5CZDB

The complex structure of vink with vinl
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
MWDAQFENLLRRYLPFLSADQPLEQDINLRDIGLDSLGTVELLSELENTYDVHFQDEALTKETFETPGVLWKTLSQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based analysis of the molecular interactions between acyltransferase and acyl carrier protein in vicenistatin biosynthesis.
pubmed doi rcsb
source organism Streptomyces halstedii
molecule tags Transferase
molecule keywords Malonyl-CoA-[acyl-carrier-protein] transacylase
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5czdB00
2L0QA 1L0IA 2FACA 3NY7B 4HKGA 2CNRA 2LIWA 2QNWA 2FVEA 3CE7A 4H2WC 2AFEA 2K0YA 5EJDA 2LIUA 2N98A 2VSQA 2EHSA 4DG9A 2K92A 2KORA 2K0XA 2CG5B 3RG2A 4H2YC 2LKIA 2JQ4A 2KG8A 2L4BA 2MVUA 2X2BA 1VKUA 1L0HA 3EJDA 4MRTC 2KWLA 2ROQA 2JU2A 2KOOA 2KW2A 2AFDA 2AF8A 2CQ8A 2FVAA 1KLPA 1X3OA 2LL8A 1AF8A 2AVAA 2JGPA 2LTEA 2KG9A 2PNGA 2L9FA 1F80D 1T8KA 5HVCA 2GDYA 2CGQA 1OR5A 2KOQA 2N5IA 2N6ZA 2JU1A 3GZMA 5KP7B 4R0MA 2MY5A 2XZ1C 2KOSA 2XZ0D 4BPHA 3LMOA 4BPGA 2GDXA 2K94A 2FADA 2LPKA 2KGCA 2FQ2A 2K2QA 4H2XC 2KGEA 1HQBA 2FQ1A 1HY8A 2N5HA 2N6YA 3GZLA 5KP6B 2KR5A 2MR8A 4PWVB 2MF4A 2MD9A 2N50A 2DNWA 1ACPA 2FQ0A 2MR7A 3EJBA 2FAEA 1NQ4A 5CZDB 2FVFA 2K93A 4IZ6A 2L22A 2GDWA 2M5RA 2LMLA 5KP8B 4CA3A 4BPFA 2MVVA 2KG6A 2KOPA 4NEOA 3EJEA 2EHTA 2FHSC 5HV8A 2LOLA 2KGAA 1DNYA 2KGDA 4PXHB 1DV5A
chains in the Genus database with same CATH superfamily
3HZQA 2PEQA 3G26A 2GZEA 1K30A 3CE7A 2K0YA 2Z46A 2VSQA 2CG5B 2KODA 3DS3A 1D1DA 2MVUA 1AYIA 3EJDA 3G28A 3CCEP 1E6JP 2AF8A 5HGMA 1X3OA 1VQPP 4XROA 2AVAA 1EMVA 1NJIQ 1GXHA 2KOQA 5KP7B 2MY5A 2E1MA 2XZ1C 3G6EP 1YJWP 5HGOA 3CCVP 1RO2A 4BPGA 2FADA 1JJ2O 2KGCA 2K2QA 5I4TG 4U0AA 5F2NA 2N5HA 4U0FA 5F2OA 5KP6B 2QA4P 2JO0A 4QKOA 2DGYA 2OTJP 2MR7A 1ZMBA 3CD6P 2CWOA 1UNKA 1GPJA 3CXCO 5KP8B 3DS4A 4BPFA 2VLPA 1M6NA 4NEOA 4IPYA 5HV8A 2LOLA 1K73Q 3NTEA 2M8PA 4PXHB 1DV5A 3CC2P 1L0IA 2FACA 3NY7B 1KD1Q 3I55P 2FVEA 1AUMA 2PEIA 1VHNA 2XXMA 2AFEA 3H4EA 2EFJA 2N98A 2OTLP 2KORA 2KG8A 1M74A 3OW2O 1YITP 1VQ5P 2M8NA 1M90Q 2ROQA 2ERHA 2JU2A 2KOOA 2KW2A 3WBHA 1M6EX 3G21A 1KLPA 1RNIA 2LTEA 2GYKA 2PNGA 5HVCA 1F80D 3G71P 3DS5A 2N5IA 2N6ZA 5JPAA 1IMQA 4U0DA 1KQSO 4BPHA 3LMOA 1VQKP 3H0DA 2FQ2A 1VQ8P 4WYMA 3CCUP 3CC7P 2EG5A 2PEMA 3H47A 1Z6MA 4PH1A 1VQ4P 2N50A 2JB0A 1ACPA 2FQ0A 3CCLP 3GKLC 3CPWO 4GR6A 2JAZA 3EJBA 3DS2A 2FAEA 1Q86Q 2K0DX 2P9XA 2XT1A 3HYBA 2FVFA 2QEXP 1VQ9P 2JYLA 1UJZA 2M5RA 2PENA 3G4SP 3CCRP 3M1MA 1GXGA 1IUQA 2KOPA 5F2KA 3EJEA 2FHSC 2KGAA 5BS1A 3CMEP 1W2BO 2PEOA 3B5IA 2ONTA 4HKGA 3U43A 2CNRA 2LIWA 4H2WC 1EOQA 2BUOA 5EJDA 2LIUA 2GZFA 3DS1A 1Q81Q 2EHSA 3CC4P 4H2YC 2JQ4A 1A43A 2VLOA 3CMAP 2L4BA 3GJNA 2PEJA 2X2BA 1VKUA 3E2DA 4MRTC 2KWLA 5EW5E 1K8AQ 3DPHA 2CQ8A 2K5XA 2LL8A 1CEIA 3B4QA 2L6EA 1VQOP 1KC8Q 2L9FA 3CCJP 1M1KQ 2GDYA 2CGQA 1N8RQ 2VLNA 1ZNVA 5DCKA 3LRYA 1QRJA 3Q20A 4U0BA 2K94A 2LPKA 4H2XC 1HQBA 1E0HA 1HY8A 2N6YA 5HGLA 1MZ8A 1QVGO 3G1GA 2GZJA 3G29A 1VQ7P 3VRLC 1S72P 1VQNP 1NQ4A 2K93A 4IZ6A 2L22A 2GDWA 3RG6C 2XV6A 3CCMP 1IMPA 1VQMP 4CA3A 4COCA 2WPTA 2MVVA 3G0VA 4XRQA 2EHTA 7CEIA 3CCSP 4QNBA 5BS2A 1FR2A 1DNYA 2KGDA 1RO0A 2L0QA 3DTJA 4XFYA 4U0CA 2EIAA 1VQLP 2QNWA 4XFZA 4DG9A 2PEKA 2K92A 2K0XA 3RG2A 2NO8A 2LKIA 3I56P 1L0HA 3CCQP 4COPA 2AFDA 2FVAA 5HGNA 3DS0A 1AF8A 3MGEA 2JGPA 2KG9A 1T8KA 1YHQP 1OR5A 1QVFO 4M0IA 2JU1A 3GZMA 2LF4A 4R0MA 1EIAA 1YIJP 2VLQA 1YJNP 2KOSA 1BXIA 2XZ0D 2GDXA 2JBGA 2GZIA 2JYGA 1Q82Q 2KGEA 2M8LA 4U0EA 2FQ1A 1A8OA 1BAJA 3GZLA 2KR5A 2MR8A 2BHVA 4PWVB 2MF4A 2MD9A 2DNWA 1YJ9P 4GR2A 2OARA 1VQ6P 5CZDB 4UHPB 2Z45A 3P05A 4F37A 4XFXA 2LMLA 1YI2P 1Q7YQ 2KG6A 2Z44A 3G1IA 1K9MQ 4PH0A 2PY8A 2GZGA
chains in the Genus database with same CATH topology
2L0QA 1L0IA 2FACA 3NY7B 4HKGA 2CNRA 2LIWA 2QNWA 2FVEA 3CE7A 4H2WC 2AFEA 2K0YA 5EJDA 2LIUA 2N98A 2VSQA 2EHSA 4DG9A 2K92A 2KORA 2K0XA 2CG5B 3RG2A 4H2YC 2LKIA 2JQ4A 2KG8A 2L4BA 2MVUA 2X2BA 1VKUA 1L0HA 3EJDA 4MRTC 2KWLA 2ROQA 2JU2A 2KOOA 2KW2A 2AFDA 2AF8A 2CQ8A 2FVAA 1KLPA 1X3OA 2LL8A 1AF8A 2AVAA 2JGPA 2LTEA 2KG9A 2PNGA 2L9FA 1F80D 1T8KA 5HVCA 2GDYA 2CGQA 1OR5A 2KOQA 2N5IA 2N6ZA 2JU1A 3GZMA 5KP7B 4R0MA 2MY5A 2XZ1C 2KOSA 2XZ0D 4BPHA 3LMOA 4BPGA 2GDXA 2K94A 2FADA 2LPKA 2KGCA 2FQ2A 2K2QA 4H2XC 2KGEA 1HQBA 2FQ1A 1HY8A 2N5HA 2N6YA 3GZLA 5KP6B 2KR5A 2MR8A 4PWVB 2MF4A 2MD9A 2N50A 2DNWA 1ACPA 2FQ0A 2MR7A 3EJBA 2FAEA 1NQ4A 5CZDB 2FVFA 2K93A 4IZ6A 2L22A 2GDWA 2M5RA 2LMLA 5KP8B 4CA3A 4BPFA 2MVVA 2KG6A 2KOPA 4NEOA 3EJEA 2EHTA 2FHSC 5HV8A 2LOLA 2KGAA 1DNYA 2KGDA 4PXHB 1DV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0Q A;  1L0I A;  2FAC A;  3NY7 B;  4HKG A;  2CNR A;  2LIW A;  2QNW A;  2FVE A;  3CE7 A;  4H2W C;  2AFE A;  2K0Y A;  5EJD A;  2LIU A;  2N98 A;  2VSQ A;  2EHS A;  4DG9 A;  2K92 A;  2KOR A;  2K0X A;  2CG5 B;  3RG2 A;  4H2Y C;  2LKI A;  2JQ4 A;  2KG8 A;  2L4B A;  2MVU A;  2X2B A;  1VKU A;  1L0H A;  3EJD A;  4MRT C;  2KWL A;  2ROQ A;  2JU2 A;  2KOO A;  2KW2 A;  2AFD A;  2AF8 A;  2CQ8 A;  2FVA A;  1KLP A;  1X3O A;  2LL8 A;  1AF8 A;  2AVA A;  2JGP A;  2LTE A;  2KG9 A;  2PNG A;  2L9F A;  1F80 D;  1T8K A;  5HVC A;  2GDY A;  2CGQ A;  1OR5 A;  2KOQ A;  2N5I A;  2N6Z A;  2JU1 A;  3GZM A;  5KP7 B;  4R0M A;  2MY5 A;  2XZ1 C;  2KOS A;  2XZ0 D;  4BPH A;  3LMO A;  4BPG A;  2GDX A;  2K94 A;  2FAD A;  2LPK A;  2KGC A;  2FQ2 A;  2K2Q A;  4H2X C;  2KGE A;  1HQB A;  2FQ1 A;  1HY8 A;  2N5H A;  2N6Y A;  3GZL A;  5KP6 B;  2KR5 A;  2MR8 A;  4PWV B;  2MF4 A;  2MD9 A;  2N50 A;  2DNW A;  1ACP A;  2FQ0 A;  2MR7 A;  3EJB A;  2FAE A;  1NQ4 A;  5CZD B;  2FVF A;  2K93 A;  4IZ6 A;  2L22 A;  2GDW A;  2M5R A;  2LML A;  5KP8 B;  4CA3 A;  4BPF A;  2MVV A;  2KG6 A;  2KOP A;  4NEO A;  3EJE A;  2EHT A;  2FHS C;  5HV8 A;  2LOL A;  2KGA A;  1DNY A;  2KGD A;  4PXH B;  1DV5 A; 
#chains in the Genus database with same CATH topology
 3HZQ A;  2PEQ A;  3G26 A;  2GZE A;  1K30 A;  3CE7 A;  2K0Y A;  2Z46 A;  2VSQ A;  2CG5 B;  2KOD A;  3DS3 A;  1D1D A;  2MVU A;  1AYI A;  3EJD A;  3G28 A;  3CCE P;  1E6J P;  2AF8 A;  5HGM A;  1X3O A;  1VQP P;  4XRO A;  2AVA A;  1EMV A;  1NJI Q;  1GXH A;  2KOQ A;  5KP7 B;  2MY5 A;  2E1M A;  2XZ1 C;  3G6E P;  1YJW P;  5HGO A;  3CCV P;  1RO2 A;  4BPG A;  2FAD A;  1JJ2 O;  2KGC A;  2K2Q A;  5I4T G;  4U0A A;  5F2N A;  2N5H A;  4U0F A;  5F2O A;  5KP6 B;  2QA4 P;  2JO0 A;  4QKO A;  2DGY A;  2OTJ P;  2MR7 A;  1ZMB A;  3CD6 P;  2CWO A;  1UNK A;  1GPJ A;  3CXC O;  5KP8 B;  3DS4 A;  4BPF A;  2VLP A;  1M6N A;  4NEO A;  4IPY A;  5HV8 A;  2LOL A;  1K73 Q;  3NTE A;  2M8P A;  4PXH B;  1DV5 A;  3CC2 P;  1L0I A;  2FAC A;  3NY7 B;  1KD1 Q;  3I55 P;  2FVE A;  1AUM A;  2PEI A;  1VHN A;  2XXM A;  2AFE A;  3H4E A;  2EFJ A;  2N98 A;  2OTL P;  2KOR A;  2KG8 A;  1M74 A;  3OW2 O;  1YIT P;  1VQ5 P;  2M8N A;  1M90 Q;  2ROQ A;  2ERH A;  2JU2 A;  2KOO A;  2KW2 A;  3WBH A;  1M6E X;  3G21 A;  1KLP A;  1RNI A;  2LTE A;  2GYK A;  2PNG A;  5HVC A;  1F80 D;  3G71 P;  3DS5 A;  2N5I A;  2N6Z A;  5JPA A;  1IMQ A;  4U0D A;  1KQS O;  4BPH A;  3LMO A;  1VQK P;  3H0D A;  2FQ2 A;  1VQ8 P;  4WYM A;  3CCU P;  3CC7 P;  2EG5 A;  2PEM A;  3H47 A;  1Z6M A;  4PH1 A;  1VQ4 P;  2N50 A;  2JB0 A;  1ACP A;  2FQ0 A;  3CCL P;  3GKL C;  3CPW O;  4GR6 A;  2JAZ A;  3EJB A;  3DS2 A;  2FAE A;  1Q86 Q;  2K0D X;  2P9X A;  2XT1 A;  3HYB A;  2FVF A;  2QEX P;  1VQ9 P;  2JYL A;  1UJZ A;  2M5R A;  2PEN A;  3G4S P;  3CCR P;  3M1M A;  1GXG A;  1IUQ A;  2KOP A;  5F2K A;  3EJE A;  2FHS C;  2KGA A;  5BS1 A;  3CME P;  1W2B O;  2PEO A;  3B5I A;  2ONT A;  4HKG A;  3U43 A;  2CNR A;  2LIW A;  4H2W C;  1EOQ A;  2BUO A;  5EJD A;  2LIU A;  2GZF A;  3DS1 A;  1Q81 Q;  2EHS A;  3CC4 P;  4H2Y C;  2JQ4 A;  1A43 A;  2VLO A;  3CMA P;  2L4B A;  3GJN A;  2PEJ A;  2X2B A;  1VKU A;  3E2D A;  4MRT C;  2KWL A;  5EW5 E;  1K8A Q;  3DPH A;  2CQ8 A;  2K5X A;  2LL8 A;  1CEI A;  3B4Q A;  2L6E A;  1VQO P;  1KC8 Q;  2L9F A;  3CCJ P;  1M1K Q;  2GDY A;  2CGQ A;  1N8R Q;  2VLN A;  1ZNV A;  5DCK A;  3LRY A;  1QRJ A;  3Q20 A;  4U0B A;  2K94 A;  2LPK A;  4H2X C;  1HQB A;  1E0H A;  1HY8 A;  2N6Y A;  5HGL A;  1MZ8 A;  1QVG O;  3G1G A;  2GZJ A;  3G29 A;  1VQ7 P;  3VRL C;  1S72 P;  1VQN P;  1NQ4 A;  2K93 A;  4IZ6 A;  2L22 A;  2GDW A;  3RG6 C;  2XV6 A;  3CCM P;  1IMP A;  1VQM P;  4CA3 A;  4COC A;  2WPT A;  2MVV A;  3G0V A;  4XRQ A;  2EHT A;  7CEI A;  3CCS P;  4QNB A;  5BS2 A;  1FR2 A;  1DNY A;  2KGD A;  1RO0 A;  2L0Q A;  3DTJ A;  4XFY A;  4U0C A;  2EIA A;  1VQL P;  2QNW A;  4XFZ A;  4DG9 A;  2PEK A;  2K92 A;  2K0X A;  3RG2 A;  2NO8 A;  2LKI A;  3I56 P;  1L0H A;  3CCQ P;  4COP A;  2AFD A;  2FVA A;  5HGN A;  3DS0 A;  1AF8 A;  3MGE A;  2JGP A;  2KG9 A;  1T8K A;  1YHQ P;  1OR5 A;  1QVF O;  4M0I A;  2JU1 A;  3GZM A;  2LF4 A;  4R0M A;  1EIA A;  1YIJ P;  2VLQ A;  1YJN P;  2KOS A;  1BXI A;  2XZ0 D;  2GDX A;  2JBG A;  2GZI A;  2JYG A;  1Q82 Q;  2KGE A;  2M8L A;  4U0E A;  2FQ1 A;  1A8O A;  1BAJ A;  3GZL A;  2KR5 A;  2MR8 A;  2BHV A;  4PWV B;  2MF4 A;  2MD9 A;  2DNW A;  1YJ9 P;  4GR2 A;  2OAR A;  1VQ6 P;  5CZD B;  4UHP B;  2Z45 A;  3P05 A;  4F37 A;  4XFX A;  2LML A;  1YI2 P;  1Q7Y Q;  2KG6 A;  2Z44 A;  3G1I A;  1K9M Q;  4PH0 A;  2PY8 A;  2GZG A; 
#chains in the Genus database with same CATH homology
 2L0Q A;  1L0I A;  2FAC A;  3NY7 B;  4HKG A;  2CNR A;  2LIW A;  2QNW A;  2FVE A;  3CE7 A;  4H2W C;  2AFE A;  2K0Y A;  5EJD A;  2LIU A;  2N98 A;  2VSQ A;  2EHS A;  4DG9 A;  2K92 A;  2KOR A;  2K0X A;  2CG5 B;  3RG2 A;  4H2Y C;  2LKI A;  2JQ4 A;  2KG8 A;  2L4B A;  2MVU A;  2X2B A;  1VKU A;  1L0H A;  3EJD A;  4MRT C;  2KWL A;  2ROQ A;  2JU2 A;  2KOO A;  2KW2 A;  2AFD A;  2AF8 A;  2CQ8 A;  2FVA A;  1KLP A;  1X3O A;  2LL8 A;  1AF8 A;  2AVA A;  2JGP A;  2LTE A;  2KG9 A;  2PNG A;  2L9F A;  1F80 D;  1T8K A;  5HVC A;  2GDY A;  2CGQ A;  1OR5 A;  2KOQ A;  2N5I A;  2N6Z A;  2JU1 A;  3GZM A;  5KP7 B;  4R0M A;  2MY5 A;  2XZ1 C;  2KOS A;  2XZ0 D;  4BPH A;  3LMO A;  4BPG A;  2GDX A;  2K94 A;  2FAD A;  2LPK A;  2KGC A;  2FQ2 A;  2K2Q A;  4H2X C;  2KGE A;  1HQB A;  2FQ1 A;  1HY8 A;  2N5H A;  2N6Y A;  3GZL A;  5KP6 B;  2KR5 A;  2MR8 A;  4PWV B;  2MF4 A;  2MD9 A;  2N50 A;  2DNW A;  1ACP A;  2FQ0 A;  2MR7 A;  3EJB A;  2FAE A;  1NQ4 A;  5CZD B;  2FVF A;  2K93 A;  4IZ6 A;  2L22 A;  2GDW A;  2M5R A;  2LML A;  5KP8 B;  4CA3 A;  4BPF A;  2MVV A;  2KG6 A;  2KOP A;  4NEO A;  3EJE A;  2EHT A;  2FHS C;  5HV8 A;  2LOL A;  2KGA A;  1DNY A;  2KGD A;  4PXH B;  1DV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...