the Genus database with same CATH superfamily
2GZJA 2JAZA 2Z46A 5F2OA 2GZEA 1N8RQ 1L0IA 3CE7A 3G29A 2EG5A 2JGPA 4H2WC 4R0MA 3M1MA 4BPFA 2OTLP 4U0DA 1KLPA 1YJWP 2KOSA 1E6JP 4H2XC 4XRQA 1HY8A 2PEMA 1FR2A 2GDXA 3G21A 1YI2P 2XV6A 2BUOA 4H2YC 1YJ9P 3WBHA 3H4EA 2FADA 1S72P 3G4SP 1QVFO 2MD9A 2K5XA 2KG9A 5DCKA 1NJIQ 2CWOA 4QNBA 4BPHA 1IUQA 3CPWO 2PEIA 2KR5A 1EIAA 3Q20A 3CCVP 1VQLP 1X3OA 2E1MA 2K93A 3DS1A 2N98A 1EMVA 4F37A 1K8AQ 2CG5B 4WYMA 3LMOA 2JQ4A 2CGQA 2LIWA 5BS1A 1AYIA 2MR8A 3G0VA 2XZ1C 4U0BA 2MVVA 3DS5A 2MVUA 3CMEP 4XFXA 2K2QA 1Q81Q 2P9XA 3I56P 2OARA 4M0IA 2QA4P 2CNRA 2K92A 1VQPP 5HGOA 4XFYA 4PXHB 2KW2A 1KQSO 1K73Q 2FVEA 2KG8A 1VKUA 2KODA 1YIJP 2QEXP 2EHSA 1DNYA 1NQ4A 1ZMBA 2JO0A 5EW5E 1K9MQ 1GPJA 1GXGA 2GYKA 1UNKA 2OTJP 2GDYA 2JYLA 5F2NA 2L22A 2K0YA 1BXIA 1M74A 1D1DA 2L0QA 2PNGA 3NTEA 2FACA 2KG6A 1VQ7P 2KGAA 5JPAA 1A8OA 2PEOA 2LPKA 3DS0A 3RG2A 2M5RA 3CMAP 3I55P 2AF8A 1QRJA 5F2KA 3LRYA 2BHVA 2ERHA 2LF4A 4U0EA 2Z44A 1Q7YQ 1KC8Q 1M90Q 2JYGA 1HQBA 4COPA 2PEQA 2KWLA 2JBGA 2DNWA 2LTEA 3CCQP 3CCUP 2EIAA 2Z45A 2GZIA 2K0DX 3CC4P 1VQ5P 3DS4A 3GZMA 2N50A 1E0HA 1VQOP 1UJZA 2M8PA 4U0CA 3DPHA 3CCMP 2N5IA 2LIUA 4MRTC 4GR2A 1BAJA 3GKLC 1VQKP 1AF8A 2VSQA 1F80D 3G1GA 3G6EP 3DS3A 2FVFA 7CEIA 2KOQA 3G28A 2K0XA 2PY8A 3CCJP 4BPGA 2AFDA 5HVCA 3B4QA 2JU1A 4NEOA 4U0AA 4HKGA 1ACPA 5KP8B 3OW2O 1VQMP 2ROQA 4PH1A 3CCLP 5HGLA 1M6EX 2X2BA 1W2BO 3E2DA 2FQ0A 2QNWA 4COCA 1VQ8P 2L6EA 3CCRP 3B5IA 2DGYA 1JJ2O 2MR7A 2VLNA 1YHQP 1VQNP 1IMPA 4PWVB 3GJNA 2XZ0D 1EOQA 3U43A 4DG9A 3EJDA 2KGEA 3HYBA 1KD1Q 4XFZA 2PEKA 5HGNA 1M1KQ 4UHPB 3MGEA 2XXMA 1RO2A 4CA3A 1VHNA 4QKOA 1VQ4P 2M8LA 2EFJA 2N6YA 4IPYA 5BS2A 2KOOA 1A43A 1VQ6P 2FHSC 2FQ2A 2FQ1A 2MY5A 2EHTA 2GZFA 4XROA 1GXHA 3EJBA 2L9FA 1M6NA 2ONTA 5I4TG 2PEJA 1ZNVA 4U0FA 5CZDB 2LL8A 2PENA 1Z6MA 4PH0A 1DV5A 3EJEA 2VLQA 2LOLA 3CC7P 5HGMA 2KOPA 1Q82Q 2FVAA 2LMLA 5EJDA 4IZ6A 2WPTA 1MZ8A 2VLOA 1RO0A 2AFEA 3CCEP 1IMQA 2VLPA 1VQ9P 2KGDA 2JU2A 2GZGA 2MF4A 2FAEA 2AVAA 3CC2P 2GDWA 4GR6A 1YJNP 2JB0A 1Q86Q 3H0DA 2KGCA 5KP6B 1AUMA 3G26A 1K30A 3CXCO 3G1IA 1L0HA 3RG6C 2N5HA 3DS2A 2K94A 1T8KA 3DTJA 3CCSP 1YITP 2L4BA 2XT1A 3GZLA 5HV8A 2M8NA 2N6ZA 2LKIA 1OR5A 3H47A 2KORA 3CD6P 2NO8A 3NY7B 3HZQA 1CEIA 2CQ8A 3G71P 3VRLC 3P05A 1QVGO 5KP7B 1RNIA
chains in the Genus database with same CATH topology
2MY5A 2EHTA 2N5IA 4PXHB 3EJBA 2L9FA 2LIUA 4MRTC 1L0IA 2KW2A 3CE7A 2FVEA 2KG8A 5CZDB 2JGPA 4H2WC 1VKUA 2LL8A 4R0MA 1AF8A 2VSQA 1F80D 2EHSA 1DV5A 2FVFA 4BPFA 3EJEA 2KOQA 1KLPA 2KOSA 1DNYA 2K0XA 1NQ4A 4H2XC 2LOLA 1HY8A 4BPGA 2KOPA 2AFDA 2GDXA 2FVAA 5HVCA 2JU1A 2LMLA 4NEOA 5EJDA 4H2YC 4IZ6A 4HKGA 1ACPA 5KP8B 2GDYA 2AFEA 2L22A 2K0YA 2ROQA 2FADA 2KGDA 2JU2A 2L0QA 2X2BA 2PNGA 2MD9A 2FACA 2MF4A 2FAEA 2KG6A 2KG9A 2KGAA 2FQ0A 2GDWA 2QNWA 2LPKA 3RG2A 2M5RA 2KGCA 5KP6B 4BPHA 2AF8A 2MR7A 2KR5A 4PWVB 2XZ0D 1X3OA 2K93A 1L0HA 2N98A 4DG9A 2N5HA 3EJDA 2KGEA 2CG5B 3LMOA 2K94A 1T8KA 2JQ4A 2L4BA 3GZLA 1HQBA 2CGQA 5HV8A 2LIWA 2KWLA 2N6ZA 2DNWA 2MR8A 2LTEA 2LKIA 1OR5A 2XZ1C 2MVVA 2KORA 2MVUA 4CA3A 3NY7B 2K2QA 2CQ8A 2N6YA 2KOOA 2FHSC 2FQ2A 5KP7B 2CNRA 2FQ1A 3GZMA 2N50A 2K92A 2AVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MY5 A;  2EHT A;  2N5I A;  4PXH B;  3EJB A;  2L9F A;  2LIU A;  4MRT C;  1L0I A;  2KW2 A;  3CE7 A;  2FVE A;  2KG8 A;  5CZD B;  2JGP A;  4H2W C;  1VKU A;  2LL8 A;  4R0M A;  1AF8 A;  2VSQ A;  1F80 D;  2EHS A;  1DV5 A;  2FVF A;  4BPF A;  3EJE A;  2KOQ A;  1KLP A;  2KOS A;  1DNY A;  2K0X A;  1NQ4 A;  4H2X C;  2LOL A;  1HY8 A;  4BPG A;  2KOP A;  2AFD A;  2GDX A;  2FVA A;  5HVC A;  2JU1 A;  2LML A;  4NEO A;  5EJD A;  4H2Y C;  4IZ6 A;  4HKG A;  1ACP A;  5KP8 B;  2GDY A;  2AFE A;  2L22 A;  2K0Y A;  2ROQ A;  2FAD A;  2KGD A;  2JU2 A;  2L0Q A;  2X2B A;  2PNG A;  2MD9 A;  2FAC A;  2MF4 A;  2FAE A;  2KG6 A;  2KG9 A;  2KGA A;  2FQ0 A;  2GDW A;  2QNW A;  2LPK A;  3RG2 A;  2M5R A;  2KGC A;  5KP6 B;  4BPH A;  2AF8 A;  2MR7 A;  2KR5 A;  4PWV B;  2XZ0 D;  1X3O A;  2K93 A;  1L0H A;  2N98 A;  4DG9 A;  2N5H A;  3EJD A;  2KGE A;  2CG5 B;  3LMO A;  2K94 A;  1T8K A;  2JQ4 A;  2L4B A;  3GZL A;  1HQB A;  2CGQ A;  5HV8 A;  2LIW A;  2KWL A;  2N6Z A;  2DNW A;  2MR8 A;  2LTE A;  2LKI A;  1OR5 A;  2XZ1 C;  2MVV A;  2KOR A;  2MVU A;  4CA3 A;  3NY7 B;  2K2Q A;  2CQ8 A;  2N6Y A;  2KOO A;  2FHS C;  2FQ2 A;  5KP7 B;  2CNR A;  2FQ1 A;  3GZM A;  2N50 A;  2K92 A;  2AVA A; 
#chains in the Genus database with same CATH topology
 2GZJ A;  2JAZ A;  2Z46 A;  5F2O A;  2GZE A;  1N8R Q;  1L0I A;  3CE7 A;  3G29 A;  2EG5 A;  2JGP A;  4H2W C;  4R0M A;  3M1M A;  4BPF A;  2OTL P;  4U0D A;  1KLP A;  1YJW P;  2KOS A;  1E6J P;  4H2X C;  4XRQ A;  1HY8 A;  2PEM A;  1FR2 A;  2GDX A;  3G21 A;  1YI2 P;  2XV6 A;  2BUO A;  4H2Y C;  1YJ9 P;  3WBH A;  3H4E A;  2FAD A;  1S72 P;  3G4S P;  1QVF O;  2MD9 A;  2K5X A;  2KG9 A;  5DCK A;  1NJI Q;  2CWO A;  4QNB A;  4BPH A;  1IUQ A;  3CPW O;  2PEI A;  2KR5 A;  1EIA A;  3Q20 A;  3CCV P;  1VQL P;  1X3O A;  2E1M A;  2K93 A;  3DS1 A;  2N98 A;  1EMV A;  4F37 A;  1K8A Q;  2CG5 B;  4WYM A;  3LMO A;  2JQ4 A;  2CGQ A;  2LIW A;  5BS1 A;  1AYI A;  2MR8 A;  3G0V A;  2XZ1 C;  4U0B A;  2MVV A;  3DS5 A;  2MVU A;  3CME P;  4XFX A;  2K2Q A;  1Q81 Q;  2P9X A;  3I56 P;  2OAR A;  4M0I A;  2QA4 P;  2CNR A;  2K92 A;  1VQP P;  5HGO A;  4XFY A;  4PXH B;  2KW2 A;  1KQS O;  1K73 Q;  2FVE A;  2KG8 A;  1VKU A;  2KOD A;  1YIJ P;  2QEX P;  2EHS A;  1DNY A;  1NQ4 A;  1ZMB A;  2JO0 A;  5EW5 E;  1K9M Q;  1GPJ A;  1GXG A;  2GYK A;  1UNK A;  2OTJ P;  2GDY A;  2JYL A;  5F2N A;  2L22 A;  2K0Y A;  1BXI A;  1M74 A;  1D1D A;  2L0Q A;  2PNG A;  3NTE A;  2FAC A;  2KG6 A;  1VQ7 P;  2KGA A;  5JPA A;  1A8O A;  2PEO A;  2LPK A;  3DS0 A;  3RG2 A;  2M5R A;  3CMA P;  3I55 P;  2AF8 A;  1QRJ A;  5F2K A;  3LRY A;  2BHV A;  2ERH A;  2LF4 A;  4U0E A;  2Z44 A;  1Q7Y Q;  1KC8 Q;  1M90 Q;  2JYG A;  1HQB A;  4COP A;  2PEQ A;  2KWL A;  2JBG A;  2DNW A;  2LTE A;  3CCQ P;  3CCU P;  2EIA A;  2Z45 A;  2GZI A;  2K0D X;  3CC4 P;  1VQ5 P;  3DS4 A;  3GZM A;  2N50 A;  1E0H A;  1VQO P;  1UJZ A;  2M8P A;  4U0C A;  3DPH A;  3CCM P;  2N5I A;  2LIU A;  4MRT C;  4GR2 A;  1BAJ A;  3GKL C;  1VQK P;  1AF8 A;  2VSQ A;  1F80 D;  3G1G A;  3G6E P;  3DS3 A;  2FVF A;  7CEI A;  2KOQ A;  3G28 A;  2K0X A;  2PY8 A;  3CCJ P;  4BPG A;  2AFD A;  5HVC A;  3B4Q A;  2JU1 A;  4NEO A;  4U0A A;  4HKG A;  1ACP A;  5KP8 B;  3OW2 O;  1VQM P;  2ROQ A;  4PH1 A;  3CCL P;  5HGL A;  1M6E X;  2X2B A;  1W2B O;  3E2D A;  2FQ0 A;  2QNW A;  4COC A;  1VQ8 P;  2L6E A;  3CCR P;  3B5I A;  2DGY A;  1JJ2 O;  2MR7 A;  2VLN A;  1YHQ P;  1VQN P;  1IMP A;  4PWV B;  3GJN A;  2XZ0 D;  1EOQ A;  3U43 A;  4DG9 A;  3EJD A;  2KGE A;  3HYB A;  1KD1 Q;  4XFZ A;  2PEK A;  5HGN A;  1M1K Q;  4UHP B;  3MGE A;  2XXM A;  1RO2 A;  4CA3 A;  1VHN A;  4QKO A;  1VQ4 P;  2M8L A;  2EFJ A;  2N6Y A;  4IPY A;  5BS2 A;  2KOO A;  1A43 A;  1VQ6 P;  2FHS C;  2FQ2 A;  2FQ1 A;  2MY5 A;  2EHT A;  2GZF A;  4XRO A;  1GXH A;  3EJB A;  2L9F A;  1M6N A;  2ONT A;  5I4T G;  2PEJ A;  1ZNV A;  4U0F A;  5CZD B;  2LL8 A;  2PEN A;  1Z6M A;  4PH0 A;  1DV5 A;  3EJE A;  2VLQ A;  2LOL A;  3CC7 P;  5HGM A;  2KOP A;  1Q82 Q;  2FVA A;  2LML A;  5EJD A;  4IZ6 A;  2WPT A;  1MZ8 A;  2VLO A;  1RO0 A;  2AFE A;  3CCE P;  1IMQ A;  2VLP A;  1VQ9 P;  2KGD A;  2JU2 A;  2GZG A;  2MF4 A;  2FAE A;  2AVA A;  3CC2 P;  2GDW A;  4GR6 A;  1YJN P;  2JB0 A;  1Q86 Q;  3H0D A;  2KGC A;  5KP6 B;  1AUM A;  3G26 A;  1K30 A;  3CXC O;  3G1I A;  1L0H A;  3RG6 C;  2N5H A;  3DS2 A;  2K94 A;  1T8K A;  3DTJ A;  3CCS P;  1YIT P;  2L4B A;  2XT1 A;  3GZL A;  5HV8 A;  2M8N A;  2N6Z A;  2LKI A;  1OR5 A;  3H47 A;  2KOR A;  3CD6 P;  2NO8 A;  3NY7 B;  3HZQ A;  1CEI A;  2CQ8 A;  3G71 P;  3VRL C;  3P05 A;  1QVG O;  5KP7 B;  1RNI A; 
#chains in the Genus database with same CATH homology
 2MY5 A;  2EHT A;  2N5I A;  4PXH B;  3EJB A;  2L9F A;  2LIU A;  4MRT C;  1L0I A;  2KW2 A;  3CE7 A;  2FVE A;  2KG8 A;  5CZD B;  2JGP A;  4H2W C;  1VKU A;  2LL8 A;  4R0M A;  1AF8 A;  2VSQ A;  1F80 D;  2EHS A;  1DV5 A;  2FVF A;  4BPF A;  3EJE A;  2KOQ A;  1KLP A;  2KOS A;  1DNY A;  2K0X A;  1NQ4 A;  4H2X C;  2LOL A;  1HY8 A;  4BPG A;  2KOP A;  2AFD A;  2GDX A;  2FVA A;  5HVC A;  2JU1 A;  2LML A;  4NEO A;  5EJD A;  4H2Y C;  4IZ6 A;  4HKG A;  1ACP A;  5KP8 B;  2GDY A;  2AFE A;  2L22 A;  2K0Y A;  2ROQ A;  2FAD A;  2KGD A;  2JU2 A;  2L0Q A;  2X2B A;  2PNG A;  2MD9 A;  2FAC A;  2MF4 A;  2FAE A;  2KG6 A;  2KG9 A;  2KGA A;  2FQ0 A;  2GDW A;  2QNW A;  2LPK A;  3RG2 A;  2M5R A;  2KGC A;  5KP6 B;  4BPH A;  2AF8 A;  2MR7 A;  2KR5 A;  4PWV B;  2XZ0 D;  1X3O A;  2K93 A;  1L0H A;  2N98 A;  4DG9 A;  2N5H A;  3EJD A;  2KGE A;  2CG5 B;  3LMO A;  2K94 A;  1T8K A;  2JQ4 A;  2L4B A;  3GZL A;  1HQB A;  2CGQ A;  5HV8 A;  2LIW A;  2KWL A;  2N6Z A;  2DNW A;  2MR8 A;  2LTE A;  2LKI A;  1OR5 A;  2XZ1 C;  2MVV A;  2KOR A;  2MVU A;  4CA3 A;  3NY7 B;  2K2Q A;  2CQ8 A;  2N6Y A;  2KOO A;  2FHS C;  2FQ2 A;  5KP7 B;  2CNR A;  2FQ1 A;  3GZM A;  2N50 A;  2K92 A;  2AVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...