5CZDB

The complex structure of vink with vinl
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
b'MWDAQFENLLRRYLPFLSADQPLEQDINLRDIGLDSLGTVELLSELENTYDVHFQDEALTKETFETPGVLWKTLSQM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malonyl-CoA-[acyl-carrier-protein] transacylase
publication title Structure-based analysis of the molecular interactions between acyltransferase and acyl carrier protein in vicenistatin biosynthesis.
pubmed doi rcsb
source organism Streptomyces halstedii
molecule tags Transferase
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5czdB00
4H2XC 2XZ0D 1L0HA 2LPKA 2FAEA 5HV8A 2CGQA 2KGDA 4DG9A 5EJDA 2LL8A 2JU2A 5KP8B 2KOSA 4MRTC 2KWLA 2N5IA 2LIWA 4IZ6A 2K94A 2GDYA 2AF8A 2N98A 2MVVA 4BPHA 2LIUA 2N6YA 3NY7B 2EHSA 3EJEA 1OR5A 4PXHB 2KG8A 1DNYA 1NQ4A 4PWVB 2FQ1A 4BPFA 2QNWA 3EJBA 4R0MA 2FQ2A 3CE7A 2LKIA 2GDWA 2M5RA 4NEOA 2JGPA 3LMOA 4BPGA 2MF4A 5CZDB 1F80D 2AFDA 2FVFA 1HY8A 5KP6B 2N5HA 2EHTA 2L9FA 2AFEA 1AF8A 2XZ1C 2L0QA 4H2WC 2K93A 2LTEA 1X3OA 2FVEA 2KGAA 2KG6A 2PNGA 2KOPA 2K0XA 1ACPA 2LOLA 1DV5A 2KW2A 2K2QA 5HVCA 4CA3A 2LMLA 4HKGA 2K0YA 2ROQA 2KGEA 2MD9A 2K92A 2L22A 2FVAA 4H2YC 2DNWA 2CNRA 2KR5A 1T8KA 2KOOA 2CQ8A 2FQ0A 3EJDA 1HQBA 2MR8A 2VSQA 2JQ4A 2KG9A 1KLPA 1VKUA 2JU1A 2AVAA 2MVUA 2FADA 5KP7B 1L0IA 2N50A 2CG5B 2FACA 2FHSC 2KOQA 2KGCA 2MY5A 3GZLA 2L4BA 3GZMA 2GDXA 2N6ZA 3RG2A 2X2BA 2MR7A 2KORA
chains in the Genus database with same CATH superfamily
1VQOP 3CCQP 2LPKA 1YI2P 3G28A 2CGQA 2KGDA 2GZJA 5EJDA 2DGYA 3DS1A 4DG9A 2PEJA 5KP8B 1ZMBA 1KD1Q 4IZ6A 2L6EA 3P05A 2GDYA 2AF8A 2JYLA 2LIUA 1CEIA 1EIAA 3NY7B 2BUOA 1OR5A 4U0DA 2FQ1A 2QEXP 2PEMA 2LKIA 4XRQA 2M5RA 4COPA 2M8NA 1F80D 5F2KA 2EHTA 3DS3A 3DS5A 2GZEA 3CC4P 4H2WC 1M6NA 2K93A 3H47A 1E6JP 2KGAA 1S72P 2EFJA 2KODA 4F37A 2PEKA 5EW5E 2KW2A 1YJNP 4XROA 3CC2P 4HKGA 3DS2A 3G6EP 7CEIA 3I55P 4PH0A 2MD9A 4WYMA 2K92A 3H0DA 1M1KQ 1ZNVA 2Z45A 2CNRA 3E2DA 2CQ8A 2FQ0A 4U0AA 3U43A 4GR2A 2N50A 2CG5B 1Q86Q 3CCEP 2MY5A 2VLPA 1BXIA 3GZLA 3CCMP 1QVGO 3RG2A 2KWLA 1FR2A 2ONTA 3G71P 1JJ2O 4H2XC 3WBHA 3CXCO 1YJWP 1E0HA 2ERHA 5HGOA 5F2NA 2N5IA 3G26A 1QRJA 3G4SP 2LIWA 1VQ7P 3G1IA 5F2OA 1VQ9P 2MVVA 2GZFA 2N6YA 2EHSA 1MZ8A 2EG5A 4PXHB 1VQKP 1DNYA 2QA4P 4PWVB 2OTJP 5I4TG 1M90Q 4BPGA 2PEIA 3G1GA 5CZDB 2EIAA 4U0CA 2GYKA 2L9FA 2AFEA 3CCRP 1AYIA 3CMAP 5BS2A 2Z46A 2KG6A 2PNGA 2KOPA 2K5XA 1K9MQ 1ACPA 3H4EA 1DV5A 2PENA 4H2YC 1VQ5P 1Z6MA 3RG6C 2DNWA 4XFYA 2KR5A 3EJDA 5HGLA 1VQLP 3G29A 2AVAA 3GJNA 4XFZA 1KQSO 2FADA 1L0IA 2FACA 2FHSC 2KOQA 3GZMA 2BHVA 1D1DA 2JO0A 5HGMA 2OTLP 1IMQA 2CWOA 2K0DX 2JAZA 2LF4A 2XZ0D 1YIJP 2VLOA 3G21A 1EOQA 5HV8A 1GXHA 1GPJA 4MRTC 2K94A 1IUQA 2Z44A 3DPHA 4BPHA 1VQPP 3GKLC 4COCA 4U0BA 1RO0A 4BPFA 2QNWA 2GZGA 2JGPA 1W2BO 4QNBA 2AFDA 1A8OA 1HY8A 2N5HA 3MGEA 1N8RQ 1EMVA 2L0QA 2NO8A 1A43A 1X3OA 2FVEA 3CCUP 2PEQA 5BS1A 1VQMP 3CCSP 2K0XA 2LOLA 2M8PA 2K2QA 5HVCA 1VHNA 2LMLA 3I56P 3CPWO 2ROQA 4U0FA 2E1MA 2KGEA 2WPTA 1YITP 2L22A 2XT1A 2JYGA 3CCVP 4IPYA 2KOOA 2XV6A 1VQ6P 2MR8A 1KLPA 5KP7B 3VRLC 2KGCA 1VQ8P 2GDXA 3LRYA 3CMEP 2X2BA 3HZQA 2MR7A 1RNIA 2XXMA 5HGNA 1BAJA 1L0HA 1M74A 1K73Q 4QKOA 2FAEA 1VQNP 1UJZA 2LL8A 3CD6P 2JU2A 4U0EA 2KOSA 1NJIQ 5DCKA 2JB0A 2N98A 1VQ4P 2PEOA 5JPAA 1UNKA 3B4QA 1K30A 2JBGA 3EJEA 2KG8A 1NQ4A 3EJBA 4R0MA 2FQ2A 3CE7A 3CCJP 1GXGA 1M6EX 1YJ9P 2GDWA 4UHPB 1IMPA 4NEOA 3LMOA 4PH1A 2MF4A 3M1MA 2FVFA 1K8AQ 5KP6B 4XFXA 3Q20A 2OARA 1AF8A 4GR6A 2XZ1C 3DS4A 2M8LA 1Q82Q 3B5IA 4M0IA 2LTEA 3OW2O 2P9XA 2GZIA 3DTJA 4CA3A 1AUMA 2K0YA 2VLQA 1YHQP 1Q81Q 2FVAA 1T8KA 1HQBA 3G0VA 2VSQA 2JQ4A 2KG9A 1QVFO 1VKUA 2JU1A 1RO2A 2MVUA 2VLNA 3HYBA 3CC7P 1KC8Q 3NTEA 2L4BA 2N6ZA 3DS0A 2PY8A 1Q7YQ 3CCLP 2KORA
chains in the Genus database with same CATH topology
4H2XC 2XZ0D 1L0HA 2LPKA 2FAEA 5HV8A 2CGQA 2KGDA 4DG9A 5EJDA 2LL8A 2JU2A 5KP8B 2KOSA 4MRTC 2KWLA 2N5IA 2LIWA 4IZ6A 2K94A 2GDYA 2AF8A 2N98A 2MVVA 4BPHA 2LIUA 2N6YA 3NY7B 2EHSA 3EJEA 1OR5A 4PXHB 2KG8A 1DNYA 1NQ4A 4PWVB 2FQ1A 4BPFA 2QNWA 3EJBA 4R0MA 2FQ2A 3CE7A 2LKIA 2GDWA 2M5RA 4NEOA 2JGPA 3LMOA 4BPGA 2MF4A 5CZDB 1F80D 2AFDA 2FVFA 1HY8A 5KP6B 2N5HA 2EHTA 2L9FA 2AFEA 1AF8A 2XZ1C 2L0QA 4H2WC 2K93A 2LTEA 1X3OA 2FVEA 2KGAA 2KG6A 2PNGA 2KOPA 2K0XA 1ACPA 2LOLA 1DV5A 2KW2A 2K2QA 5HVCA 4CA3A 2LMLA 4HKGA 2K0YA 2ROQA 2KGEA 2MD9A 2K92A 2L22A 2FVAA 4H2YC 2DNWA 2CNRA 2KR5A 1T8KA 2KOOA 2CQ8A 2FQ0A 3EJDA 1HQBA 2MR8A 2VSQA 2JQ4A 2KG9A 1KLPA 1VKUA 2JU1A 2AVAA 2MVUA 2FADA 5KP7B 1L0IA 2N50A 2CG5B 2FACA 2FHSC 2KOQA 2KGCA 2MY5A 3GZLA 2L4BA 3GZMA 2GDXA 2N6ZA 3RG2A 2X2BA 2MR7A 2KORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2X C;  2XZ0 D;  1L0H A;  2LPK A;  2FAE A;  5HV8 A;  2CGQ A;  2KGD A;  4DG9 A;  5EJD A;  2LL8 A;  2JU2 A;  5KP8 B;  2KOS A;  4MRT C;  2KWL A;  2N5I A;  2LIW A;  4IZ6 A;  2K94 A;  2GDY A;  2AF8 A;  2N98 A;  2MVV A;  4BPH A;  2LIU A;  2N6Y A;  3NY7 B;  2EHS A;  3EJE A;  1OR5 A;  4PXH B;  2KG8 A;  1DNY A;  1NQ4 A;  4PWV B;  2FQ1 A;  4BPF A;  2QNW A;  3EJB A;  4R0M A;  2FQ2 A;  3CE7 A;  2LKI A;  2GDW A;  2M5R A;  4NEO A;  2JGP A;  3LMO A;  4BPG A;  2MF4 A;  5CZD B;  1F80 D;  2AFD A;  2FVF A;  1HY8 A;  5KP6 B;  2N5H A;  2EHT A;  2L9F A;  2AFE A;  1AF8 A;  2XZ1 C;  2L0Q A;  4H2W C;  2K93 A;  2LTE A;  1X3O A;  2FVE A;  2KGA A;  2KG6 A;  2PNG A;  2KOP A;  2K0X A;  1ACP A;  2LOL A;  1DV5 A;  2KW2 A;  2K2Q A;  5HVC A;  4CA3 A;  2LML A;  4HKG A;  2K0Y A;  2ROQ A;  2KGE A;  2MD9 A;  2K92 A;  2L22 A;  2FVA A;  4H2Y C;  2DNW A;  2CNR A;  2KR5 A;  1T8K A;  2KOO A;  2CQ8 A;  2FQ0 A;  3EJD A;  1HQB A;  2MR8 A;  2VSQ A;  2JQ4 A;  2KG9 A;  1KLP A;  1VKU A;  2JU1 A;  2AVA A;  2MVU A;  2FAD A;  5KP7 B;  1L0I A;  2N50 A;  2CG5 B;  2FAC A;  2FHS C;  2KOQ A;  2KGC A;  2MY5 A;  3GZL A;  2L4B A;  3GZM A;  2GDX A;  2N6Z A;  3RG2 A;  2X2B A;  2MR7 A;  2KOR A; 
#chains in the Genus database with same CATH topology
 1VQO P;  3CCQ P;  2LPK A;  1YI2 P;  3G28 A;  2CGQ A;  2KGD A;  2GZJ A;  5EJD A;  2DGY A;  3DS1 A;  4DG9 A;  2PEJ A;  5KP8 B;  1ZMB A;  1KD1 Q;  4IZ6 A;  2L6E A;  3P05 A;  2GDY A;  2AF8 A;  2JYL A;  2LIU A;  1CEI A;  1EIA A;  3NY7 B;  2BUO A;  1OR5 A;  4U0D A;  2FQ1 A;  2QEX P;  2PEM A;  2LKI A;  4XRQ A;  2M5R A;  4COP A;  2M8N A;  1F80 D;  5F2K A;  2EHT A;  3DS3 A;  3DS5 A;  2GZE A;  3CC4 P;  4H2W C;  1M6N A;  2K93 A;  3H47 A;  1E6J P;  2KGA A;  1S72 P;  2EFJ A;  2KOD A;  4F37 A;  2PEK A;  5EW5 E;  2KW2 A;  1YJN P;  4XRO A;  3CC2 P;  4HKG A;  3DS2 A;  3G6E P;  7CEI A;  3I55 P;  4PH0 A;  2MD9 A;  4WYM A;  2K92 A;  3H0D A;  1M1K Q;  1ZNV A;  2Z45 A;  2CNR A;  3E2D A;  2CQ8 A;  2FQ0 A;  4U0A A;  3U43 A;  4GR2 A;  2N50 A;  2CG5 B;  1Q86 Q;  3CCE P;  2MY5 A;  2VLP A;  1BXI A;  3GZL A;  3CCM P;  1QVG O;  3RG2 A;  2KWL A;  1FR2 A;  2ONT A;  3G71 P;  1JJ2 O;  4H2X C;  3WBH A;  3CXC O;  1YJW P;  1E0H A;  2ERH A;  5HGO A;  5F2N A;  2N5I A;  3G26 A;  1QRJ A;  3G4S P;  2LIW A;  1VQ7 P;  3G1I A;  5F2O A;  1VQ9 P;  2MVV A;  2GZF A;  2N6Y A;  2EHS A;  1MZ8 A;  2EG5 A;  4PXH B;  1VQK P;  1DNY A;  2QA4 P;  4PWV B;  2OTJ P;  5I4T G;  1M90 Q;  4BPG A;  2PEI A;  3G1G A;  5CZD B;  2EIA A;  4U0C A;  2GYK A;  2L9F A;  2AFE A;  3CCR P;  1AYI A;  3CMA P;  5BS2 A;  2Z46 A;  2KG6 A;  2PNG A;  2KOP A;  2K5X A;  1K9M Q;  1ACP A;  3H4E A;  1DV5 A;  2PEN A;  4H2Y C;  1VQ5 P;  1Z6M A;  3RG6 C;  2DNW A;  4XFY A;  2KR5 A;  3EJD A;  5HGL A;  1VQL P;  3G29 A;  2AVA A;  3GJN A;  4XFZ A;  1KQS O;  2FAD A;  1L0I A;  2FAC A;  2FHS C;  2KOQ A;  3GZM A;  2BHV A;  1D1D A;  2JO0 A;  5HGM A;  2OTL P;  1IMQ A;  2CWO A;  2K0D X;  2JAZ A;  2LF4 A;  2XZ0 D;  1YIJ P;  2VLO A;  3G21 A;  1EOQ A;  5HV8 A;  1GXH A;  1GPJ A;  4MRT C;  2K94 A;  1IUQ A;  2Z44 A;  3DPH A;  4BPH A;  1VQP P;  3GKL C;  4COC A;  4U0B A;  1RO0 A;  4BPF A;  2QNW A;  2GZG A;  2JGP A;  1W2B O;  4QNB A;  2AFD A;  1A8O A;  1HY8 A;  2N5H A;  3MGE A;  1N8R Q;  1EMV A;  2L0Q A;  2NO8 A;  1A43 A;  1X3O A;  2FVE A;  3CCU P;  2PEQ A;  5BS1 A;  1VQM P;  3CCS P;  2K0X A;  2LOL A;  2M8P A;  2K2Q A;  5HVC A;  1VHN A;  2LML A;  3I56 P;  3CPW O;  2ROQ A;  4U0F A;  2E1M A;  2KGE A;  2WPT A;  1YIT P;  2L22 A;  2XT1 A;  2JYG A;  3CCV P;  4IPY A;  2KOO A;  2XV6 A;  1VQ6 P;  2MR8 A;  1KLP A;  5KP7 B;  3VRL C;  2KGC A;  1VQ8 P;  2GDX A;  3LRY A;  3CME P;  2X2B A;  3HZQ A;  2MR7 A;  1RNI A;  2XXM A;  5HGN A;  1BAJ A;  1L0H A;  1M74 A;  1K73 Q;  4QKO A;  2FAE A;  1VQN P;  1UJZ A;  2LL8 A;  3CD6 P;  2JU2 A;  4U0E A;  2KOS A;  1NJI Q;  5DCK A;  2JB0 A;  2N98 A;  1VQ4 P;  2PEO A;  5JPA A;  1UNK A;  3B4Q A;  1K30 A;  2JBG A;  3EJE A;  2KG8 A;  1NQ4 A;  3EJB A;  4R0M A;  2FQ2 A;  3CE7 A;  3CCJ P;  1GXG A;  1M6E X;  1YJ9 P;  2GDW A;  4UHP B;  1IMP A;  4NEO A;  3LMO A;  4PH1 A;  2MF4 A;  3M1M A;  2FVF A;  1K8A Q;  5KP6 B;  4XFX A;  3Q20 A;  2OAR A;  1AF8 A;  4GR6 A;  2XZ1 C;  3DS4 A;  2M8L A;  1Q82 Q;  3B5I A;  4M0I A;  2LTE A;  3OW2 O;  2P9X A;  2GZI A;  3DTJ A;  4CA3 A;  1AUM A;  2K0Y A;  2VLQ A;  1YHQ P;  1Q81 Q;  2FVA A;  1T8K A;  1HQB A;  3G0V A;  2VSQ A;  2JQ4 A;  2KG9 A;  1QVF O;  1VKU A;  2JU1 A;  1RO2 A;  2MVU A;  2VLN A;  3HYB A;  3CC7 P;  1KC8 Q;  3NTE A;  2L4B A;  2N6Z A;  3DS0 A;  2PY8 A;  1Q7Y Q;  3CCL P;  2KOR A; 
#chains in the Genus database with same CATH homology
 4H2X C;  2XZ0 D;  1L0H A;  2LPK A;  2FAE A;  5HV8 A;  2CGQ A;  2KGD A;  4DG9 A;  5EJD A;  2LL8 A;  2JU2 A;  5KP8 B;  2KOS A;  4MRT C;  2KWL A;  2N5I A;  2LIW A;  4IZ6 A;  2K94 A;  2GDY A;  2AF8 A;  2N98 A;  2MVV A;  4BPH A;  2LIU A;  2N6Y A;  3NY7 B;  2EHS A;  3EJE A;  1OR5 A;  4PXH B;  2KG8 A;  1DNY A;  1NQ4 A;  4PWV B;  2FQ1 A;  4BPF A;  2QNW A;  3EJB A;  4R0M A;  2FQ2 A;  3CE7 A;  2LKI A;  2GDW A;  2M5R A;  4NEO A;  2JGP A;  3LMO A;  4BPG A;  2MF4 A;  5CZD B;  1F80 D;  2AFD A;  2FVF A;  1HY8 A;  5KP6 B;  2N5H A;  2EHT A;  2L9F A;  2AFE A;  1AF8 A;  2XZ1 C;  2L0Q A;  4H2W C;  2K93 A;  2LTE A;  1X3O A;  2FVE A;  2KGA A;  2KG6 A;  2PNG A;  2KOP A;  2K0X A;  1ACP A;  2LOL A;  1DV5 A;  2KW2 A;  2K2Q A;  5HVC A;  4CA3 A;  2LML A;  4HKG A;  2K0Y A;  2ROQ A;  2KGE A;  2MD9 A;  2K92 A;  2L22 A;  2FVA A;  4H2Y C;  2DNW A;  2CNR A;  2KR5 A;  1T8K A;  2KOO A;  2CQ8 A;  2FQ0 A;  3EJD A;  1HQB A;  2MR8 A;  2VSQ A;  2JQ4 A;  2KG9 A;  1KLP A;  1VKU A;  2JU1 A;  2AVA A;  2MVU A;  2FAD A;  5KP7 B;  1L0I A;  2N50 A;  2CG5 B;  2FAC A;  2FHS C;  2KOQ A;  2KGC A;  2MY5 A;  3GZL A;  2L4B A;  3GZM A;  2GDX A;  2N6Z A;  3RG2 A;  2X2B A;  2MR7 A;  2KOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...