2FVAA

Structure of 18:0-acp with docked fatty acid
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Acyl Carrier Protein
publication title Solution structures of spinach acyl carrier protein with decanoate and stearate
pubmed doi rcsb
source organism Spinacia oleracea
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fvaA00
2CQ8A 2K93A 2KOPA 5KP6B 2FQ0A 5KP8B 2GDWA 2KGEA 3CE7A 3EJBA 2MVVA 2KWLA 1ACPA 2X2BA 1VKUA 2KR5A 2M5RA 2LMLA 2LOLA 2MR8A 2JU1A 4H2YC 2EHSA 2CG5B 2KGAA 2XZ0D 1DNYA 2FQ1A 2N6ZA 2QNWA 3GZLA 2KG6A 4IZ6A 2L22A 2K0XA 2KGCA 2KW2A 2KG9A 2N6YA 2L9FA 2K0YA 2K94A 2FADA 2FVFA 4HKGA 3RG2A 2CNRA 2K2QA 2FAEA 3GZMA 2LL8A 2LPKA 4BPFA 2LKIA 2KORA 2AFDA 2AFEA 1DV5A 2L4BA 2KGDA 1L0IA 5CZDB 2N98A 4R0MA 2MY5A 2MF4A 1HQBA 2KOSA 2PNGA 4H2WC 2DNWA 5EJDA 4NEOA 2LTEA 2JU2A 2VSQA 1OR5A 2KG8A 2GDYA 4H2XC 4PXHB 1X3OA 2LIUA 2GDXA 2FQ2A 4CA3A 2MVUA 2LIWA 1F80D 2FHSC 2FVEA 4MRTC 2FACA 2K92A 3EJEA 2N5HA 4BPHA 2N5IA 2AF8A 3LMOA 5KP7B 2EHTA 2FVAA 1T8KA 4PWVB 1KLPA 2JGPA 1AF8A 4BPGA 1HY8A 2KOQA 1L0HA 2N50A 2ROQA 2MD9A 2L0QA 1NQ4A 3EJDA 5HVCA 2MR7A 2AVAA 2CGQA 4DG9A 2KOOA 2JQ4A 3NY7B 5HV8A 2XZ1C
chains in the Genus database with same CATH superfamily
2KOPA 5KP6B 3CCUP 1EMVA 2FQ0A 2KGEA 2QA4P 2X2BA 2PEMA 1IMQA 2KR5A 4QNBA 3DS0A 1E0HA 2KG6A 3MGEA 4U0AA 3CC2P 3Q20A 1VQ6P 2K0XA 2JB0A 3I56P 3CPWO 2VLNA 2L9FA 2K94A 3GJNA 2FADA 2FVFA 2CNRA 2FAEA 1QRJA 1N8RQ 2LL8A 2LKIA 2M8NA 2AFEA 3CCMP 1DV5A 3CD6P 2N98A 2K5XA 1HQBA 2KOSA 2PNGA 2NO8A 2PEJA 2GZJA 2VSQA 1E6JP 2KG8A 2GDYA 2JO0A 4F37A 2PEIA 1RO0A 4XFYA 2CWOA 1F80D 2FVEA 1VQKP 2K92A 3EJEA 2N5HA 1K9MQ 3B4QA 1Q7YQ 3G29A 4QKOA 2FVAA 4PWVB 3CCEP 1AF8A 2GZIA 4U0CA 1VHNA 1EIAA 5HGOA 3EJDA 3DPHA 1QVGO 2PEKA 5BS1A 2JQ4A 3CCQP 3CCLP 4UHPB 2K93A 3CXCO 2GYKA 1Z6MA 1YJNP 1YHQP 3DS2A 1AUMA 2PEOA 2GDWA 3CE7A 1MZ8A 5BS2A 3WBHA 2LOLA 2XV6A 1ZMBA 5HGNA 1AYIA 2EHSA 2CG5B 2Z44A 1M90Q 2QNWA 4PH1A 1YITP 2KGCA 3RG6C 3DS4A 2KW2A 5DCKA 4HKGA 3RG2A 2K2QA 2GZGA 4GR6A 1VQ9P 1VQ5P 3GZMA 1VQ7P 1YIJP 1ZNVA 2KORA 1NJIQ 3GKLC 1VQOP 2KGDA 2L4BA 4R0MA 1A8OA 4NEOA 1CEIA 2JU2A 4WYMA 2OTJP 1FR2A 2QEXP 3H4EA 1RNIA 1VQMP 2Z45A 4BPHA 1VQNP 3LMOA 1D1DA 5F2KA 2JGPA 4BPGA 1EOQA 5F2OA 3HYBA 3G1IA 1VQPP 2L0QA 4COPA 2M8PA 2MR7A 3G0VA 2JYLA 2CGQA 2ONTA 2KOOA 2XZ1C 4XFXA 1UNKA 2EFJA 2Z46A 2BHVA 2ERHA 1GXHA 2MVVA 1ACPA 3CMAP 4XROA 5EW5E 2M5RA 4XFZA 2MR8A 1KD1Q 4H2YC 4IPYA 2KGAA 2XZ0D 2P9XA 2N6ZA 3GZLA 4IZ6A 1M1KQ 2L22A 1UJZA 3G21A 2KG9A 4XRQA 1A43A 2LF4A 3DS5A 2GZFA 2XXMA 5HGMA 1RO2A 4U0BA 2LPKA 2AFDA 4U0DA 1JJ2O 3DS1A 2DGYA 1L0IA 2MY5A 3LRYA 3CC7P 1Q82Q 4H2WC 1YI2P 5EJDA 2LTEA 4M0IA 1OR5A 4PXHB 1VQLP 1X3OA 5F2NA 2MVUA 2LIWA 2FHSC 4MRTC 1GPJA 1YJ9P 2JAZA 3DTJA 2VLOA 4U0EA 1Q81Q 2N5IA 1W2BO 2AF8A 1VQ4P 5KP7B 5HGLA 2EHTA 3U43A 1VQ8P 3OW2O 3H0DA 3I55P 1IUQA 3G26A 4DG9A 2PY8A 2GZEA 1S72P 1GXGA 2PENA 2CQ8A 3CCVP 1YJWP 2L6EA 5KP8B 3H47A 1IMPA 2VLQA 3HZQA 3EJBA 2KWLA 1VKUA 1QVFO 2LMLA 4U0FA 2JU1A 2KODA 1DNYA 2FQ1A 3G4SP 2EIAA 2N6YA 2K0YA 3M1MA 4COCA 5I4TG 3CCRP 1M6EX 3G71P 1BAJA 2XT1A 1M6NA 4BPFA 2JYGA 1K8AQ 5CZDB 2WPTA 3E2DA 2OARA 2MF4A 2DNWA 3G1GA 3P05A 4H2XC 1Q86Q 3G28A 1K73Q 2LIUA 2GDXA 2FQ2A 4CA3A 2BUOA 2K0DX 2OTLP 4PH0A 2M8LA 2FACA 2EG5A 5JPAA 3CMEP 1T8KA 1KLPA 3VRLC 2VLPA 3CCSP 7CEIA 1HY8A 2KOQA 1L0HA 3G6EP 1K30A 2PEQA 3CCJP 3B5IA 3NTEA 2N50A 2ROQA 2MD9A 1NQ4A 1M74A 5HVCA 1KQSO 3DS3A 1KC8Q 2E1MA 2AVAA 3CC4P 1BXIA 4GR2A 3NY7B 2JBGA 5HV8A
chains in the Genus database with same CATH topology
2CQ8A 2K93A 2KOPA 5KP6B 2FQ0A 5KP8B 2GDWA 2KGEA 3CE7A 3EJBA 2MVVA 2KWLA 1ACPA 2X2BA 1VKUA 2KR5A 2M5RA 2LMLA 2LOLA 2MR8A 2JU1A 4H2YC 2EHSA 2CG5B 2KGAA 2XZ0D 1DNYA 2FQ1A 2N6ZA 2QNWA 3GZLA 2KG6A 4IZ6A 2L22A 2K0XA 2KGCA 2KW2A 2KG9A 2N6YA 2L9FA 2K0YA 2K94A 2FADA 2FVFA 4HKGA 3RG2A 2CNRA 2K2QA 2FAEA 3GZMA 2LL8A 2LPKA 4BPFA 2LKIA 2KORA 2AFDA 2AFEA 1DV5A 2L4BA 2KGDA 1L0IA 5CZDB 2N98A 4R0MA 2MY5A 2MF4A 1HQBA 2KOSA 2PNGA 4H2WC 2DNWA 5EJDA 4NEOA 2LTEA 2JU2A 2VSQA 1OR5A 2KG8A 2GDYA 4H2XC 4PXHB 1X3OA 2LIUA 2GDXA 2FQ2A 4CA3A 2MVUA 2LIWA 1F80D 2FHSC 2FVEA 4MRTC 2FACA 2K92A 3EJEA 2N5HA 4BPHA 2N5IA 2AF8A 3LMOA 5KP7B 2EHTA 2FVAA 1T8KA 4PWVB 1KLPA 2JGPA 1AF8A 4BPGA 1HY8A 2KOQA 1L0HA 2N50A 2ROQA 2MD9A 2L0QA 1NQ4A 3EJDA 5HVCA 2MR7A 2AVAA 2CGQA 4DG9A 2KOOA 2JQ4A 3NY7B 5HV8A 2XZ1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQ8 A;  2K93 A;  2KOP A;  5KP6 B;  2FQ0 A;  5KP8 B;  2GDW A;  2KGE A;  3CE7 A;  3EJB A;  2MVV A;  2KWL A;  1ACP A;  2X2B A;  1VKU A;  2KR5 A;  2M5R A;  2LML A;  2LOL A;  2MR8 A;  2JU1 A;  4H2Y C;  2EHS A;  2CG5 B;  2KGA A;  2XZ0 D;  1DNY A;  2FQ1 A;  2N6Z A;  2QNW A;  3GZL A;  2KG6 A;  4IZ6 A;  2L22 A;  2K0X A;  2KGC A;  2KW2 A;  2KG9 A;  2N6Y A;  2L9F A;  2K0Y A;  2K94 A;  2FAD A;  2FVF A;  4HKG A;  3RG2 A;  2CNR A;  2K2Q A;  2FAE A;  3GZM A;  2LL8 A;  2LPK A;  4BPF A;  2LKI A;  2KOR A;  2AFD A;  2AFE A;  1DV5 A;  2L4B A;  2KGD A;  1L0I A;  5CZD B;  2N98 A;  4R0M A;  2MY5 A;  2MF4 A;  1HQB A;  2KOS A;  2PNG A;  4H2W C;  2DNW A;  5EJD A;  4NEO A;  2LTE A;  2JU2 A;  2VSQ A;  1OR5 A;  2KG8 A;  2GDY A;  4H2X C;  4PXH B;  1X3O A;  2LIU A;  2GDX A;  2FQ2 A;  4CA3 A;  2MVU A;  2LIW A;  1F80 D;  2FHS C;  2FVE A;  4MRT C;  2FAC A;  2K92 A;  3EJE A;  2N5H A;  4BPH A;  2N5I A;  2AF8 A;  3LMO A;  5KP7 B;  2EHT A;  2FVA A;  1T8K A;  4PWV B;  1KLP A;  2JGP A;  1AF8 A;  4BPG A;  1HY8 A;  2KOQ A;  1L0H A;  2N50 A;  2ROQ A;  2MD9 A;  2L0Q A;  1NQ4 A;  3EJD A;  5HVC A;  2MR7 A;  2AVA A;  2CGQ A;  4DG9 A;  2KOO A;  2JQ4 A;  3NY7 B;  5HV8 A;  2XZ1 C; 
#chains in the Genus database with same CATH topology
 2KOP A;  5KP6 B;  3CCU P;  1EMV A;  2FQ0 A;  2KGE A;  2QA4 P;  2X2B A;  2PEM A;  1IMQ A;  2KR5 A;  4QNB A;  3DS0 A;  1E0H A;  2KG6 A;  3MGE A;  4U0A A;  3CC2 P;  3Q20 A;  1VQ6 P;  2K0X A;  2JB0 A;  3I56 P;  3CPW O;  2VLN A;  2L9F A;  2K94 A;  3GJN A;  2FAD A;  2FVF A;  2CNR A;  2FAE A;  1QRJ A;  1N8R Q;  2LL8 A;  2LKI A;  2M8N A;  2AFE A;  3CCM P;  1DV5 A;  3CD6 P;  2N98 A;  2K5X A;  1HQB A;  2KOS A;  2PNG A;  2NO8 A;  2PEJ A;  2GZJ A;  2VSQ A;  1E6J P;  2KG8 A;  2GDY A;  2JO0 A;  4F37 A;  2PEI A;  1RO0 A;  4XFY A;  2CWO A;  1F80 D;  2FVE A;  1VQK P;  2K92 A;  3EJE A;  2N5H A;  1K9M Q;  3B4Q A;  1Q7Y Q;  3G29 A;  4QKO A;  2FVA A;  4PWV B;  3CCE P;  1AF8 A;  2GZI A;  4U0C A;  1VHN A;  1EIA A;  5HGO A;  3EJD A;  3DPH A;  1QVG O;  2PEK A;  5BS1 A;  2JQ4 A;  3CCQ P;  3CCL P;  4UHP B;  2K93 A;  3CXC O;  2GYK A;  1Z6M A;  1YJN P;  1YHQ P;  3DS2 A;  1AUM A;  2PEO A;  2GDW A;  3CE7 A;  1MZ8 A;  5BS2 A;  3WBH A;  2LOL A;  2XV6 A;  1ZMB A;  5HGN A;  1AYI A;  2EHS A;  2CG5 B;  2Z44 A;  1M90 Q;  2QNW A;  4PH1 A;  1YIT P;  2KGC A;  3RG6 C;  3DS4 A;  2KW2 A;  5DCK A;  4HKG A;  3RG2 A;  2K2Q A;  2GZG A;  4GR6 A;  1VQ9 P;  1VQ5 P;  3GZM A;  1VQ7 P;  1YIJ P;  1ZNV A;  2KOR A;  1NJI Q;  3GKL C;  1VQO P;  2KGD A;  2L4B A;  4R0M A;  1A8O A;  4NEO A;  1CEI A;  2JU2 A;  4WYM A;  2OTJ P;  1FR2 A;  2QEX P;  3H4E A;  1RNI A;  1VQM P;  2Z45 A;  4BPH A;  1VQN P;  3LMO A;  1D1D A;  5F2K A;  2JGP A;  4BPG A;  1EOQ A;  5F2O A;  3HYB A;  3G1I A;  1VQP P;  2L0Q A;  4COP A;  2M8P A;  2MR7 A;  3G0V A;  2JYL A;  2CGQ A;  2ONT A;  2KOO A;  2XZ1 C;  4XFX A;  1UNK A;  2EFJ A;  2Z46 A;  2BHV A;  2ERH A;  1GXH A;  2MVV A;  1ACP A;  3CMA P;  4XRO A;  5EW5 E;  2M5R A;  4XFZ A;  2MR8 A;  1KD1 Q;  4H2Y C;  4IPY A;  2KGA A;  2XZ0 D;  2P9X A;  2N6Z A;  3GZL A;  4IZ6 A;  1M1K Q;  2L22 A;  1UJZ A;  3G21 A;  2KG9 A;  4XRQ A;  1A43 A;  2LF4 A;  3DS5 A;  2GZF A;  2XXM A;  5HGM A;  1RO2 A;  4U0B A;  2LPK A;  2AFD A;  4U0D A;  1JJ2 O;  3DS1 A;  2DGY A;  1L0I A;  2MY5 A;  3LRY A;  3CC7 P;  1Q82 Q;  4H2W C;  1YI2 P;  5EJD A;  2LTE A;  4M0I A;  1OR5 A;  4PXH B;  1VQL P;  1X3O A;  5F2N A;  2MVU A;  2LIW A;  2FHS C;  4MRT C;  1GPJ A;  1YJ9 P;  2JAZ A;  3DTJ A;  2VLO A;  4U0E A;  1Q81 Q;  2N5I A;  1W2B O;  2AF8 A;  1VQ4 P;  5KP7 B;  5HGL A;  2EHT A;  3U43 A;  1VQ8 P;  3OW2 O;  3H0D A;  3I55 P;  1IUQ A;  3G26 A;  4DG9 A;  2PY8 A;  2GZE A;  1S72 P;  1GXG A;  2PEN A;  2CQ8 A;  3CCV P;  1YJW P;  2L6E A;  5KP8 B;  3H47 A;  1IMP A;  2VLQ A;  3HZQ A;  3EJB A;  2KWL A;  1VKU A;  1QVF O;  2LML A;  4U0F A;  2JU1 A;  2KOD A;  1DNY A;  2FQ1 A;  3G4S P;  2EIA A;  2N6Y A;  2K0Y A;  3M1M A;  4COC A;  5I4T G;  3CCR P;  1M6E X;  3G71 P;  1BAJ A;  2XT1 A;  1M6N A;  4BPF A;  2JYG A;  1K8A Q;  5CZD B;  2WPT A;  3E2D A;  2OAR A;  2MF4 A;  2DNW A;  3G1G A;  3P05 A;  4H2X C;  1Q86 Q;  3G28 A;  1K73 Q;  2LIU A;  2GDX A;  2FQ2 A;  4CA3 A;  2BUO A;  2K0D X;  2OTL P;  4PH0 A;  2M8L A;  2FAC A;  2EG5 A;  5JPA A;  3CME P;  1T8K A;  1KLP A;  3VRL C;  2VLP A;  3CCS P;  7CEI A;  1HY8 A;  2KOQ A;  1L0H A;  3G6E P;  1K30 A;  2PEQ A;  3CCJ P;  3B5I A;  3NTE A;  2N50 A;  2ROQ A;  2MD9 A;  1NQ4 A;  1M74 A;  5HVC A;  1KQS O;  3DS3 A;  1KC8 Q;  2E1M A;  2AVA A;  3CC4 P;  1BXI A;  4GR2 A;  3NY7 B;  2JBG A;  5HV8 A; 
#chains in the Genus database with same CATH homology
 2CQ8 A;  2K93 A;  2KOP A;  5KP6 B;  2FQ0 A;  5KP8 B;  2GDW A;  2KGE A;  3CE7 A;  3EJB A;  2MVV A;  2KWL A;  1ACP A;  2X2B A;  1VKU A;  2KR5 A;  2M5R A;  2LML A;  2LOL A;  2MR8 A;  2JU1 A;  4H2Y C;  2EHS A;  2CG5 B;  2KGA A;  2XZ0 D;  1DNY A;  2FQ1 A;  2N6Z A;  2QNW A;  3GZL A;  2KG6 A;  4IZ6 A;  2L22 A;  2K0X A;  2KGC A;  2KW2 A;  2KG9 A;  2N6Y A;  2L9F A;  2K0Y A;  2K94 A;  2FAD A;  2FVF A;  4HKG A;  3RG2 A;  2CNR A;  2K2Q A;  2FAE A;  3GZM A;  2LL8 A;  2LPK A;  4BPF A;  2LKI A;  2KOR A;  2AFD A;  2AFE A;  1DV5 A;  2L4B A;  2KGD A;  1L0I A;  5CZD B;  2N98 A;  4R0M A;  2MY5 A;  2MF4 A;  1HQB A;  2KOS A;  2PNG A;  4H2W C;  2DNW A;  5EJD A;  4NEO A;  2LTE A;  2JU2 A;  2VSQ A;  1OR5 A;  2KG8 A;  2GDY A;  4H2X C;  4PXH B;  1X3O A;  2LIU A;  2GDX A;  2FQ2 A;  4CA3 A;  2MVU A;  2LIW A;  1F80 D;  2FHS C;  2FVE A;  4MRT C;  2FAC A;  2K92 A;  3EJE A;  2N5H A;  4BPH A;  2N5I A;  2AF8 A;  3LMO A;  5KP7 B;  2EHT A;  2FVA A;  1T8K A;  4PWV B;  1KLP A;  2JGP A;  1AF8 A;  4BPG A;  1HY8 A;  2KOQ A;  1L0H A;  2N50 A;  2ROQ A;  2MD9 A;  2L0Q A;  1NQ4 A;  3EJD A;  5HVC A;  2MR7 A;  2AVA A;  2CGQ A;  4DG9 A;  2KOO A;  2JQ4 A;  3NY7 B;  5HV8 A;  2XZ1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...