1UNKA

Structure of colicin e7 immunity protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunity protein
molecule keywords COLICIN E7
publication title A novel role of ImmE7 in the autoregulatory expression of the ColE7 operon and identification of possible RNase active sites in the crystal structure of dimeric ImmE7.
pubmed doi rcsb
total genus 28
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1996-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1unkA00
2GZFA 4QKOA 1IMPA 5EW5E 1UJZA 3GKLC 4UHPB 2JAZA 1CEIA 1ZNVA 2K5XA 2GZEA 3GJNA 1GXHA 2K0DX 1FR2A 2GZIA 2VLPA 4F37A 2JB0A 1MZ8A 2GZGA 7CEIA 1IMQA 1AYIA 2NO8A 2VLOA 3U43A 2JBGA 2VLQA 2VLNA 1BXIA 1E0HA 1UNKA 2WPTA 1GXGA 2ERHA 2GYKA 2GZJA 1EMVA
chains in the Genus database with same CATH superfamily
2K0XA 1M6NA 2Z45A 3Q20A 2KOSA 3CCSP 1A43A 2KGCA 2KOPA 2XXMA 1M74A 4F37A 4PWVB 2FVFA 2JQ4A 2VLQA 1BXIA 2K94A 4HKGA 2EFJA 3CE7A 3RG2A 1IMPA 3DS2A 2AF8A 1YJ9P 5EJDA 2LL8A 3B5IA 2MY5A 2PEKA 3EJEA 2FADA 1IMQA 2NO8A 2XV6A 1A8OA 5KP8B 2VLOA 3G1GA 2AFDA 1E0HA 4WYMA 1L0IA 2KGDA 7CEIA 2AFEA 2L6EA 1X3OA 3CC4P 5EW5E 2KGEA 2LMLA 3CCMP 3HYBA 2LIWA 2PEQA 3DS3A 3WBHA 3GZLA 3G71P 2CWOA 1MZ8A 1KQSO 2PY8A 3CCUP 2K92A 2EG5A 2KWLA 1ZMBA 4XFXA 4R0MA 2N50A 1OR5A 3GKLC 2LOLA 2L22A 1FR2A 3CXCO 3CCQP 1VQOP 2M8NA 1VQKP 3H4EA 2DNWA 3G0VA 1AUMA 2MR8A 1K9MQ 2PEJA 4GR2A 1UJZA 2ONTA 1HQBA 3OW2O 2GDWA 2KODA 5BS1A 2MD9A 1VHNA 3DS5A 2FQ2A 1RNIA 2Z46A 2QNWA 2N5IA 5I4TG 1K30A 2KG6A 2FACA 1UNKA 2KW2A 2M5RA 2GYKA 3G28A 5KP6B 3G29A 4H2YC 1KD1Q 4BPFA 2FVAA 1KC8Q 4PXHB 3DS1A 1VKUA 2FVEA 2EIAA 2N5HA 2GZEA 3GJNA 1F80D 1GPJA 1RO0A 3DTJA 4QNBA 1Q86Q 2EHTA 3RG6C 2MVVA 2PEOA 2Z44A 2L4BA 4BPHA 3H0DA 2ERHA 3VRLC 1EMVA 2BUOA 2M8PA 2AVAA 2XZ1C 2K0DX 4GR6A 3CD6P 3CCEP 5F2OA 1YJWP 1AYIA 3CC7P 2MF4A 2XZ0D 3LMOA 2JO0A 2VSQA 5BS2A 2L0QA 4XRQA 1ZNVA 3H47A 3CC2P 1E6JP 3G6EP 2N6YA 4H2XC 2M8LA 4CA3A 2L9FA 4IPYA 2OTLP 3I56P 4U0DA 1VQ5P 1YI2P 2PEMA 1D1DA 1YHQP 2CQ8A 2OTJP 2E1MA 1DNYA 2LIUA 2KG8A 2JB0A 3GZMA 2LPKA 1VQ8P 1NQ4A 1GXGA 1Q7YQ 2EHSA 1VQ7P 4QKOA 1KLPA 1HY8A 4U0EA 3M1MA 4BPGA 2N98A 3DS0A 1N8RQ 2JYGA 5HGLA 2LKIA 5HGMA 3NY7B 2ROQA 2GZGA 2MVUA 1QVGO 2CG5B 4XFYA 1L0HA 2DGYA 2CNRA 1YIJP 1EIAA 4PH0A 3G21A 1YJNP 1VQ6P 2PENA 3G4SP 1YITP 3EJDA 2JU1A 2MR7A 1VQMP 1S72P 1T8KA 1AF8A 1GXHA 5DCKA 4DG9A 4U0BA 1M6EX 2LTEA 4NEOA 4U0FA 2K0YA 3CCRP 1M90Q 1VQ4P 2QA4P 1Q81Q 2FHSC 2GZFA 5JPAA 3G26A 1DV5A 2KOOA 1K8AQ 2BHVA 1QVFO 1JJ2O 5HGOA 2OARA 3U43A 2JBGA 2N6ZA 5KP7B 2WPTA 4XROA 4IZ6A 3CPWO 3I55P 2PNGA 3DS4A 1VQNP 3CMEP 1CEIA 4U0AA 2JGPA 2KOQA 2FQ1A 2GDXA 1BAJA 5F2KA 4PH1A 4U0CA 5HVCA 2LF4A 2XT1A 3E2DA 4XFZA 3MGEA 4UHPB 2JAZA 4COCA 2K5XA 1Z6MA 2K93A 3CCLP 3P05A 4COPA 2X2BA 3LRYA 1W2BO 2P9XA 1Q82Q 3CCVP 2JU2A 1VQ9P 3HZQA 3B4QA 3DPHA 2KG9A 2FAEA 4MRTC 4H2WC 2GDYA 1VQLP 2PEIA 1QRJA 2GZIA 3NTEA 3G1IA 4M0IA 2KGAA 1M1KQ 1RO2A 2VLNA 3CMAP 5F2NA 2CGQA 5CZDB 1K73Q 1EOQA 5HGNA 2K2QA 1IUQA 3EJBA 2KR5A 3CCJP 2VLPA 1NJIQ 2JYLA 2QEXP 2KORA 1ACPA 1VQPP 5HV8A 2FQ0A 2GZJA
chains in the Genus database with same CATH topology
2GZFA 4QKOA 1IMPA 5EW5E 1UJZA 3GKLC 4UHPB 2JAZA 1CEIA 1ZNVA 2K5XA 2GZEA 3GJNA 1GXHA 2K0DX 1FR2A 2GZIA 2VLPA 4F37A 2JB0A 1MZ8A 2GZGA 7CEIA 1IMQA 1AYIA 2NO8A 2VLOA 3U43A 2JBGA 2VLQA 2VLNA 1BXIA 1E0HA 1UNKA 2WPTA 1GXGA 2ERHA 2GYKA 2GZJA 1EMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZF A;  4QKO A;  1IMP A;  5EW5 E;  1UJZ A;  3GKL C;  4UHP B;  2JAZ A;  1CEI A;  1ZNV A;  2K5X A;  2GZE A;  3GJN A;  1GXH A;  2K0D X;  1FR2 A;  2GZI A;  2VLP A;  4F37 A;  2JB0 A;  1MZ8 A;  2GZG A;  7CEI A;  1IMQ A;  1AYI A;  2NO8 A;  2VLO A;  3U43 A;  2JBG A;  2VLQ A;  2VLN A;  1BXI A;  1E0H A;  1UNK A;  2WPT A;  1GXG A;  2ERH A;  2GYK A;  2GZJ A;  1EMV A; 
#chains in the Genus database with same CATH topology
 2K0X A;  1M6N A;  2Z45 A;  3Q20 A;  2KOS A;  3CCS P;  1A43 A;  2KGC A;  2KOP A;  2XXM A;  1M74 A;  4F37 A;  4PWV B;  2FVF A;  2JQ4 A;  2VLQ A;  1BXI A;  2K94 A;  4HKG A;  2EFJ A;  3CE7 A;  3RG2 A;  1IMP A;  3DS2 A;  2AF8 A;  1YJ9 P;  5EJD A;  2LL8 A;  3B5I A;  2MY5 A;  2PEK A;  3EJE A;  2FAD A;  1IMQ A;  2NO8 A;  2XV6 A;  1A8O A;  5KP8 B;  2VLO A;  3G1G A;  2AFD A;  1E0H A;  4WYM A;  1L0I A;  2KGD A;  7CEI A;  2AFE A;  2L6E A;  1X3O A;  3CC4 P;  5EW5 E;  2KGE A;  2LML A;  3CCM P;  3HYB A;  2LIW A;  2PEQ A;  3DS3 A;  3WBH A;  3GZL A;  3G71 P;  2CWO A;  1MZ8 A;  1KQS O;  2PY8 A;  3CCU P;  2K92 A;  2EG5 A;  2KWL A;  1ZMB A;  4XFX A;  4R0M A;  2N50 A;  1OR5 A;  3GKL C;  2LOL A;  2L22 A;  1FR2 A;  3CXC O;  3CCQ P;  1VQO P;  2M8N A;  1VQK P;  3H4E A;  2DNW A;  3G0V A;  1AUM A;  2MR8 A;  1K9M Q;  2PEJ A;  4GR2 A;  1UJZ A;  2ONT A;  1HQB A;  3OW2 O;  2GDW A;  2KOD A;  5BS1 A;  2MD9 A;  1VHN A;  3DS5 A;  2FQ2 A;  1RNI A;  2Z46 A;  2QNW A;  2N5I A;  5I4T G;  1K30 A;  2KG6 A;  2FAC A;  1UNK A;  2KW2 A;  2M5R A;  2GYK A;  3G28 A;  5KP6 B;  3G29 A;  4H2Y C;  1KD1 Q;  4BPF A;  2FVA A;  1KC8 Q;  4PXH B;  3DS1 A;  1VKU A;  2FVE A;  2EIA A;  2N5H A;  2GZE A;  3GJN A;  1F80 D;  1GPJ A;  1RO0 A;  3DTJ A;  4QNB A;  1Q86 Q;  2EHT A;  3RG6 C;  2MVV A;  2PEO A;  2Z44 A;  2L4B A;  4BPH A;  3H0D A;  2ERH A;  3VRL C;  1EMV A;  2BUO A;  2M8P A;  2AVA A;  2XZ1 C;  2K0D X;  4GR6 A;  3CD6 P;  3CCE P;  5F2O A;  1YJW P;  1AYI A;  3CC7 P;  2MF4 A;  2XZ0 D;  3LMO A;  2JO0 A;  2VSQ A;  5BS2 A;  2L0Q A;  4XRQ A;  1ZNV A;  3H47 A;  3CC2 P;  1E6J P;  3G6E P;  2N6Y A;  4H2X C;  2M8L A;  4CA3 A;  2L9F A;  4IPY A;  2OTL P;  3I56 P;  4U0D A;  1VQ5 P;  1YI2 P;  2PEM A;  1D1D A;  1YHQ P;  2CQ8 A;  2OTJ P;  2E1M A;  1DNY A;  2LIU A;  2KG8 A;  2JB0 A;  3GZM A;  2LPK A;  1VQ8 P;  1NQ4 A;  1GXG A;  1Q7Y Q;  2EHS A;  1VQ7 P;  4QKO A;  1KLP A;  1HY8 A;  4U0E A;  3M1M A;  4BPG A;  2N98 A;  3DS0 A;  1N8R Q;  2JYG A;  5HGL A;  2LKI A;  5HGM A;  3NY7 B;  2ROQ A;  2GZG A;  2MVU A;  1QVG O;  2CG5 B;  4XFY A;  1L0H A;  2DGY A;  2CNR A;  1YIJ P;  1EIA A;  4PH0 A;  3G21 A;  1YJN P;  1VQ6 P;  2PEN A;  3G4S P;  1YIT P;  3EJD A;  2JU1 A;  2MR7 A;  1VQM P;  1S72 P;  1T8K A;  1AF8 A;  1GXH A;  5DCK A;  4DG9 A;  4U0B A;  1M6E X;  2LTE A;  4NEO A;  4U0F A;  2K0Y A;  3CCR P;  1M90 Q;  1VQ4 P;  2QA4 P;  1Q81 Q;  2FHS C;  2GZF A;  5JPA A;  3G26 A;  1DV5 A;  2KOO A;  1K8A Q;  2BHV A;  1QVF O;  1JJ2 O;  5HGO A;  2OAR A;  3U43 A;  2JBG A;  2N6Z A;  5KP7 B;  2WPT A;  4XRO A;  4IZ6 A;  3CPW O;  3I55 P;  2PNG A;  3DS4 A;  1VQN P;  3CME P;  1CEI A;  4U0A A;  2JGP A;  2KOQ A;  2FQ1 A;  2GDX A;  1BAJ A;  5F2K A;  4PH1 A;  4U0C A;  5HVC A;  2LF4 A;  2XT1 A;  3E2D A;  4XFZ A;  3MGE A;  4UHP B;  2JAZ A;  4COC A;  2K5X A;  1Z6M A;  2K93 A;  3CCL P;  3P05 A;  4COP A;  2X2B A;  3LRY A;  1W2B O;  2P9X A;  1Q82 Q;  3CCV P;  2JU2 A;  1VQ9 P;  3HZQ A;  3B4Q A;  3DPH A;  2KG9 A;  2FAE A;  4MRT C;  4H2W C;  2GDY A;  1VQL P;  2PEI A;  1QRJ A;  2GZI A;  3NTE A;  3G1I A;  4M0I A;  2KGA A;  1M1K Q;  1RO2 A;  2VLN A;  3CMA P;  5F2N A;  2CGQ A;  5CZD B;  1K73 Q;  1EOQ A;  5HGN A;  2K2Q A;  1IUQ A;  3EJB A;  2KR5 A;  3CCJ P;  2VLP A;  1NJI Q;  2JYL A;  2QEX P;  2KOR A;  1ACP A;  1VQP P;  5HV8 A;  2FQ0 A;  2GZJ A; 
#chains in the Genus database with same CATH homology
 2GZF A;  4QKO A;  1IMP A;  5EW5 E;  1UJZ A;  3GKL C;  4UHP B;  2JAZ A;  1CEI A;  1ZNV A;  2K5X A;  2GZE A;  3GJN A;  1GXH A;  2K0D X;  1FR2 A;  2GZI A;  2VLP A;  4F37 A;  2JB0 A;  1MZ8 A;  2GZG A;  7CEI A;  1IMQ A;  1AYI A;  2NO8 A;  2VLO A;  3U43 A;  2JBG A;  2VLQ A;  2VLN A;  1BXI A;  1E0H A;  1UNK A;  2WPT A;  1GXG A;  2ERH A;  2GYK A;  2GZJ A;  1EMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...