1UNKA

Structure of colicin e7 immunity protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
87
structure length
87
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E7
publication title A novel role of ImmE7 in the autoregulatory expression of the ColE7 operon and identification of possible RNase active sites in the crystal structure of dimeric ImmE7.
pubmed doi rcsb
molecule tags Immunity protein
total genus 28
structure length 87
sequence length 87
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1996-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1unkA00
1BXIA 1GXGA 3GKLC 2VLNA 2K5XA 1FR2A 2GZIA 1MZ8A 1AYIA 4UHPB 1UJZA 1GXHA 1EMVA 2GZJA 1IMQA 2GZFA 2K0DX 2JAZA 4QKOA 5EW5E 2VLQA 4F37A 1CEIA 2GZEA 2VLOA 2WPTA 3U43A 2NO8A 2VLPA 3GJNA 2GYKA 1UNKA 2JB0A 2JBGA 2ERHA 1E0HA 1ZNVA 7CEIA 2GZGA 1IMPA
chains in the Genus database with same CATH superfamily
2MR7A 2MVVA 4COCA 1KLPA 3LRYA 4U0AA 1M6NA 2OTJP 5BS2A 1VQ6P 2FQ0A 2L22A 2MVUA 2AFDA 1RO2A 3GZMA 5KP6B 3DS4A 2LIWA 2JB0A 2N6YA 3G21A 1YI2P 4H2YC 2Z46A 2K0XA 2X2BA 2MF4A 3G29A 4BPHA 3CCMP 2AF8A 2FADA 1VQNP 1DV5A 4QKOA 1VQOP 1VHNA 2JYLA 3H0DA 3NTEA 2KOPA 5KP7B 2L4BA 1ZNVA 3VRLC 4XFYA 3CXCO 5F2NA 2K5XA 2N5IA 5I4TG 3G1IA 2KG6A 1EMVA 4QNBA 2PEQA 2JO0A 1AUMA 3HYBA 2L9FA 5JPAA 2EHTA 3P05A 1DNYA 4GR6A 2JU2A 1M1KQ 3MGEA 2PENA 2CGQA 3G71P 2BHVA 4WYMA 3GKLC 1NJIQ 2LTEA 1YHQP 2GDYA 2FHSC 2KGCA 2LMLA 2FVFA 1RO0A 1QVGO 1K8AQ 3CCSP 1Q86Q 2AFEA 2MD9A 2PEOA 1VQ9P 2KR5A 3DS1A 2JGPA 5HGNA 4UHPB 1KD1Q 2KGAA 2FAEA 3G0VA 3WBHA 2N6ZA 2GYKA 2DGYA 4PH0A 4BPFA 3E2DA 4XFXA 4CA3A 1ACPA 2N50A 3NY7B 1VQ4P 1BXIA 1AF8A 3CPWO 2EIAA 2Z45A 1N8RQ 3CC4P 1K9MQ 4U0EA 3CCRP 2FQ1A 2KG8A 3G26A 1E6JP 1VQ7P 5CZDB 2EG5A 3H47A 2KOOA 4R0MA 2CQ8A 2MR8A 3DTJA 2FQ2A 5HV8A 1IMQA 3CCVP 4DG9A 2OTLP 2XZ0D 3CCJP 2K93A 4HKGA 1K73Q 1HQBA 4XRQA 1RNIA 2P9XA 1JJ2O 2ONTA 2PNGA 1GXGA 3DS2A 5BS1A 2K92A 1VQ8P 1GXHA 2QA4P 4PXHB 3G1GA 3OW2O 2EFJA 2WPTA 2VLPA 4H2XC 2VSQA 1Q81Q 3CCQP 2JYGA 1A43A 2KW2A 4XFZA 2LPKA 3M1MA 4BPGA 5F2KA 2DNWA 2N5HA 2XT1A 1D1DA 1FR2A 1GPJA 3CD6P 1AYIA 3G28A 2GZJA 2CWOA 5EW5E 2VLQA 4F37A 2ROQA 1CEIA 3GJNA 1VQ5P 3DS5A 1HY8A 2ERHA 2LOLA 1OR5A 3HZQA 3CC2P 4XROA 3CMEP 2XZ1C 2PEMA 1M90Q 4U0CA 1NQ4A 1EOQA 2PY8A 2NO8A 2K94A 4U0FA 2K0YA 2GDWA 4IZ6A 2FACA 1YJ9P 2PEIA 3RG2A 2FVEA 1UJZA 3CCUP 2K0DX 2JAZA 5HGMA 2BUOA 4H2WC 1K30A 2AVAA 3DS3A 2M8LA 2KGEA 2PEKA 2LL8A 1L0IA 2KORA 3Q20A 2CG5B 2GZIA 2KWLA 1F80D 4NEOA 4U0DA 2GDXA 1QRJA 1M74A 3H4EA 1UNKA 5HVCA 2JBGA 3RG6C 1E0HA 2XV6A 4COPA 4PWVB 3B4QA 1YITP 2LF4A 1BAJA 1QVFO 1W2BO 1L0HA 2GZFA 3EJBA 1YJWP 1Q7YQ 2M8NA 2CNRA 1Z6MA 3LMOA 4PH1A 3I55P 3GZLA 5DCKA 2N98A 2FVAA 2L6EA 1S72P 2PEJA 1Q82Q 2M8PA 2E1MA 2GZEA 2XXMA 1VQKP 1IUQA 3B5IA 3CMAP 2LKIA 1ZMBA 3I56P 2L0QA 4U0BA 7CEIA 2GZGA 3CCLP 2EHSA 1IMPA 1VQMP 3CCEP 2QNWA 2QEXP 2JQ4A 1A8OA 1MZ8A 1KC8Q 1VKUA 2KGDA 1T8KA 3DS0A 3G4SP 4IPYA 5F2OA 5KP8B 3EJDA 1YIJP 3CC7P 4MRTC 4GR2A 2JU1A 3EJEA 2KOSA 1X3OA 2VLNA 2K2QA 2MY5A 2KG9A 1M6EX 1VQPP 3CE7A 3DPHA 2VLOA 3U43A 1VQLP 2OARA 3G6EP 5HGLA 1KQSO 4M0IA 2LIUA 2KOQA 2KODA 2Z44A 2M5RA 1EIAA 5EJDA 1YJNP 5HGOA
chains in the Genus database with same CATH topology
1BXIA 1GXGA 3GKLC 2VLNA 2K5XA 1FR2A 2GZIA 1MZ8A 1AYIA 4UHPB 1UJZA 1GXHA 1EMVA 2GZJA 1IMQA 2GZFA 2K0DX 2JAZA 4QKOA 5EW5E 2VLQA 4F37A 1CEIA 2GZEA 2VLOA 2WPTA 3U43A 2NO8A 2VLPA 3GJNA 2GYKA 1UNKA 2JB0A 2JBGA 2ERHA 1E0HA 1ZNVA 7CEIA 2GZGA 1IMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BXI A;  1GXG A;  3GKL C;  2VLN A;  2K5X A;  1FR2 A;  2GZI A;  1MZ8 A;  1AYI A;  4UHP B;  1UJZ A;  1GXH A;  1EMV A;  2GZJ A;  1IMQ A;  2GZF A;  2K0D X;  2JAZ A;  4QKO A;  5EW5 E;  2VLQ A;  4F37 A;  1CEI A;  2GZE A;  2VLO A;  2WPT A;  3U43 A;  2NO8 A;  2VLP A;  3GJN A;  2GYK A;  1UNK A;  2JB0 A;  2JBG A;  2ERH A;  1E0H A;  1ZNV A;  7CEI A;  2GZG A;  1IMP A; 
#chains in the Genus database with same CATH topology
 2MR7 A;  2MVV A;  4COC A;  1KLP A;  3LRY A;  4U0A A;  1M6N A;  2OTJ P;  5BS2 A;  1VQ6 P;  2FQ0 A;  2L22 A;  2MVU A;  2AFD A;  1RO2 A;  3GZM A;  5KP6 B;  3DS4 A;  2LIW A;  2JB0 A;  2N6Y A;  3G21 A;  1YI2 P;  4H2Y C;  2Z46 A;  2K0X A;  2X2B A;  2MF4 A;  3G29 A;  4BPH A;  3CCM P;  2AF8 A;  2FAD A;  1VQN P;  1DV5 A;  4QKO A;  1VQO P;  1VHN A;  2JYL A;  3H0D A;  3NTE A;  2KOP A;  5KP7 B;  2L4B A;  1ZNV A;  3VRL C;  4XFY A;  3CXC O;  5F2N A;  2K5X A;  2N5I A;  5I4T G;  3G1I A;  2KG6 A;  1EMV A;  4QNB A;  2PEQ A;  2JO0 A;  1AUM A;  3HYB A;  2L9F A;  5JPA A;  2EHT A;  3P05 A;  1DNY A;  4GR6 A;  2JU2 A;  1M1K Q;  3MGE A;  2PEN A;  2CGQ A;  3G71 P;  2BHV A;  4WYM A;  3GKL C;  1NJI Q;  2LTE A;  1YHQ P;  2GDY A;  2FHS C;  2KGC A;  2LML A;  2FVF A;  1RO0 A;  1QVG O;  1K8A Q;  3CCS P;  1Q86 Q;  2AFE A;  2MD9 A;  2PEO A;  1VQ9 P;  2KR5 A;  3DS1 A;  2JGP A;  5HGN A;  4UHP B;  1KD1 Q;  2KGA A;  2FAE A;  3G0V A;  3WBH A;  2N6Z A;  2GYK A;  2DGY A;  4PH0 A;  4BPF A;  3E2D A;  4XFX A;  4CA3 A;  1ACP A;  2N50 A;  3NY7 B;  1VQ4 P;  1BXI A;  1AF8 A;  3CPW O;  2EIA A;  2Z45 A;  1N8R Q;  3CC4 P;  1K9M Q;  4U0E A;  3CCR P;  2FQ1 A;  2KG8 A;  3G26 A;  1E6J P;  1VQ7 P;  5CZD B;  2EG5 A;  3H47 A;  2KOO A;  4R0M A;  2CQ8 A;  2MR8 A;  3DTJ A;  2FQ2 A;  5HV8 A;  1IMQ A;  3CCV P;  4DG9 A;  2OTL P;  2XZ0 D;  3CCJ P;  2K93 A;  4HKG A;  1K73 Q;  1HQB A;  4XRQ A;  1RNI A;  2P9X A;  1JJ2 O;  2ONT A;  2PNG A;  1GXG A;  3DS2 A;  5BS1 A;  2K92 A;  1VQ8 P;  1GXH A;  2QA4 P;  4PXH B;  3G1G A;  3OW2 O;  2EFJ A;  2WPT A;  2VLP A;  4H2X C;  2VSQ A;  1Q81 Q;  3CCQ P;  2JYG A;  1A43 A;  2KW2 A;  4XFZ A;  2LPK A;  3M1M A;  4BPG A;  5F2K A;  2DNW A;  2N5H A;  2XT1 A;  1D1D A;  1FR2 A;  1GPJ A;  3CD6 P;  1AYI A;  3G28 A;  2GZJ A;  2CWO A;  5EW5 E;  2VLQ A;  4F37 A;  2ROQ A;  1CEI A;  3GJN A;  1VQ5 P;  3DS5 A;  1HY8 A;  2ERH A;  2LOL A;  1OR5 A;  3HZQ A;  3CC2 P;  4XRO A;  3CME P;  2XZ1 C;  2PEM A;  1M90 Q;  4U0C A;  1NQ4 A;  1EOQ A;  2PY8 A;  2NO8 A;  2K94 A;  4U0F A;  2K0Y A;  2GDW A;  4IZ6 A;  2FAC A;  1YJ9 P;  2PEI A;  3RG2 A;  2FVE A;  1UJZ A;  3CCU P;  2K0D X;  2JAZ A;  5HGM A;  2BUO A;  4H2W C;  1K30 A;  2AVA A;  3DS3 A;  2M8L A;  2KGE A;  2PEK A;  2LL8 A;  1L0I A;  2KOR A;  3Q20 A;  2CG5 B;  2GZI A;  2KWL A;  1F80 D;  4NEO A;  4U0D A;  2GDX A;  1QRJ A;  1M74 A;  3H4E A;  1UNK A;  5HVC A;  2JBG A;  3RG6 C;  1E0H A;  2XV6 A;  4COP A;  4PWV B;  3B4Q A;  1YIT P;  2LF4 A;  1BAJ A;  1QVF O;  1W2B O;  1L0H A;  2GZF A;  3EJB A;  1YJW P;  1Q7Y Q;  2M8N A;  2CNR A;  1Z6M A;  3LMO A;  4PH1 A;  3I55 P;  3GZL A;  5DCK A;  2N98 A;  2FVA A;  2L6E A;  1S72 P;  2PEJ A;  1Q82 Q;  2M8P A;  2E1M A;  2GZE A;  2XXM A;  1VQK P;  1IUQ A;  3B5I A;  3CMA P;  2LKI A;  1ZMB A;  3I56 P;  2L0Q A;  4U0B A;  7CEI A;  2GZG A;  3CCL P;  2EHS A;  1IMP A;  1VQM P;  3CCE P;  2QNW A;  2QEX P;  2JQ4 A;  1A8O A;  1MZ8 A;  1KC8 Q;  1VKU A;  2KGD A;  1T8K A;  3DS0 A;  3G4S P;  4IPY A;  5F2O A;  5KP8 B;  3EJD A;  1YIJ P;  3CC7 P;  4MRT C;  4GR2 A;  2JU1 A;  3EJE A;  2KOS A;  1X3O A;  2VLN A;  2K2Q A;  2MY5 A;  2KG9 A;  1M6E X;  1VQP P;  3CE7 A;  3DPH A;  2VLO A;  3U43 A;  1VQL P;  2OAR A;  3G6E P;  5HGL A;  1KQS O;  4M0I A;  2LIU A;  2KOQ A;  2KOD A;  2Z44 A;  2M5R A;  1EIA A;  5EJD A;  1YJN P;  5HGO A; 
#chains in the Genus database with same CATH homology
 1BXI A;  1GXG A;  3GKL C;  2VLN A;  2K5X A;  1FR2 A;  2GZI A;  1MZ8 A;  1AYI A;  4UHP B;  1UJZ A;  1GXH A;  1EMV A;  2GZJ A;  1IMQ A;  2GZF A;  2K0D X;  2JAZ A;  4QKO A;  5EW5 E;  2VLQ A;  4F37 A;  1CEI A;  2GZE A;  2VLO A;  2WPT A;  3U43 A;  2NO8 A;  2VLP A;  3GJN A;  2GYK A;  1UNK A;  2JB0 A;  2JBG A;  2ERH A;  1E0H A;  1ZNV A;  7CEI A;  2GZG A;  1IMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...