5CZDB

The complex structure of vink with vinl
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
MWDAQFENLLRRYLPFLSADQPLEQDINLRDIGLDSLGTVELLSELENTYDVHFQDEALTKETFETPGVLWKTLSQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Malonyl-CoA-[acyl-carrier-protein] transacylase
publication title Structure-based analysis of the molecular interactions between acyltransferase and acyl carrier protein in vicenistatin biosynthesis.
pubmed doi rcsb
source organism Streptomyces halstedii
total genus 20
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2015-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5czdB00
2M5RA 2KG6A 2KWLA 2JQ4A 2MY5A 2KW2A 2KGDA 2L4BA 4BPHA 5KP6B 2CGQA 2KGEA 3EJBA 2KOOA 2LPKA 2MVVA 2K0XA 2DNWA 4CA3A 2K94A 4PWVB 1L0IA 3GZMA 2LIWA 5EJDA 2K2QA 2MVUA 2JU1A 1T8KA 2EHSA 2FQ1A 2GDWA 1DV5A 1KLPA 2N5HA 5KP7B 2ROQA 1ACPA 2CG5B 5HVCA 2GDXA 4BPFA 4BPGA 2XZ1C 2FQ2A 2FACA 3EJEA 2JGPA 2FADA 2QNWA 4NEOA 5KP8B 1HY8A 2FVFA 2KOPA 2LIUA 2XZ0D 1L0HA 3EJDA 2MD9A 2LOLA 4H2WC 2KOSA 2AFEA 3GZLA 2LKIA 2CQ8A 2KR5A 4PXHB 2FVAA 2VSQA 2L0QA 2LTEA 2AF8A 2FQ0A 2N50A 2JU2A 1AF8A 2KGAA 4DG9A 2K0YA 2PNGA 1F80D 2KGCA 2LL8A 4HKGA 1VKUA 4R0MA 2L22A 2KG8A 2GDYA 2KOQA 2MF4A 4H2YC 2N5IA 2MR7A 1HQBA 2CNRA 2KORA 2FVEA 5CZDB 2N6ZA 2LMLA 4IZ6A 2MR8A 2N6YA 4MRTC 3CE7A 1X3OA 2KG9A 2N98A 2FHSC 3NY7B 2AFDA 4H2XC 1OR5A 2K92A 5HV8A 2L9FA 3LMOA 2AVAA 2FAEA 1DNYA 3RG2A 2K93A 1NQ4A 2X2BA 2EHTA
chains in the Genus database with same CATH superfamily
2KG6A 1VQKP 2LF4A 2M8PA 1VQPP 5HGOA 3GJNA 1K73Q 2Z44A 5F2OA 1RO0A 3H0DA 3NTEA 1VQOP 2M8LA 1M6NA 2K2QA 3DS1A 5KP7B 1RO2A 4U0FA 3DPHA 5HGMA 2GDXA 1Q86Q 1IMQA 3P05A 2L6EA 4GR6A 4XFYA 5F2NA 2JB0A 3H47A 5HGLA 2NO8A 1YHQP 2WPTA 3I56P 1D1DA 1GXHA 2AFEA 2KR5A 4GR2A 3G29A 4PXHB 2FVAA 1M6EX 2ONTA 3CC2P 1IMPA 2KGAA 1F80D 2EG5A 4R0MA 2MF4A 3DS2A 1YITP 1HQBA 2BHVA 4U0EA 1VQ8P 3CCSP 2FVEA 2EFJA 1VHNA 3M1MA 2N6ZA 1QVFO 2N6YA 3HYBA 3DTJA 3B4QA 3CC7P 3G4SP 1OR5A 2K92A 1YJ9P 2AVAA 1CEIA 1VQNP 3G71P 4XROA 2K93A 1NQ4A 4U0DA 1BAJA 2BUOA 4U0BA 2M8NA 2VLNA 2GZIA 1GXGA 7CEIA 1ZNVA 2GZGA 2MVVA 3CCEP 4CA3A 3DS0A 4UHPB 1Q81Q 2K0DX 1K9MQ 2LIWA 2MVUA 1T8KA 1E6JP 2EIAA 1DV5A 1Q82Q 1KLPA 3HZQA 2N5HA 3U43A 2XV6A 1VQ4P 4WYMA 1ACPA 5HVCA 2VLPA 1UJZA 4BPFA 4BPGA 2XZ1C 1EMVA 2PEOA 2FQ2A 2FACA 1YJWP 2FADA 2JYLA 5KP8B 3G1IA 5F2KA 5BS2A 2KOPA 4F37A 1L0HA 3EJDA 2KOSA 2CQ8A 2GZFA 2VSQA 2L0QA 1NJIQ 1A8OA 2LTEA 2AF8A 2FQ0A 1QVGO 4DG9A 3CXCO 1S72P 2K0YA 2KGCA 1VQ5P 3DS3A 2KOQA 2VLQA 2N5IA 2DGYA 3G26A 2PY8A 3CMAP 3LRYA 1M1KQ 4IZ6A 3CCMP 2KODA 1GPJA 2AFDA 3OW2O 5HV8A 2L9FA 1BXIA 2FAEA 2GZEA 2EHTA 2M5RA 2P9XA 2QEXP 2PENA 2MY5A 2KW2A 2KGDA 2L4BA 5KP6B 2KGEA 3EJBA 3DS4A 1EOQA 2Z46A 4PWVB 3GZMA 5EJDA 2JU1A 2JYGA 2FQ1A 2GDWA 2Z45A 4M0IA 2ROQA 1YIJP 4COCA 1N8RQ 5JPAA 1VQMP 1W2BO 4PH0A 2XZ0D 1YJNP 2MD9A 2LOLA 1M74A 5BS1A 2OTJP 4U0AA 1KD1Q 3DS5A 2N50A 4COPA 2JU2A 4QKOA 5EW5E 4U0CA 2LL8A 3I55P 1VKUA 2L22A 3CMEP 2PEMA 2GDYA 3WBHA 1KC8Q 2MR7A 2PEKA 1ZMBA 5CZDB 4XFXA 3CCLP 3Q20A 3CE7A 1X3OA 1VQ9P 2KG9A 2FHSC 3NY7B 1RNIA 1Q7YQ 3LMOA 4XRQA 3CD6P 3RG2A 1JJ2O 1Z6MA 2JBGA 2JAZA 2KWLA 4IPYA 3B5IA 2JQ4A 1K30A 1VQ7P 4BPHA 2ERHA 2CGQA 2KOOA 2LPKA 2K0XA 2DNWA 5DCKA 2K94A 2OARA 3G28A 1FR2A 1MZ8A 2PEIA 1L0IA 2OTLP 2PEQA 2E1MA 3CCJP 3G0VA 2EHSA 1K8AQ 3CCVP 1M90Q 3G6EP 5HGNA 1E0HA 4PH1A 2CG5B 2XT1A 3EJEA 2JGPA 1AYIA 1KQSO 2QNWA 4NEOA 1IUQA 2PEJA 3CCQP 1HY8A 5I4TG 2XXMA 2FVFA 2LIUA 3H4EA 1VQLP 3G21A 4H2WC 3GZLA 3MGEA 2K5XA 2LKIA 3CPWO 1VQ6P 3RG6C 1QRJA 2JO0A 1AF8A 3CCUP 2PNGA 2GZJA 2QA4P 4HKGA 1UNKA 2KG8A 4H2YC 4XFZA 2CNRA 2VLOA 3GKLC 2KORA 4QNBA 1EIAA 2LMLA 1YI2P 2MR8A 4MRTC 1AUMA 3CC4P 2GYKA 2N98A 4H2XC 3E2DA 3G1GA 3VRLC 1DNYA 3CCRP 2CWOA 2X2BA 1A43A
chains in the Genus database with same CATH topology
2M5RA 2KG6A 2KWLA 2JQ4A 2MY5A 2KW2A 2KGDA 2L4BA 4BPHA 5KP6B 2CGQA 2KGEA 3EJBA 2KOOA 2LPKA 2MVVA 2K0XA 2DNWA 4CA3A 2K94A 4PWVB 1L0IA 3GZMA 2LIWA 5EJDA 2K2QA 2MVUA 2JU1A 1T8KA 2EHSA 2FQ1A 2GDWA 1DV5A 1KLPA 2N5HA 5KP7B 2ROQA 1ACPA 2CG5B 5HVCA 2GDXA 4BPFA 4BPGA 2XZ1C 2FQ2A 2FACA 3EJEA 2JGPA 2FADA 2QNWA 4NEOA 5KP8B 1HY8A 2FVFA 2KOPA 2LIUA 2XZ0D 1L0HA 3EJDA 2MD9A 2LOLA 4H2WC 2KOSA 2AFEA 3GZLA 2LKIA 2CQ8A 2KR5A 4PXHB 2FVAA 2VSQA 2L0QA 2LTEA 2AF8A 2FQ0A 2N50A 2JU2A 1AF8A 2KGAA 4DG9A 2K0YA 2PNGA 1F80D 2KGCA 2LL8A 4HKGA 1VKUA 4R0MA 2L22A 2KG8A 2GDYA 2KOQA 2MF4A 4H2YC 2N5IA 2MR7A 1HQBA 2CNRA 2KORA 2FVEA 5CZDB 2N6ZA 2LMLA 4IZ6A 2MR8A 2N6YA 4MRTC 3CE7A 1X3OA 2KG9A 2N98A 2FHSC 3NY7B 2AFDA 4H2XC 1OR5A 2K92A 5HV8A 2L9FA 3LMOA 2AVAA 2FAEA 1DNYA 3RG2A 2K93A 1NQ4A 2X2BA 2EHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5R A;  2KG6 A;  2KWL A;  2JQ4 A;  2MY5 A;  2KW2 A;  2KGD A;  2L4B A;  4BPH A;  5KP6 B;  2CGQ A;  2KGE A;  3EJB A;  2KOO A;  2LPK A;  2MVV A;  2K0X A;  2DNW A;  4CA3 A;  2K94 A;  4PWV B;  1L0I A;  3GZM A;  2LIW A;  5EJD A;  2K2Q A;  2MVU A;  2JU1 A;  1T8K A;  2EHS A;  2FQ1 A;  2GDW A;  1DV5 A;  1KLP A;  2N5H A;  5KP7 B;  2ROQ A;  1ACP A;  2CG5 B;  5HVC A;  2GDX A;  4BPF A;  4BPG A;  2XZ1 C;  2FQ2 A;  2FAC A;  3EJE A;  2JGP A;  2FAD A;  2QNW A;  4NEO A;  5KP8 B;  1HY8 A;  2FVF A;  2KOP A;  2LIU A;  2XZ0 D;  1L0H A;  3EJD A;  2MD9 A;  2LOL A;  4H2W C;  2KOS A;  2AFE A;  3GZL A;  2LKI A;  2CQ8 A;  2KR5 A;  4PXH B;  2FVA A;  2VSQ A;  2L0Q A;  2LTE A;  2AF8 A;  2FQ0 A;  2N50 A;  2JU2 A;  1AF8 A;  2KGA A;  4DG9 A;  2K0Y A;  2PNG A;  1F80 D;  2KGC A;  2LL8 A;  4HKG A;  1VKU A;  4R0M A;  2L22 A;  2KG8 A;  2GDY A;  2KOQ A;  2MF4 A;  4H2Y C;  2N5I A;  2MR7 A;  1HQB A;  2CNR A;  2KOR A;  2FVE A;  5CZD B;  2N6Z A;  2LML A;  4IZ6 A;  2MR8 A;  2N6Y A;  4MRT C;  3CE7 A;  1X3O A;  2KG9 A;  2N98 A;  2FHS C;  3NY7 B;  2AFD A;  4H2X C;  1OR5 A;  2K92 A;  5HV8 A;  2L9F A;  3LMO A;  2AVA A;  2FAE A;  1DNY A;  3RG2 A;  2K93 A;  1NQ4 A;  2X2B A;  2EHT A; 
#chains in the Genus database with same CATH topology
 2KG6 A;  1VQK P;  2LF4 A;  2M8P A;  1VQP P;  5HGO A;  3GJN A;  1K73 Q;  2Z44 A;  5F2O A;  1RO0 A;  3H0D A;  3NTE A;  1VQO P;  2M8L A;  1M6N A;  2K2Q A;  3DS1 A;  5KP7 B;  1RO2 A;  4U0F A;  3DPH A;  5HGM A;  2GDX A;  1Q86 Q;  1IMQ A;  3P05 A;  2L6E A;  4GR6 A;  4XFY A;  5F2N A;  2JB0 A;  3H47 A;  5HGL A;  2NO8 A;  1YHQ P;  2WPT A;  3I56 P;  1D1D A;  1GXH A;  2AFE A;  2KR5 A;  4GR2 A;  3G29 A;  4PXH B;  2FVA A;  1M6E X;  2ONT A;  3CC2 P;  1IMP A;  2KGA A;  1F80 D;  2EG5 A;  4R0M A;  2MF4 A;  3DS2 A;  1YIT P;  1HQB A;  2BHV A;  4U0E A;  1VQ8 P;  3CCS P;  2FVE A;  2EFJ A;  1VHN A;  3M1M A;  2N6Z A;  1QVF O;  2N6Y A;  3HYB A;  3DTJ A;  3B4Q A;  3CC7 P;  3G4S P;  1OR5 A;  2K92 A;  1YJ9 P;  2AVA A;  1CEI A;  1VQN P;  3G71 P;  4XRO A;  2K93 A;  1NQ4 A;  4U0D A;  1BAJ A;  2BUO A;  4U0B A;  2M8N A;  2VLN A;  2GZI A;  1GXG A;  7CEI A;  1ZNV A;  2GZG A;  2MVV A;  3CCE P;  4CA3 A;  3DS0 A;  4UHP B;  1Q81 Q;  2K0D X;  1K9M Q;  2LIW A;  2MVU A;  1T8K A;  1E6J P;  2EIA A;  1DV5 A;  1Q82 Q;  1KLP A;  3HZQ A;  2N5H A;  3U43 A;  2XV6 A;  1VQ4 P;  4WYM A;  1ACP A;  5HVC A;  2VLP A;  1UJZ A;  4BPF A;  4BPG A;  2XZ1 C;  1EMV A;  2PEO A;  2FQ2 A;  2FAC A;  1YJW P;  2FAD A;  2JYL A;  5KP8 B;  3G1I A;  5F2K A;  5BS2 A;  2KOP A;  4F37 A;  1L0H A;  3EJD A;  2KOS A;  2CQ8 A;  2GZF A;  2VSQ A;  2L0Q A;  1NJI Q;  1A8O A;  2LTE A;  2AF8 A;  2FQ0 A;  1QVG O;  4DG9 A;  3CXC O;  1S72 P;  2K0Y A;  2KGC A;  1VQ5 P;  3DS3 A;  2KOQ A;  2VLQ A;  2N5I A;  2DGY A;  3G26 A;  2PY8 A;  3CMA P;  3LRY A;  1M1K Q;  4IZ6 A;  3CCM P;  2KOD A;  1GPJ A;  2AFD A;  3OW2 O;  5HV8 A;  2L9F A;  1BXI A;  2FAE A;  2GZE A;  2EHT A;  2M5R A;  2P9X A;  2QEX P;  2PEN A;  2MY5 A;  2KW2 A;  2KGD A;  2L4B A;  5KP6 B;  2KGE A;  3EJB A;  3DS4 A;  1EOQ A;  2Z46 A;  4PWV B;  3GZM A;  5EJD A;  2JU1 A;  2JYG A;  2FQ1 A;  2GDW A;  2Z45 A;  4M0I A;  2ROQ A;  1YIJ P;  4COC A;  1N8R Q;  5JPA A;  1VQM P;  1W2B O;  4PH0 A;  2XZ0 D;  1YJN P;  2MD9 A;  2LOL A;  1M74 A;  5BS1 A;  2OTJ P;  4U0A A;  1KD1 Q;  3DS5 A;  2N50 A;  4COP A;  2JU2 A;  4QKO A;  5EW5 E;  4U0C A;  2LL8 A;  3I55 P;  1VKU A;  2L22 A;  3CME P;  2PEM A;  2GDY A;  3WBH A;  1KC8 Q;  2MR7 A;  2PEK A;  1ZMB A;  5CZD B;  4XFX A;  3CCL P;  3Q20 A;  3CE7 A;  1X3O A;  1VQ9 P;  2KG9 A;  2FHS C;  3NY7 B;  1RNI A;  1Q7Y Q;  3LMO A;  4XRQ A;  3CD6 P;  3RG2 A;  1JJ2 O;  1Z6M A;  2JBG A;  2JAZ A;  2KWL A;  4IPY A;  3B5I A;  2JQ4 A;  1K30 A;  1VQ7 P;  4BPH A;  2ERH A;  2CGQ A;  2KOO A;  2LPK A;  2K0X A;  2DNW A;  5DCK A;  2K94 A;  2OAR A;  3G28 A;  1FR2 A;  1MZ8 A;  2PEI A;  1L0I A;  2OTL P;  2PEQ A;  2E1M A;  3CCJ P;  3G0V A;  2EHS A;  1K8A Q;  3CCV P;  1M90 Q;  3G6E P;  5HGN A;  1E0H A;  4PH1 A;  2CG5 B;  2XT1 A;  3EJE A;  2JGP A;  1AYI A;  1KQS O;  2QNW A;  4NEO A;  1IUQ A;  2PEJ A;  3CCQ P;  1HY8 A;  5I4T G;  2XXM A;  2FVF A;  2LIU A;  3H4E A;  1VQL P;  3G21 A;  4H2W C;  3GZL A;  3MGE A;  2K5X A;  2LKI A;  3CPW O;  1VQ6 P;  3RG6 C;  1QRJ A;  2JO0 A;  1AF8 A;  3CCU P;  2PNG A;  2GZJ A;  2QA4 P;  4HKG A;  1UNK A;  2KG8 A;  4H2Y C;  4XFZ A;  2CNR A;  2VLO A;  3GKL C;  2KOR A;  4QNB A;  1EIA A;  2LML A;  1YI2 P;  2MR8 A;  4MRT C;  1AUM A;  3CC4 P;  2GYK A;  2N98 A;  4H2X C;  3E2D A;  3G1G A;  3VRL C;  1DNY A;  3CCR P;  2CWO A;  2X2B A;  1A43 A; 
#chains in the Genus database with same CATH homology
 2M5R A;  2KG6 A;  2KWL A;  2JQ4 A;  2MY5 A;  2KW2 A;  2KGD A;  2L4B A;  4BPH A;  5KP6 B;  2CGQ A;  2KGE A;  3EJB A;  2KOO A;  2LPK A;  2MVV A;  2K0X A;  2DNW A;  4CA3 A;  2K94 A;  4PWV B;  1L0I A;  3GZM A;  2LIW A;  5EJD A;  2K2Q A;  2MVU A;  2JU1 A;  1T8K A;  2EHS A;  2FQ1 A;  2GDW A;  1DV5 A;  1KLP A;  2N5H A;  5KP7 B;  2ROQ A;  1ACP A;  2CG5 B;  5HVC A;  2GDX A;  4BPF A;  4BPG A;  2XZ1 C;  2FQ2 A;  2FAC A;  3EJE A;  2JGP A;  2FAD A;  2QNW A;  4NEO A;  5KP8 B;  1HY8 A;  2FVF A;  2KOP A;  2LIU A;  2XZ0 D;  1L0H A;  3EJD A;  2MD9 A;  2LOL A;  4H2W C;  2KOS A;  2AFE A;  3GZL A;  2LKI A;  2CQ8 A;  2KR5 A;  4PXH B;  2FVA A;  2VSQ A;  2L0Q A;  2LTE A;  2AF8 A;  2FQ0 A;  2N50 A;  2JU2 A;  1AF8 A;  2KGA A;  4DG9 A;  2K0Y A;  2PNG A;  1F80 D;  2KGC A;  2LL8 A;  4HKG A;  1VKU A;  4R0M A;  2L22 A;  2KG8 A;  2GDY A;  2KOQ A;  2MF4 A;  4H2Y C;  2N5I A;  2MR7 A;  1HQB A;  2CNR A;  2KOR A;  2FVE A;  5CZD B;  2N6Z A;  2LML A;  4IZ6 A;  2MR8 A;  2N6Y A;  4MRT C;  3CE7 A;  1X3O A;  2KG9 A;  2N98 A;  2FHS C;  3NY7 B;  2AFD A;  4H2X C;  1OR5 A;  2K92 A;  5HV8 A;  2L9F A;  3LMO A;  2AVA A;  2FAE A;  1DNY A;  3RG2 A;  2K93 A;  1NQ4 A;  2X2B A;  2EHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...