1UNKA

Structure of colicin e7 immunity protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E7
publication title A novel role of ImmE7 in the autoregulatory expression of the ColE7 operon and identification of possible RNase active sites in the crystal structure of dimeric ImmE7.
pubmed doi rcsb
molecule tags Immunity protein
total genus 28
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1996-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1unkA00
1AYIA 1BXIA 2K5XA 4F37A 1E0HA 4UHPB 2ERHA 2GZEA 2GZJA 1UJZA 2JBGA 2GZGA 3GJNA 2WPTA 1FR2A 2K0DX 1ZNVA 5EW5E 1GXGA 7CEIA 4QKOA 1UNKA 2VLOA 3U43A 2JAZA 1IMPA 2VLNA 3GKLC 1MZ8A 2GZIA 2VLQA 2VLPA 2JB0A 2NO8A 2GZFA 1IMQA 1CEIA 1EMVA 1GXHA 2GYKA
chains in the Genus database with same CATH superfamily
1YITP 5BS2A 4XRQA 2EHTA 2KORA 2LTEA 1A43A 1ZNVA 3HZQA 2N5HA 3G21A 2E1MA 1VQ6P 2AF8A 3CCUP 2MR8A 4U0DA 4COCA 2EFJA 2GZJA 2AFDA 2JBGA 2EG5A 1Q82Q 2K0DX 4MRTC 1YI2P 3G29A 1Q86Q 2N5IA 1K9MQ 4NEOA 1HQBA 1ZMBA 3G26A 3H47A 3CPWO 1RNIA 3RG2A 2VLNA 2VLQA 2PNGA 3G71P 2L0QA 4F37A 1VQLP 1YJNP 1X3OA 1N8RQ 2MVVA 3E2DA 2PEQA 3GZLA 3CCQP 4H2WC 3DS3A 3CCRP 1D1DA 2K0XA 3CCMP 3CCVP 1DNYA 1UNKA 2JYLA 2KGEA 2NO8A 2K92A 2QA4P 2Z44A 1M90Q 4XFZA 2LL8A 3G4SP 3P05A 2KWLA 2KGAA 4XFYA 3B5IA 1QVFO 2PEOA 3G6EP 2JYGA 2FVEA 5HVCA 2N6YA 1KD1Q 2QEXP 1RO0A 4GR2A 1VQKP 2FACA 3HYBA 1OR5A 1AUMA 2KOPA 2LMLA 4BPFA 2Z46A 2LIWA 3Q20A 3I55P 1IMPA 1MZ8A 2VLPA 1EMVA 3CD6P 2GYKA 2M8NA 1E0HA 2CGQA 2OTJP 1KQSO 2P9XA 2QNWA 1S72P 3OW2O 5HGNA 5DCKA 2VLOA 2JU2A 4H2YC 5BS1A 3CE7A 1RO2A 1VQOP 1YJWP 2GZIA 1VHNA 3EJEA 1K30A 5HGLA 2ROQA 2DNWA 1W2BO 2FVFA 2L6EA 3DS2A 1GXGA 3DPHA 2PENA 2EHSA 3I56P 5HV8A 1BXIA 4R0MA 2K5XA 4U0FA 1HY8A 2PEKA 2M8LA 3CC4P 3GZMA 3H0DA 2JU1A 4PH1A 2CG5B 4HKGA 4WYMA 5F2NA 2KG6A 4U0EA 1VQ9P 3DS0A 1AF8A 2FQ2A 1L0HA 2MVUA 3VRLC 2OTLP 1IUQA 3G1IA 3MGEA 2KG9A 4U0BA 2CWOA 2K94A 1EOQA 1L0IA 2MF4A 3U43A 1VKUA 1E6JP 4PWVB 1F80D 1CEIA 5HGOA 2XZ0D 4GR6A 4H2XC 2KGDA 3M1MA 2JO0A 1YIJP 1YJ9P 2MY5A 1JJ2O 4COPA 2X2BA 5F2OA 4CA3A 1VQNP 1DV5A 2MR7A 2CNRA 3CC2P 3CMEP 3GKLC 3CCJP 3CC7P 2FQ0A 2GDXA 3NTEA 1Q7YQ 1BAJA 1K73Q 3EJBA 1KLPA 2ERHA 2FHSC 1UJZA 3GJNA 2Z45A 2LOLA 4U0AA 3DS5A 2LF4A 2M5RA 5KP8B 2N50A 2AFEA 7CEIA 2KOSA 2XV6A 4XFXA 4IPYA 3LMOA 4PH0A 2N98A 3WBHA 1VQ8P 1K8AQ 2GDYA 1VQ4P 1M6NA 2BUOA 4M0IA 2AVAA 2XZ1C 3DS1A 2K0YA 1QVGO 1KC8Q 1NQ4A 1Z6MA 1VQPP 4XROA 2DGYA 5KP7B 3B4QA 1T8KA 1NJIQ 2GZFA 4UHPB 4BPHA 1QRJA 3DTJA 3NY7B 2XT1A 1VQ7P 4U0CA 3CMAP 5CZDB 2WPTA 2FADA 3H4EA 1M74A 2KGCA 2EIAA 5JPAA 3CCSP 4BPGA 2PY8A 2OARA 4PXHB 2GDWA 3RG6C 1YHQP 1IMQA 2K93A 2LIUA 2BHVA 1A8OA 3CCLP 4IZ6A 2ONTA 2LPKA 1GPJA 2MD9A 2PEJA 2FAEA 3CXCO 3G0VA 1ACPA 4QKOA 2N6ZA 1VQ5P 1GXHA 2FQ1A 3DS4A 1AYIA 1VQMP 2XXMA 2PEMA 2KG8A 1M1KQ 2KODA 1FR2A 3G28A 1Q81Q 2VSQA 5EW5E 2JQ4A 1M6EX 2LKIA 3CCEP 3LRYA 5KP6B 4DG9A 3EJDA 5I4TG 2JB0A 2KR5A 2JGPA 2KOQA 3G1GA 2GZEA 5HGMA 2FVAA 2GZGA 2KW2A 2CQ8A 1EIAA 2L9FA 4QNBA 5EJDA 2M8PA 2L4BA 2L22A 2K2QA 2JAZA 2PEIA 2KOOA 5F2KA
chains in the Genus database with same CATH topology
1AYIA 1BXIA 2K5XA 4F37A 1E0HA 4UHPB 2ERHA 2GZEA 2GZJA 1UJZA 2JBGA 2GZGA 3GJNA 2WPTA 1FR2A 2K0DX 1ZNVA 5EW5E 1GXGA 7CEIA 4QKOA 1UNKA 2VLOA 3U43A 2JAZA 1IMPA 2VLNA 3GKLC 1MZ8A 2GZIA 2VLQA 2VLPA 2JB0A 2NO8A 2GZFA 1IMQA 1CEIA 1EMVA 1GXHA 2GYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYI A;  1BXI A;  2K5X A;  4F37 A;  1E0H A;  4UHP B;  2ERH A;  2GZE A;  2GZJ A;  1UJZ A;  2JBG A;  2GZG A;  3GJN A;  2WPT A;  1FR2 A;  2K0D X;  1ZNV A;  5EW5 E;  1GXG A;  7CEI A;  4QKO A;  1UNK A;  2VLO A;  3U43 A;  2JAZ A;  1IMP A;  2VLN A;  3GKL C;  1MZ8 A;  2GZI A;  2VLQ A;  2VLP A;  2JB0 A;  2NO8 A;  2GZF A;  1IMQ A;  1CEI A;  1EMV A;  1GXH A;  2GYK A; 
#chains in the Genus database with same CATH topology
 1YIT P;  5BS2 A;  4XRQ A;  2EHT A;  2KOR A;  2LTE A;  1A43 A;  1ZNV A;  3HZQ A;  2N5H A;  3G21 A;  2E1M A;  1VQ6 P;  2AF8 A;  3CCU P;  2MR8 A;  4U0D A;  4COC A;  2EFJ A;  2GZJ A;  2AFD A;  2JBG A;  2EG5 A;  1Q82 Q;  2K0D X;  4MRT C;  1YI2 P;  3G29 A;  1Q86 Q;  2N5I A;  1K9M Q;  4NEO A;  1HQB A;  1ZMB A;  3G26 A;  3H47 A;  3CPW O;  1RNI A;  3RG2 A;  2VLN A;  2VLQ A;  2PNG A;  3G71 P;  2L0Q A;  4F37 A;  1VQL P;  1YJN P;  1X3O A;  1N8R Q;  2MVV A;  3E2D A;  2PEQ A;  3GZL A;  3CCQ P;  4H2W C;  3DS3 A;  3CCR P;  1D1D A;  2K0X A;  3CCM P;  3CCV P;  1DNY A;  1UNK A;  2JYL A;  2KGE A;  2NO8 A;  2K92 A;  2QA4 P;  2Z44 A;  1M90 Q;  4XFZ A;  2LL8 A;  3G4S P;  3P05 A;  2KWL A;  2KGA A;  4XFY A;  3B5I A;  1QVF O;  2PEO A;  3G6E P;  2JYG A;  2FVE A;  5HVC A;  2N6Y A;  1KD1 Q;  2QEX P;  1RO0 A;  4GR2 A;  1VQK P;  2FAC A;  3HYB A;  1OR5 A;  1AUM A;  2KOP A;  2LML A;  4BPF A;  2Z46 A;  2LIW A;  3Q20 A;  3I55 P;  1IMP A;  1MZ8 A;  2VLP A;  1EMV A;  3CD6 P;  2GYK A;  2M8N A;  1E0H A;  2CGQ A;  2OTJ P;  1KQS O;  2P9X A;  2QNW A;  1S72 P;  3OW2 O;  5HGN A;  5DCK A;  2VLO A;  2JU2 A;  4H2Y C;  5BS1 A;  3CE7 A;  1RO2 A;  1VQO P;  1YJW P;  2GZI A;  1VHN A;  3EJE A;  1K30 A;  5HGL A;  2ROQ A;  2DNW A;  1W2B O;  2FVF A;  2L6E A;  3DS2 A;  1GXG A;  3DPH A;  2PEN A;  2EHS A;  3I56 P;  5HV8 A;  1BXI A;  4R0M A;  2K5X A;  4U0F A;  1HY8 A;  2PEK A;  2M8L A;  3CC4 P;  3GZM A;  3H0D A;  2JU1 A;  4PH1 A;  2CG5 B;  4HKG A;  4WYM A;  5F2N A;  2KG6 A;  4U0E A;  1VQ9 P;  3DS0 A;  1AF8 A;  2FQ2 A;  1L0H A;  2MVU A;  3VRL C;  2OTL P;  1IUQ A;  3G1I A;  3MGE A;  2KG9 A;  4U0B A;  2CWO A;  2K94 A;  1EOQ A;  1L0I A;  2MF4 A;  3U43 A;  1VKU A;  1E6J P;  4PWV B;  1F80 D;  1CEI A;  5HGO A;  2XZ0 D;  4GR6 A;  4H2X C;  2KGD A;  3M1M A;  2JO0 A;  1YIJ P;  1YJ9 P;  2MY5 A;  1JJ2 O;  4COP A;  2X2B A;  5F2O A;  4CA3 A;  1VQN P;  1DV5 A;  2MR7 A;  2CNR A;  3CC2 P;  3CME P;  3GKL C;  3CCJ P;  3CC7 P;  2FQ0 A;  2GDX A;  3NTE A;  1Q7Y Q;  1BAJ A;  1K73 Q;  3EJB A;  1KLP A;  2ERH A;  2FHS C;  1UJZ A;  3GJN A;  2Z45 A;  2LOL A;  4U0A A;  3DS5 A;  2LF4 A;  2M5R A;  5KP8 B;  2N50 A;  2AFE A;  7CEI A;  2KOS A;  2XV6 A;  4XFX A;  4IPY A;  3LMO A;  4PH0 A;  2N98 A;  3WBH A;  1VQ8 P;  1K8A Q;  2GDY A;  1VQ4 P;  1M6N A;  2BUO A;  4M0I A;  2AVA A;  2XZ1 C;  3DS1 A;  2K0Y A;  1QVG O;  1KC8 Q;  1NQ4 A;  1Z6M A;  1VQP P;  4XRO A;  2DGY A;  5KP7 B;  3B4Q A;  1T8K A;  1NJI Q;  2GZF A;  4UHP B;  4BPH A;  1QRJ A;  3DTJ A;  3NY7 B;  2XT1 A;  1VQ7 P;  4U0C A;  3CMA P;  5CZD B;  2WPT A;  2FAD A;  3H4E A;  1M74 A;  2KGC A;  2EIA A;  5JPA A;  3CCS P;  4BPG A;  2PY8 A;  2OAR A;  4PXH B;  2GDW A;  3RG6 C;  1YHQ P;  1IMQ A;  2K93 A;  2LIU A;  2BHV A;  1A8O A;  3CCL P;  4IZ6 A;  2ONT A;  2LPK A;  1GPJ A;  2MD9 A;  2PEJ A;  2FAE A;  3CXC O;  3G0V A;  1ACP A;  4QKO A;  2N6Z A;  1VQ5 P;  1GXH A;  2FQ1 A;  3DS4 A;  1AYI A;  1VQM P;  2XXM A;  2PEM A;  2KG8 A;  1M1K Q;  2KOD A;  1FR2 A;  3G28 A;  1Q81 Q;  2VSQ A;  5EW5 E;  2JQ4 A;  1M6E X;  2LKI A;  3CCE P;  3LRY A;  5KP6 B;  4DG9 A;  3EJD A;  5I4T G;  2JB0 A;  2KR5 A;  2JGP A;  2KOQ A;  3G1G A;  2GZE A;  5HGM A;  2FVA A;  2GZG A;  2KW2 A;  2CQ8 A;  1EIA A;  2L9F A;  4QNB A;  5EJD A;  2M8P A;  2L4B A;  2L22 A;  2K2Q A;  2JAZ A;  2PEI A;  2KOO A;  5F2K A; 
#chains in the Genus database with same CATH homology
 1AYI A;  1BXI A;  2K5X A;  4F37 A;  1E0H A;  4UHP B;  2ERH A;  2GZE A;  2GZJ A;  1UJZ A;  2JBG A;  2GZG A;  3GJN A;  2WPT A;  1FR2 A;  2K0D X;  1ZNV A;  5EW5 E;  1GXG A;  7CEI A;  4QKO A;  1UNK A;  2VLO A;  3U43 A;  2JAZ A;  1IMP A;  2VLN A;  3GKL C;  1MZ8 A;  2GZI A;  2VLQ A;  2VLP A;  2JB0 A;  2NO8 A;  2GZF A;  1IMQ A;  1CEI A;  1EMV A;  1GXH A;  2GYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...