2N5HA

Pltl-holo
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
90
structure length
90
Chain Sequence
MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTVEQLKAESALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Peptidyl carrier protein PltL
publication title Structure and Substrate Sequestration in the Pyoluteorin Type II Peptidyl Carrier Protein PltL.
pubmed doi rcsb
source organism Pseudomonas protegens
total genus 24
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n5hA00
2FADA 2CGQA 2LIUA 2N5IA 3GZLA 2N6YA 2K94A 3LMOA 2CNRA 2GDYA 1DV5A 2L22A 2KWLA 2ROQA 5CZDB 1X3OA 2LIWA 2AVAA 2KOQA 2L9FA 2FVEA 2KORA 2KW2A 2AF8A 2AFEA 2K93A 4HKGA 2N50A 2K0XA 2MR7A 4PXHB 4H2WC 2K2QA 2MR8A 2JU2A 4R0MA 2GDWA 5EJDA 2M5RA 1HY8A 2MF4A 1F80D 2KOPA 2KG6A 2KR5A 2KG9A 2VSQA 2KOOA 3EJDA 1ACPA 1AF8A 2KGCA 2CQ8A 2DNWA 5KP8B 2JGPA 2FQ1A 2FQ0A 2XZ1C 2K0YA 2CG5B 5KP6B 3EJEA 3NY7B 2FACA 1DNYA 2L4BA 2L0QA 5HVCA 3EJBA 2KGDA 1NQ4A 2MVUA 2MD9A 1OR5A 2N98A 5KP7B 2JQ4A 2LL8A 2LTEA 2EHTA 2FVAA 4BPGA 4DG9A 2XZ0D 4NEOA 1HQBA 2X2BA 2LMLA 5HV8A 4PWVB 4IZ6A 4CA3A 4BPFA 2PNGA 2LOLA 2QNWA 4H2XC 2AFDA 2EHSA 2JU1A 2FHSC 1KLPA 2LKIA 1T8KA 2N5HA 3RG2A 2FQ2A 2K92A 2LPKA 2MVVA 3CE7A 2KGEA 4MRTC 4H2YC 2FVFA 2N6ZA 2KGAA 1L0IA 4BPHA 2MY5A 2GDXA 2KOSA 1VKUA 2KG8A 2FAEA 3GZMA 1L0HA
chains in the Genus database with same CATH superfamily
3G29A 2PEQA 2CNRA 1E6JP 2OARA 1Q82Q 2AVAA 2KOQA 1Q81Q 2KW2A 2M8PA 2AFEA 2K93A 2N50A 3G0VA 2PENA 3CCUP 2K0XA 2MR7A 3I56P 2QEXP 2GDWA 2EIAA 5EW5E 3G26A 1A43A 2KG9A 2VSQA 1AF8A 2PEJA 2WPTA 1M6EX 1Q86Q 2FQ1A 3NY7B 1UNKA 3RG6C 1GXGA 5HVCA 2M8NA 3I55P 1K73Q 2N98A 5JPAA 2JQ4A 4XFZA 2EHTA 4DG9A 2QNWA 3DS0A 2AFDA 1YITP 2N5HA 1N8RQ 4MRTC 3H47A 1VQ6P 3G1IA 3DS1A 1CEIA 2KOSA 2PEKA 1VKUA 3DS5A 1VQ7P 2Z46A 2ERHA 2L6EA 2XXMA 3CCEP 2FADA 2CGQA 3DS4A 3P05A 1AUMA 1Q7YQ 2PEOA 2K94A 2VLNA 3CMAP 1VHNA 2ROQA 1X3OA 2LIWA 1M90Q 2FVEA 3B5IA 4M0IA 2AF8A 4QNBA 1QRJA 1AYIA 4H2WC 2K2QA 2MR8A 3H4EA 5EJDA 2M5RA 1IMPA 2MF4A 3CCJP 2M8LA 3CC7P 2PY8A 1RO0A 1GPJA 2JYLA 2JBGA 3EJDA 1ACPA 2KGCA 2CQ8A 2DNWA 1MZ8A 2JGPA 2FQ0A 2K0YA 1YHQP 3EJEA 4WYMA 4F37A 1DNYA 2L4BA 5HGLA 1RNIA 1VQ9P 2KGDA 1NQ4A 1M1KQ 2MD9A 1EOQA 2FVAA 1VQ5P 4U0EA 4NEOA 3CMEP 3WBHA 4BPFA 5HGMA 2PNGA 2GZJA 4XRQA 2EHSA 2FHSC 1M6NA 3M1MA 2OTJP 5F2OA 2FQ2A 2K92A 4H2YC 2N6ZA 2KGAA 1KC8Q 1L0IA 7CEIA 1VQ4P 3H0DA 1YJNP 2K5XA 3LRYA 2LIUA 5BS2A 2N5IA 1VQLP 3GKLC 3LMOA 2Z44A 2GZIA 1ZNVA 1DV5A 4XROA 1BXIA 5CZDB 1Z6MA 1S72P 3B4QA 2L9FA 5HGNA 1IUQA 2KORA 1KQSO 1EMVA 2NO8A 5I4TG 3DS3A 3OW2O 4PXHB 2ONTA 4XFXA 2JYGA 1K8AQ 3Q20A 2JU2A 3MGEA 1GXHA 2OTLP 2KOPA 2XV6A 3CCRP 5KP8B 2JAZA 2XZ1C 2CG5B 2P9XA 1VQNP 5KP6B 3CXCO 3CCSP 2L0QA 3DS2A 5HGOA 2DGYA 1OR5A 2PEMA 4PH0A 2EG5A 3CC4P 5KP7B 2LL8A 2LTEA 4XFYA 3CPWO 2GZGA 2X2BA 2VLOA 3NTEA 4PWVB 4IZ6A 4U0DA 3CC2P 4GR2A 1EIAA 2LOLA 4H2XC 3CCLP 1RO2A 4COPA 2JU1A 2VLPA 1JJ2O 2LKIA 1KLPA 1E0HA 2LPKA 2MVVA 2FVFA 4U0BA 3HZQA 2GDXA 3CCVP 2KG8A 4U0AA 4GR6A 3GZMA 1YJWP 1IMQA 3G71P 4UHPB 4QKOA 3GZLA 2N6YA 2QA4P 2BHVA 2GZEA 2GDYA 2L22A 2KWLA 3G21A 4U0FA 2JO0A 2BUOA 1FR2A 2K0DX 1VQ8P 1BAJA 5F2KA 4HKGA 2LF4A 2VLQA 4R0MA 3HYBA 1UJZA 4U0CA 3G4SP 4COCA 1QVFO 1HY8A 3DTJA 1F80D 2KR5A 2KG6A 3GJNA 2KOOA 1ZMBA 4IPYA 3E2DA 3U43A 2JB0A 2Z45A 5BS1A 1QVGO 1VQMP 2FACA 2CWOA 3G6EP 1D1DA 4PH1A 3G28A 3EJBA 2MVUA 2PEIA 5DCKA 3G1GA 2GZFA 2GYKA 4BPGA 3CCQP 3VRLC 2XZ0D 1HQBA 3CCMP 2LMLA 1M74A 2E1MA 1VQKP 5HV8A 1YIJP 1VQOP 5F2NA 4CA3A 1A8OA 2XT1A 1YJ9P 1T8KA 3RG2A 3CE7A 2KGEA 1YI2P 4BPHA 2MY5A 1KD1Q 1K9MQ 1K30A 2EFJA 2FAEA 1NJIQ 2KODA 1VQPP 1L0HA 3CD6P 1W2BO 3DPHA
chains in the Genus database with same CATH topology
2FADA 2CGQA 2LIUA 2N5IA 3GZLA 2N6YA 2K94A 3LMOA 2CNRA 2GDYA 1DV5A 2L22A 2KWLA 2ROQA 5CZDB 1X3OA 2LIWA 2AVAA 2KOQA 2L9FA 2FVEA 2KORA 2KW2A 2AF8A 2AFEA 2K93A 4HKGA 2N50A 2K0XA 2MR7A 4PXHB 4H2WC 2K2QA 2MR8A 2JU2A 4R0MA 2GDWA 5EJDA 2M5RA 1HY8A 2MF4A 1F80D 2KOPA 2KG6A 2KR5A 2KG9A 2VSQA 2KOOA 3EJDA 1ACPA 1AF8A 2KGCA 2CQ8A 2DNWA 5KP8B 2JGPA 2FQ1A 2FQ0A 2XZ1C 2K0YA 2CG5B 5KP6B 3EJEA 3NY7B 2FACA 1DNYA 2L4BA 2L0QA 5HVCA 3EJBA 2KGDA 1NQ4A 2MVUA 2MD9A 1OR5A 2N98A 5KP7B 2JQ4A 2LL8A 2LTEA 2EHTA 2FVAA 4BPGA 4DG9A 2XZ0D 4NEOA 1HQBA 2X2BA 2LMLA 5HV8A 4PWVB 4IZ6A 4CA3A 4BPFA 2PNGA 2LOLA 2QNWA 4H2XC 2AFDA 2EHSA 2JU1A 2FHSC 1KLPA 2LKIA 1T8KA 2N5HA 3RG2A 2FQ2A 2K92A 2LPKA 2MVVA 3CE7A 2KGEA 4MRTC 4H2YC 2FVFA 2N6ZA 2KGAA 1L0IA 4BPHA 2MY5A 2GDXA 2KOSA 1VKUA 2KG8A 2FAEA 3GZMA 1L0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAD A;  2CGQ A;  2LIU A;  2N5I A;  3GZL A;  2N6Y A;  2K94 A;  3LMO A;  2CNR A;  2GDY A;  1DV5 A;  2L22 A;  2KWL A;  2ROQ A;  5CZD B;  1X3O A;  2LIW A;  2AVA A;  2KOQ A;  2L9F A;  2FVE A;  2KOR A;  2KW2 A;  2AF8 A;  2AFE A;  2K93 A;  4HKG A;  2N50 A;  2K0X A;  2MR7 A;  4PXH B;  4H2W C;  2K2Q A;  2MR8 A;  2JU2 A;  4R0M A;  2GDW A;  5EJD A;  2M5R A;  1HY8 A;  2MF4 A;  1F80 D;  2KOP A;  2KG6 A;  2KR5 A;  2KG9 A;  2VSQ A;  2KOO A;  3EJD A;  1ACP A;  1AF8 A;  2KGC A;  2CQ8 A;  2DNW A;  5KP8 B;  2JGP A;  2FQ1 A;  2FQ0 A;  2XZ1 C;  2K0Y A;  2CG5 B;  5KP6 B;  3EJE A;  3NY7 B;  2FAC A;  1DNY A;  2L4B A;  2L0Q A;  5HVC A;  3EJB A;  2KGD A;  1NQ4 A;  2MVU A;  2MD9 A;  1OR5 A;  2N98 A;  5KP7 B;  2JQ4 A;  2LL8 A;  2LTE A;  2EHT A;  2FVA A;  4BPG A;  4DG9 A;  2XZ0 D;  4NEO A;  1HQB A;  2X2B A;  2LML A;  5HV8 A;  4PWV B;  4IZ6 A;  4CA3 A;  4BPF A;  2PNG A;  2LOL A;  2QNW A;  4H2X C;  2AFD A;  2EHS A;  2JU1 A;  2FHS C;  1KLP A;  2LKI A;  1T8K A;  2N5H A;  3RG2 A;  2FQ2 A;  2K92 A;  2LPK A;  2MVV A;  3CE7 A;  2KGE A;  4MRT C;  4H2Y C;  2FVF A;  2N6Z A;  2KGA A;  1L0I A;  4BPH A;  2MY5 A;  2GDX A;  2KOS A;  1VKU A;  2KG8 A;  2FAE A;  3GZM A;  1L0H A; 
#chains in the Genus database with same CATH topology
 3G29 A;  2PEQ A;  2CNR A;  1E6J P;  2OAR A;  1Q82 Q;  2AVA A;  2KOQ A;  1Q81 Q;  2KW2 A;  2M8P A;  2AFE A;  2K93 A;  2N50 A;  3G0V A;  2PEN A;  3CCU P;  2K0X A;  2MR7 A;  3I56 P;  2QEX P;  2GDW A;  2EIA A;  5EW5 E;  3G26 A;  1A43 A;  2KG9 A;  2VSQ A;  1AF8 A;  2PEJ A;  2WPT A;  1M6E X;  1Q86 Q;  2FQ1 A;  3NY7 B;  1UNK A;  3RG6 C;  1GXG A;  5HVC A;  2M8N A;  3I55 P;  1K73 Q;  2N98 A;  5JPA A;  2JQ4 A;  4XFZ A;  2EHT A;  4DG9 A;  2QNW A;  3DS0 A;  2AFD A;  1YIT P;  2N5H A;  1N8R Q;  4MRT C;  3H47 A;  1VQ6 P;  3G1I A;  3DS1 A;  1CEI A;  2KOS A;  2PEK A;  1VKU A;  3DS5 A;  1VQ7 P;  2Z46 A;  2ERH A;  2L6E A;  2XXM A;  3CCE P;  2FAD A;  2CGQ A;  3DS4 A;  3P05 A;  1AUM A;  1Q7Y Q;  2PEO A;  2K94 A;  2VLN A;  3CMA P;  1VHN A;  2ROQ A;  1X3O A;  2LIW A;  1M90 Q;  2FVE A;  3B5I A;  4M0I A;  2AF8 A;  4QNB A;  1QRJ A;  1AYI A;  4H2W C;  2K2Q A;  2MR8 A;  3H4E A;  5EJD A;  2M5R A;  1IMP A;  2MF4 A;  3CCJ P;  2M8L A;  3CC7 P;  2PY8 A;  1RO0 A;  1GPJ A;  2JYL A;  2JBG A;  3EJD A;  1ACP A;  2KGC A;  2CQ8 A;  2DNW A;  1MZ8 A;  2JGP A;  2FQ0 A;  2K0Y A;  1YHQ P;  3EJE A;  4WYM A;  4F37 A;  1DNY A;  2L4B A;  5HGL A;  1RNI A;  1VQ9 P;  2KGD A;  1NQ4 A;  1M1K Q;  2MD9 A;  1EOQ A;  2FVA A;  1VQ5 P;  4U0E A;  4NEO A;  3CME P;  3WBH A;  4BPF A;  5HGM A;  2PNG A;  2GZJ A;  4XRQ A;  2EHS A;  2FHS C;  1M6N A;  3M1M A;  2OTJ P;  5F2O A;  2FQ2 A;  2K92 A;  4H2Y C;  2N6Z A;  2KGA A;  1KC8 Q;  1L0I A;  7CEI A;  1VQ4 P;  3H0D A;  1YJN P;  2K5X A;  3LRY A;  2LIU A;  5BS2 A;  2N5I A;  1VQL P;  3GKL C;  3LMO A;  2Z44 A;  2GZI A;  1ZNV A;  1DV5 A;  4XRO A;  1BXI A;  5CZD B;  1Z6M A;  1S72 P;  3B4Q A;  2L9F A;  5HGN A;  1IUQ A;  2KOR A;  1KQS O;  1EMV A;  2NO8 A;  5I4T G;  3DS3 A;  3OW2 O;  4PXH B;  2ONT A;  4XFX A;  2JYG A;  1K8A Q;  3Q20 A;  2JU2 A;  3MGE A;  1GXH A;  2OTL P;  2KOP A;  2XV6 A;  3CCR P;  5KP8 B;  2JAZ A;  2XZ1 C;  2CG5 B;  2P9X A;  1VQN P;  5KP6 B;  3CXC O;  3CCS P;  2L0Q A;  3DS2 A;  5HGO A;  2DGY A;  1OR5 A;  2PEM A;  4PH0 A;  2EG5 A;  3CC4 P;  5KP7 B;  2LL8 A;  2LTE A;  4XFY A;  3CPW O;  2GZG A;  2X2B A;  2VLO A;  3NTE A;  4PWV B;  4IZ6 A;  4U0D A;  3CC2 P;  4GR2 A;  1EIA A;  2LOL A;  4H2X C;  3CCL P;  1RO2 A;  4COP A;  2JU1 A;  2VLP A;  1JJ2 O;  2LKI A;  1KLP A;  1E0H A;  2LPK A;  2MVV A;  2FVF A;  4U0B A;  3HZQ A;  2GDX A;  3CCV P;  2KG8 A;  4U0A A;  4GR6 A;  3GZM A;  1YJW P;  1IMQ A;  3G71 P;  4UHP B;  4QKO A;  3GZL A;  2N6Y A;  2QA4 P;  2BHV A;  2GZE A;  2GDY A;  2L22 A;  2KWL A;  3G21 A;  4U0F A;  2JO0 A;  2BUO A;  1FR2 A;  2K0D X;  1VQ8 P;  1BAJ A;  5F2K A;  4HKG A;  2LF4 A;  2VLQ A;  4R0M A;  3HYB A;  1UJZ A;  4U0C A;  3G4S P;  4COC A;  1QVF O;  1HY8 A;  3DTJ A;  1F80 D;  2KR5 A;  2KG6 A;  3GJN A;  2KOO A;  1ZMB A;  4IPY A;  3E2D A;  3U43 A;  2JB0 A;  2Z45 A;  5BS1 A;  1QVG O;  1VQM P;  2FAC A;  2CWO A;  3G6E P;  1D1D A;  4PH1 A;  3G28 A;  3EJB A;  2MVU A;  2PEI A;  5DCK A;  3G1G A;  2GZF A;  2GYK A;  4BPG A;  3CCQ P;  3VRL C;  2XZ0 D;  1HQB A;  3CCM P;  2LML A;  1M74 A;  2E1M A;  1VQK P;  5HV8 A;  1YIJ P;  1VQO P;  5F2N A;  4CA3 A;  1A8O A;  2XT1 A;  1YJ9 P;  1T8K A;  3RG2 A;  3CE7 A;  2KGE A;  1YI2 P;  4BPH A;  2MY5 A;  1KD1 Q;  1K9M Q;  1K30 A;  2EFJ A;  2FAE A;  1NJI Q;  2KOD A;  1VQP P;  1L0H A;  3CD6 P;  1W2B O;  3DPH A; 
#chains in the Genus database with same CATH homology
 2FAD A;  2CGQ A;  2LIU A;  2N5I A;  3GZL A;  2N6Y A;  2K94 A;  3LMO A;  2CNR A;  2GDY A;  1DV5 A;  2L22 A;  2KWL A;  2ROQ A;  5CZD B;  1X3O A;  2LIW A;  2AVA A;  2KOQ A;  2L9F A;  2FVE A;  2KOR A;  2KW2 A;  2AF8 A;  2AFE A;  2K93 A;  4HKG A;  2N50 A;  2K0X A;  2MR7 A;  4PXH B;  4H2W C;  2K2Q A;  2MR8 A;  2JU2 A;  4R0M A;  2GDW A;  5EJD A;  2M5R A;  1HY8 A;  2MF4 A;  1F80 D;  2KOP A;  2KG6 A;  2KR5 A;  2KG9 A;  2VSQ A;  2KOO A;  3EJD A;  1ACP A;  1AF8 A;  2KGC A;  2CQ8 A;  2DNW A;  5KP8 B;  2JGP A;  2FQ1 A;  2FQ0 A;  2XZ1 C;  2K0Y A;  2CG5 B;  5KP6 B;  3EJE A;  3NY7 B;  2FAC A;  1DNY A;  2L4B A;  2L0Q A;  5HVC A;  3EJB A;  2KGD A;  1NQ4 A;  2MVU A;  2MD9 A;  1OR5 A;  2N98 A;  5KP7 B;  2JQ4 A;  2LL8 A;  2LTE A;  2EHT A;  2FVA A;  4BPG A;  4DG9 A;  2XZ0 D;  4NEO A;  1HQB A;  2X2B A;  2LML A;  5HV8 A;  4PWV B;  4IZ6 A;  4CA3 A;  4BPF A;  2PNG A;  2LOL A;  2QNW A;  4H2X C;  2AFD A;  2EHS A;  2JU1 A;  2FHS C;  1KLP A;  2LKI A;  1T8K A;  2N5H A;  3RG2 A;  2FQ2 A;  2K92 A;  2LPK A;  2MVV A;  3CE7 A;  2KGE A;  4MRT C;  4H2Y C;  2FVF A;  2N6Z A;  2KGA A;  1L0I A;  4BPH A;  2MY5 A;  2GDX A;  2KOS A;  1VKU A;  2KG8 A;  2FAE A;  3GZM A;  1L0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...