2N5HA

Pltl-holo
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
90
structure length
90
Chain Sequence
MDGEEVKEKIRRYIMEDLIGPSAKEDELDDQTPLLEWGILNSMNIVKLMVYIRDEMGVSIPSTHITGKYFKDLNAISRTVEQLKAESALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl carrier protein PltL
publication title Structure and Substrate Sequestration in the Pyoluteorin Type II Peptidyl Carrier Protein PltL.
pubmed doi rcsb
source organism Pseudomonas protegens
molecule tags Transport protein
total genus 24
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2n5hA00
2MY5A 2FADA 2KW2A 1AF8A 2KORA 2MVUA 2JGPA 2FAEA 5HV8A 1VKUA 1ACPA 2CG5B 2MVVA 2KG6A 4BPFA 1L0HA 2LL8A 4MRTC 2MF4A 1DV5A 2QNWA 3NY7B 2X2BA 3CE7A 2JQ4A 1F80D 2KOOA 2LOLA 2L4BA 2KOQA 2EHSA 1HY8A 2KGDA 2LMLA 3EJEA 2JU2A 2N6ZA 4BPHA 4H2YC 4PWVB 2AFDA 2PNGA 4IZ6A 2MR8A 2K2QA 2FVAA 2LKIA 2KGCA 2LPKA 2K0YA 1OR5A 2FQ1A 2KG8A 1HQBA 1X3OA 2KR5A 3GZLA 2CQ8A 2CNRA 2GDWA 1NQ4A 2VSQA 3GZMA 1T8KA 2K92A 2DNWA 2FQ2A 2L9FA 4CA3A 3EJDA 4HKGA 2FVEA 2JU1A 1DNYA 5KP6B 2N50A 1KLPA 2KGEA 2ROQA 2XZ0D 1L0IA 4NEOA 4BPGA 2KGAA 3EJBA 4DG9A 2L22A 2LTEA 2EHTA 3RG2A 2AFEA 5EJDA 2FVFA 5HVCA 2N6YA 2KOPA 2GDYA 2K0XA 2LIUA 2KWLA 2N98A 2K94A 2XZ1C 2N5HA 2FACA 4R0MA 2CGQA 5KP8B 2FQ0A 2AF8A 2MR7A 2LIWA 2N5IA 2GDXA 4H2XC 2M5RA 2MD9A 4H2WC 2K93A 4PXHB 5CZDB 2KOSA 5KP7B 2AVAA 3LMOA 2FHSC 2L0QA 2KG9A
chains in the Genus database with same CATH superfamily
3RG6C 2BHVA 4QKOA 1VQPP 2JGPA 1UJZA 1VKUA 2MVVA 1BXIA 1ZMBA 3CCVP 4MRTC 3NY7B 1Q82Q 4WYMA 2VLOA 4COCA 1YJWP 1Z6MA 1F80D 2KOOA 3DTJA 5F2OA 1HY8A 1IMPA 2LMLA 1VQMP 1K8AQ 1EIAA 3CC4P 4BPHA 3H47A 2PNGA 2MR8A 2K2QA 3WBHA 1VQ9P 3G4SP 2FVAA 2LKIA 2Z46A 1X3OA 3E2DA 2GDWA 1NQ4A 3HZQA 2LF4A 4PH1A 3GZMA 1VQ5P 5JPAA 3DS5A 2JU1A 2N50A 2XZ0D 4NEOA 3CCLP 1VQOP 4U0AA 2EIAA 3DS0A 3GKLC 1YITP 2KGAA 2NO8A 2EHTA 3CCJP 2DGYA 5HVCA 5F2KA 4U0DA 4XFXA 2KOPA 2K94A 2Z45A 1S72P 2AF8A 2LIWA 2N5IA 4COPA 1K30A 2MD9A 4PXHB 2KOSA 5KP7B 4GR6A 3LMOA 2L0QA 4GR2A 2MY5A 1K73Q 2JYGA 4F37A 2KW2A 3H4EA 5HV8A 1RNIA 2GZIA 4XROA 2CG5B 1L0HA 3G1GA 2QNWA 1IUQA 2X2BA 1MZ8A 2L6EA 2ERHA 3CE7A 2K5XA 1W2BO 2L4BA 2KOQA 2EHSA 2PEIA 4XFZA 1M74A 2JU2A 3CPWO 2OARA 4PWVB 3G1IA 3B4QA 3I55P 1KQSO 1IMQA 3CD6P 2KGCA 4PH0A 3GZLA 1ZNVA 5BS2A 2DNWA 3CCQP 1NJIQ 3CXCO 2JBGA 2VLQA 3DS4A 3EJDA 2XV6A 2FVEA 4HKGA 4IPYA 2M8LA 1DNYA 1VQNP 7CEIA 2ROQA 1VHNA 5EW5E 1Q86Q 1YJNP 3EJBA 2L22A 2WPTA 3RG2A 5EJDA 3G0VA 2XXMA 3CMAP 4U0FA 2M8NA 2N5HA 2CGQA 5KP8B 2MR7A 1Q81Q 1E0HA 2VLNA 1K9MQ 4H2WC 2K93A 1QRJA 2FHSC 2JO0A 2PEOA 1EOQA 4U0EA 2KORA 5F2NA 1A43A 3CCEP 2QA4P 1CEIA 3CC2P 1M6NA 2XT1A 2GZEA 2PY8A 2KG6A 1D1DA 3CCUP 1A8OA 2MF4A 1DV5A 2PEJA 3Q20A 3CMEP 2PEQA 2JQ4A 1YIJP 3P05A 4U0BA 1GXGA 3HYBA 1E6JP 3EJEA 1QVGO 3M1MA 3G26A 1RO2A 3VRLC 1M90Q 4IZ6A 1VQ4P 2JAZA 5HGLA 3I56P 2PEMA 2CWOA 1OR5A 2FQ1A 3CC7P 2KG8A 2BUOA 2VSQA 3DS1A 2K0DX 2K92A 2FQ2A 2L9FA 1VQ8P 2EFJA 4CA3A 3CCRP 5KP6B 1KLPA 4UHPB 3G21A 1L0IA 3MGEA 2E1MA 2GYKA 4BPGA 1GPJA 2Z44A 4DG9A 2EG5A 1AUMA 5BS1A 3GJNA 2AFEA 2FVFA 1FR2A 2K0XA 2LIUA 2KWLA 2FACA 1QVFO 4R0MA 1YJ9P 4XFYA 4XRQA 2GDXA 4H2XC 2M5RA 2GZJA 5CZDB 2PENA 2OTLP 3LRYA 2KG9A 2FADA 1AF8A 3CCMP 1GXHA 2MVUA 3B5IA 4M0IA 2FAEA 2PEKA 1ACPA 1EMVA 4BPFA 1VQ6P 2ONTA 2LL8A 1YI2P 5HGMA 1UNKA 3G6EP 1VQKP 2LOLA 2KODA 1JJ2O 2KGDA 2GZFA 2N6ZA 1RO0A 1Q7YQ 5DCKA 4H2YC 2VLPA 2AFDA 1BAJA 1M1KQ 2K0YA 2LPKA 3OW2O 1N8RQ 1HQBA 2KR5A 3DPHA 2GZGA 2CQ8A 2CNRA 2M8PA 2QEXP 2OTJP 1T8KA 1VQLP 3G28A 2JB0A 3NTEA 2P9XA 2KGEA 1KC8Q 1KD1Q 2JYLA 5I4TG 3CCSP 5HGNA 5HGOA 2LTEA 3U43A 3G71P 1YHQP 2N6YA 2GDYA 2N98A 4U0CA 2XZ1C 3H0DA 1M6EX 2FQ0A 1AYIA 3DS3A 3G29A 2AVAA 4QNBA 3DS2A 1VQ7P
chains in the Genus database with same CATH topology
2MY5A 2FADA 2KW2A 1AF8A 2KORA 2MVUA 2JGPA 2FAEA 5HV8A 1VKUA 1ACPA 2CG5B 2MVVA 2KG6A 4BPFA 1L0HA 2LL8A 4MRTC 2MF4A 1DV5A 2QNWA 3NY7B 2X2BA 3CE7A 2JQ4A 1F80D 2KOOA 2LOLA 2L4BA 2KOQA 2EHSA 1HY8A 2KGDA 2LMLA 3EJEA 2JU2A 2N6ZA 4BPHA 4H2YC 4PWVB 2AFDA 2PNGA 4IZ6A 2MR8A 2K2QA 2FVAA 2LKIA 2KGCA 2LPKA 2K0YA 1OR5A 2FQ1A 2KG8A 1HQBA 1X3OA 2KR5A 3GZLA 2CQ8A 2CNRA 2GDWA 1NQ4A 2VSQA 3GZMA 1T8KA 2K92A 2DNWA 2FQ2A 2L9FA 4CA3A 3EJDA 4HKGA 2FVEA 2JU1A 1DNYA 5KP6B 2N50A 1KLPA 2KGEA 2ROQA 2XZ0D 1L0IA 4NEOA 4BPGA 2KGAA 3EJBA 4DG9A 2L22A 2LTEA 2EHTA 3RG2A 2AFEA 5EJDA 2FVFA 5HVCA 2N6YA 2KOPA 2GDYA 2K0XA 2LIUA 2KWLA 2N98A 2K94A 2XZ1C 2N5HA 2FACA 4R0MA 2CGQA 5KP8B 2FQ0A 2AF8A 2MR7A 2LIWA 2N5IA 2GDXA 4H2XC 2M5RA 2MD9A 4H2WC 2K93A 4PXHB 5CZDB 2KOSA 5KP7B 2AVAA 3LMOA 2FHSC 2L0QA 2KG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MY5 A;  2FAD A;  2KW2 A;  1AF8 A;  2KOR A;  2MVU A;  2JGP A;  2FAE A;  5HV8 A;  1VKU A;  1ACP A;  2CG5 B;  2MVV A;  2KG6 A;  4BPF A;  1L0H A;  2LL8 A;  4MRT C;  2MF4 A;  1DV5 A;  2QNW A;  3NY7 B;  2X2B A;  3CE7 A;  2JQ4 A;  1F80 D;  2KOO A;  2LOL A;  2L4B A;  2KOQ A;  2EHS A;  1HY8 A;  2KGD A;  2LML A;  3EJE A;  2JU2 A;  2N6Z A;  4BPH A;  4H2Y C;  4PWV B;  2AFD A;  2PNG A;  4IZ6 A;  2MR8 A;  2K2Q A;  2FVA A;  2LKI A;  2KGC A;  2LPK A;  2K0Y A;  1OR5 A;  2FQ1 A;  2KG8 A;  1HQB A;  1X3O A;  2KR5 A;  3GZL A;  2CQ8 A;  2CNR A;  2GDW A;  1NQ4 A;  2VSQ A;  3GZM A;  1T8K A;  2K92 A;  2DNW A;  2FQ2 A;  2L9F A;  4CA3 A;  3EJD A;  4HKG A;  2FVE A;  2JU1 A;  1DNY A;  5KP6 B;  2N50 A;  1KLP A;  2KGE A;  2ROQ A;  2XZ0 D;  1L0I A;  4NEO A;  4BPG A;  2KGA A;  3EJB A;  4DG9 A;  2L22 A;  2LTE A;  2EHT A;  3RG2 A;  2AFE A;  5EJD A;  2FVF A;  5HVC A;  2N6Y A;  2KOP A;  2GDY A;  2K0X A;  2LIU A;  2KWL A;  2N98 A;  2K94 A;  2XZ1 C;  2N5H A;  2FAC A;  4R0M A;  2CGQ A;  5KP8 B;  2FQ0 A;  2AF8 A;  2MR7 A;  2LIW A;  2N5I A;  2GDX A;  4H2X C;  2M5R A;  2MD9 A;  4H2W C;  2K93 A;  4PXH B;  5CZD B;  2KOS A;  5KP7 B;  2AVA A;  3LMO A;  2FHS C;  2L0Q A;  2KG9 A; 
#chains in the Genus database with same CATH topology
 3RG6 C;  2BHV A;  4QKO A;  1VQP P;  2JGP A;  1UJZ A;  1VKU A;  2MVV A;  1BXI A;  1ZMB A;  3CCV P;  4MRT C;  3NY7 B;  1Q82 Q;  4WYM A;  2VLO A;  4COC A;  1YJW P;  1Z6M A;  1F80 D;  2KOO A;  3DTJ A;  5F2O A;  1HY8 A;  1IMP A;  2LML A;  1VQM P;  1K8A Q;  1EIA A;  3CC4 P;  4BPH A;  3H47 A;  2PNG A;  2MR8 A;  2K2Q A;  3WBH A;  1VQ9 P;  3G4S P;  2FVA A;  2LKI A;  2Z46 A;  1X3O A;  3E2D A;  2GDW A;  1NQ4 A;  3HZQ A;  2LF4 A;  4PH1 A;  3GZM A;  1VQ5 P;  5JPA A;  3DS5 A;  2JU1 A;  2N50 A;  2XZ0 D;  4NEO A;  3CCL P;  1VQO P;  4U0A A;  2EIA A;  3DS0 A;  3GKL C;  1YIT P;  2KGA A;  2NO8 A;  2EHT A;  3CCJ P;  2DGY A;  5HVC A;  5F2K A;  4U0D A;  4XFX A;  2KOP A;  2K94 A;  2Z45 A;  1S72 P;  2AF8 A;  2LIW A;  2N5I A;  4COP A;  1K30 A;  2MD9 A;  4PXH B;  2KOS A;  5KP7 B;  4GR6 A;  3LMO A;  2L0Q A;  4GR2 A;  2MY5 A;  1K73 Q;  2JYG A;  4F37 A;  2KW2 A;  3H4E A;  5HV8 A;  1RNI A;  2GZI A;  4XRO A;  2CG5 B;  1L0H A;  3G1G A;  2QNW A;  1IUQ A;  2X2B A;  1MZ8 A;  2L6E A;  2ERH A;  3CE7 A;  2K5X A;  1W2B O;  2L4B A;  2KOQ A;  2EHS A;  2PEI A;  4XFZ A;  1M74 A;  2JU2 A;  3CPW O;  2OAR A;  4PWV B;  3G1I A;  3B4Q A;  3I55 P;  1KQS O;  1IMQ A;  3CD6 P;  2KGC A;  4PH0 A;  3GZL A;  1ZNV A;  5BS2 A;  2DNW A;  3CCQ P;  1NJI Q;  3CXC O;  2JBG A;  2VLQ A;  3DS4 A;  3EJD A;  2XV6 A;  2FVE A;  4HKG A;  4IPY A;  2M8L A;  1DNY A;  1VQN P;  7CEI A;  2ROQ A;  1VHN A;  5EW5 E;  1Q86 Q;  1YJN P;  3EJB A;  2L22 A;  2WPT A;  3RG2 A;  5EJD A;  3G0V A;  2XXM A;  3CMA P;  4U0F A;  2M8N A;  2N5H A;  2CGQ A;  5KP8 B;  2MR7 A;  1Q81 Q;  1E0H A;  2VLN A;  1K9M Q;  4H2W C;  2K93 A;  1QRJ A;  2FHS C;  2JO0 A;  2PEO A;  1EOQ A;  4U0E A;  2KOR A;  5F2N A;  1A43 A;  3CCE P;  2QA4 P;  1CEI A;  3CC2 P;  1M6N A;  2XT1 A;  2GZE A;  2PY8 A;  2KG6 A;  1D1D A;  3CCU P;  1A8O A;  2MF4 A;  1DV5 A;  2PEJ A;  3Q20 A;  3CME P;  2PEQ A;  2JQ4 A;  1YIJ P;  3P05 A;  4U0B A;  1GXG A;  3HYB A;  1E6J P;  3EJE A;  1QVG O;  3M1M A;  3G26 A;  1RO2 A;  3VRL C;  1M90 Q;  4IZ6 A;  1VQ4 P;  2JAZ A;  5HGL A;  3I56 P;  2PEM A;  2CWO A;  1OR5 A;  2FQ1 A;  3CC7 P;  2KG8 A;  2BUO A;  2VSQ A;  3DS1 A;  2K0D X;  2K92 A;  2FQ2 A;  2L9F A;  1VQ8 P;  2EFJ A;  4CA3 A;  3CCR P;  5KP6 B;  1KLP A;  4UHP B;  3G21 A;  1L0I A;  3MGE A;  2E1M A;  2GYK A;  4BPG A;  1GPJ A;  2Z44 A;  4DG9 A;  2EG5 A;  1AUM A;  5BS1 A;  3GJN A;  2AFE A;  2FVF A;  1FR2 A;  2K0X A;  2LIU A;  2KWL A;  2FAC A;  1QVF O;  4R0M A;  1YJ9 P;  4XFY A;  4XRQ A;  2GDX A;  4H2X C;  2M5R A;  2GZJ A;  5CZD B;  2PEN A;  2OTL P;  3LRY A;  2KG9 A;  2FAD A;  1AF8 A;  3CCM P;  1GXH A;  2MVU A;  3B5I A;  4M0I A;  2FAE A;  2PEK A;  1ACP A;  1EMV A;  4BPF A;  1VQ6 P;  2ONT A;  2LL8 A;  1YI2 P;  5HGM A;  1UNK A;  3G6E P;  1VQK P;  2LOL A;  2KOD A;  1JJ2 O;  2KGD A;  2GZF A;  2N6Z A;  1RO0 A;  1Q7Y Q;  5DCK A;  4H2Y C;  2VLP A;  2AFD A;  1BAJ A;  1M1K Q;  2K0Y A;  2LPK A;  3OW2 O;  1N8R Q;  1HQB A;  2KR5 A;  3DPH A;  2GZG A;  2CQ8 A;  2CNR A;  2M8P A;  2QEX P;  2OTJ P;  1T8K A;  1VQL P;  3G28 A;  2JB0 A;  3NTE A;  2P9X A;  2KGE A;  1KC8 Q;  1KD1 Q;  2JYL A;  5I4T G;  3CCS P;  5HGN A;  5HGO A;  2LTE A;  3U43 A;  3G71 P;  1YHQ P;  2N6Y A;  2GDY A;  2N98 A;  4U0C A;  2XZ1 C;  3H0D A;  1M6E X;  2FQ0 A;  1AYI A;  3DS3 A;  3G29 A;  2AVA A;  4QNB A;  3DS2 A;  1VQ7 P; 
#chains in the Genus database with same CATH homology
 2MY5 A;  2FAD A;  2KW2 A;  1AF8 A;  2KOR A;  2MVU A;  2JGP A;  2FAE A;  5HV8 A;  1VKU A;  1ACP A;  2CG5 B;  2MVV A;  2KG6 A;  4BPF A;  1L0H A;  2LL8 A;  4MRT C;  2MF4 A;  1DV5 A;  2QNW A;  3NY7 B;  2X2B A;  3CE7 A;  2JQ4 A;  1F80 D;  2KOO A;  2LOL A;  2L4B A;  2KOQ A;  2EHS A;  1HY8 A;  2KGD A;  2LML A;  3EJE A;  2JU2 A;  2N6Z A;  4BPH A;  4H2Y C;  4PWV B;  2AFD A;  2PNG A;  4IZ6 A;  2MR8 A;  2K2Q A;  2FVA A;  2LKI A;  2KGC A;  2LPK A;  2K0Y A;  1OR5 A;  2FQ1 A;  2KG8 A;  1HQB A;  1X3O A;  2KR5 A;  3GZL A;  2CQ8 A;  2CNR A;  2GDW A;  1NQ4 A;  2VSQ A;  3GZM A;  1T8K A;  2K92 A;  2DNW A;  2FQ2 A;  2L9F A;  4CA3 A;  3EJD A;  4HKG A;  2FVE A;  2JU1 A;  1DNY A;  5KP6 B;  2N50 A;  1KLP A;  2KGE A;  2ROQ A;  2XZ0 D;  1L0I A;  4NEO A;  4BPG A;  2KGA A;  3EJB A;  4DG9 A;  2L22 A;  2LTE A;  2EHT A;  3RG2 A;  2AFE A;  5EJD A;  2FVF A;  5HVC A;  2N6Y A;  2KOP A;  2GDY A;  2K0X A;  2LIU A;  2KWL A;  2N98 A;  2K94 A;  2XZ1 C;  2N5H A;  2FAC A;  4R0M A;  2CGQ A;  5KP8 B;  2FQ0 A;  2AF8 A;  2MR7 A;  2LIW A;  2N5I A;  2GDX A;  4H2X C;  2M5R A;  2MD9 A;  4H2W C;  2K93 A;  4PXH B;  5CZD B;  2KOS A;  5KP7 B;  2AVA A;  3LMO A;  2FHS C;  2L0Q A;  2KG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...