2FVAA

Structure of 18:0-acp with docked fatty acid
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of spinach acyl carrier protein with decanoate and stearate
pubmed doi rcsb
source organism Spinacia oleracea
molecule tags Biosynthetic protein
molecule keywords Acyl Carrier Protein
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fvaA00
2MVVA 2EHTA 2LPKA 5KP6B 2FACA 2N5HA 2L0QA 2LIUA 2K92A 2MD9A 2FVFA 2KG6A 1ACPA 1T8KA 3GZMA 2K0XA 1KLPA 2K93A 2FVEA 2LL8A 2CG5B 2FQ1A 2GDYA 2ROQA 2N50A 2XZ0D 2DNWA 2L4BA 2MVUA 1HQBA 2AVAA 2KGEA 4CA3A 2KORA 1NQ4A 2LOLA 2KGDA 4H2WC 4IZ6A 3LMOA 2KR5A 4H2YC 2N98A 2KWLA 2KG8A 2KOQA 2LMLA 4BPHA 1X3OA 5EJDA 2MY5A 2FQ0A 2KW2A 2LKIA 2K0YA 1L0HA 3NY7B 1F80D 2JU2A 2AF8A 3RG2A 2X2BA 5KP8B 2L22A 5CZDB 4BPGA 3EJBA 2K2QA 2FVAA 3CE7A 4R0MA 2CNRA 2XZ1C 2CQ8A 2KGAA 1VKUA 2MR8A 4HKGA 5KP7B 2EHSA 1DNYA 2MF4A 2LTEA 2CGQA 2MR7A 2KG9A 2PNGA 2GDXA 2QNWA 2FAEA 4BPFA 2M5RA 2AFEA 2N6ZA 1AF8A 2FQ2A 2N6YA 2AFDA 2JU1A 2KGCA 1OR5A 2GDWA 2JQ4A 2LIWA 2JGPA 1HY8A 1L0IA 5HV8A 2VSQA 2FADA 1DV5A 2KOPA 4PWVB 2KOSA 2L9FA 2KOOA 4NEOA 4PXHB 5HVCA 3GZLA 2K94A 2FHSC 2N5IA 3EJEA 3EJDA 4DG9A 4H2XC 4MRTC
chains in the Genus database with same CATH superfamily
5HGMA 3H47A 1Q7YQ 2LPKA 2VLPA 2MD9A 3G1IA 2KG6A 1T8KA 3VRLC 1K9MQ 3CMAP 4U0FA 3RG6C 1FR2A 2N50A 3HYBA 2XZ0D 3B5IA 1YI2P 1RO0A 3CMEP 4IPYA 4QNBA 1M1KQ 3DS0A 3CCVP 3M1MA 2EFJA 3MGEA 2EG5A 2KWLA 4M0IA 2L6EA 5EJDA 2KW2A 1A43A 2Z45A 3CCJP 4GR6A 2XT1A 2XXMA 2X2BA 5KP8B 2K2QA 4R0MA 1VQOP 2VLQA 2LTEA 2CGQA 3DS1A 3HZQA 2CWOA 2GDXA 5F2KA 4UHPB 5I4TG 1VQ6P 3DS5A 1VQKP 1E6JP 2N6ZA 7CEIA 2GZEA 1AF8A 1EIAA 2AFDA 2JU1A 3U43A 1OR5A 1E0HA 2ERHA 3CCSP 2KOPA 1Q86Q 2KOSA 2L9FA 4U0BA 1QVFO 1BXIA 2N5IA 4QKOA 3EJDA 3CCUP 2PEJA 2GZGA 1AUMA 1K73Q 1YJ9P 2MVVA 2L0QA 2LIUA 5F2NA 5BS1A 3GZMA 2K0XA 2K93A 3Q20A 3G21A 3GJNA 2ROQA 1JJ2O 4F37A 2DNWA 2L4BA 3H4EA 2P9XA 2PEQA 2KGEA 2PEMA 2LF4A 2LOLA 4IZ6A 3LMOA 2KR5A 1VQMP 2KG8A 4BPHA 4U0AA 3DS4A 2MY5A 2EIAA 2K0YA 1L0HA 1S72P 4U0DA 2E1MA 2PEKA 2K0DX 3P05A 3CC2P 2AF8A 5EW5E 3RG2A 2L22A 4BPGA 1VHNA 2FVAA 3CE7A 3CPWO 1VKUA 4HKGA 2EHSA 2PENA 3CCLP 1M6EX 2OTJP 2QNWA 4U0EA 2FAEA 4BPFA 4PH0A 2FQ2A 2N6YA 2DGYA 3WBHA 5DCKA 1DV5A 5HGLA 3I55P 1KD1Q 4XFZA 4PH1A 2FHSC 3EJEA 1AYIA 1UJZA 2EHTA 1VQNP 1KQSO 2N5HA 2FVFA 1ACPA 4XRQA 4XFXA 1VQPP 1M90Q 3CC7P 2FVEA 1VQ5P 2LL8A 3CC4P 3G6EP 2FQ1A 2GDYA 2CG5B 3G1GA 3G28A 3G71P 1EOQA 2MVUA 2Z44A 2JYLA 2AVAA 3DTJA 2Z46A 1YJWP 5HGOA 4CA3A 2VLNA 2M8PA 2KGDA 4H2WC 3CCMP 2PEOA 1Q82Q 2KOQA 2LMLA 1X3OA 2JAZA 2FQ0A 2BHVA 2JB0A 1K8AQ 3NY7B 5JPAA 1VQ7P 2JYGA 1ZMBA 1A8OA 2OARA 3EJBA 1RO2A 2KODA 2CNRA 2KGAA 5KP7B 1DNYA 1NJIQ 2WPTA 2JBGA 3G4SP 2BUOA 2M5RA 1VQ9P 2AFEA 2JO0A 3I56P 1W2BO 2KGCA 3GKLC 2GDWA 2JQ4A 2LIWA 1EMVA 2JGPA 2ONTA 2M8LA 2VLOA 2QA4P 5HV8A 1GPJA 2FADA 4PWVB 5HGNA 4PXHB 1M74A 5HVCA 1Z6MA 4WYMA 2QEXP 2K94A 1YHQP 4H2XC 1YJNP 3G0VA 1KC8Q 5KP6B 1VQ4P 2FACA 1VQLP 2K92A 3LRYA 1KLPA 1K30A 3DPHA 3CXCO 2NO8A 1VQ8P 3OW2O 1YITP 2PY8A 1HQBA 1D1DA 5BS2A 2GZJA 1GXGA 1QRJA 2KORA 1NQ4A 1IMPA 3G26A 1MZ8A 4H2YC 2N98A 3CD6P 2OTLP 1YIJP 3DS2A 2LKIA 1F80D 1CEIA 3CCRP 2JU2A 2M8NA 2PEIA 5CZDB 1ZNVA 2GYKA 3CCEP 4COCA 1RNIA 2XZ1C 4GR2A 2CQ8A 5F2OA 2MR8A 3E2DA 1Q81Q 2MF4A 2MR7A 2KG9A 2PNGA 1N8RQ 4XFYA 3B4QA 2GZFA 4U0CA 4XROA 2GZIA 1IUQA 2K5XA 2XV6A 3H0DA 1HY8A 4COPA 1L0IA 2VSQA 1GXHA 1QVGO 2KOOA 3G29A 4NEOA 1M6NA 1IMQA 1BAJA 3GZLA 3CCQP 3DS3A 1UNKA 4DG9A 3NTEA 4MRTC
chains in the Genus database with same CATH topology
2MVVA 2EHTA 2LPKA 5KP6B 2FACA 2N5HA 2L0QA 2LIUA 2K92A 2MD9A 2FVFA 2KG6A 1ACPA 1T8KA 3GZMA 2K0XA 1KLPA 2K93A 2FVEA 2LL8A 2CG5B 2FQ1A 2GDYA 2ROQA 2N50A 2XZ0D 2DNWA 2L4BA 2MVUA 1HQBA 2AVAA 2KGEA 4CA3A 2KORA 1NQ4A 2LOLA 2KGDA 4H2WC 4IZ6A 3LMOA 2KR5A 4H2YC 2N98A 2KWLA 2KG8A 2KOQA 2LMLA 4BPHA 1X3OA 5EJDA 2MY5A 2FQ0A 2KW2A 2LKIA 2K0YA 1L0HA 3NY7B 1F80D 2JU2A 2AF8A 3RG2A 2X2BA 5KP8B 2L22A 5CZDB 4BPGA 3EJBA 2K2QA 2FVAA 3CE7A 4R0MA 2CNRA 2XZ1C 2CQ8A 2KGAA 1VKUA 2MR8A 4HKGA 5KP7B 2EHSA 1DNYA 2MF4A 2LTEA 2CGQA 2MR7A 2KG9A 2PNGA 2GDXA 2QNWA 2FAEA 4BPFA 2M5RA 2AFEA 2N6ZA 1AF8A 2FQ2A 2N6YA 2AFDA 2JU1A 2KGCA 1OR5A 2GDWA 2JQ4A 2LIWA 2JGPA 1HY8A 1L0IA 5HV8A 2VSQA 2FADA 1DV5A 2KOPA 4PWVB 2KOSA 2L9FA 2KOOA 4NEOA 4PXHB 5HVCA 3GZLA 2K94A 2FHSC 2N5IA 3EJEA 3EJDA 4DG9A 4H2XC 4MRTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MVV A;  2EHT A;  2LPK A;  5KP6 B;  2FAC A;  2N5H A;  2L0Q A;  2LIU A;  2K92 A;  2MD9 A;  2FVF A;  2KG6 A;  1ACP A;  1T8K A;  3GZM A;  2K0X A;  1KLP A;  2K93 A;  2FVE A;  2LL8 A;  2CG5 B;  2FQ1 A;  2GDY A;  2ROQ A;  2N50 A;  2XZ0 D;  2DNW A;  2L4B A;  2MVU A;  1HQB A;  2AVA A;  2KGE A;  4CA3 A;  2KOR A;  1NQ4 A;  2LOL A;  2KGD A;  4H2W C;  4IZ6 A;  3LMO A;  2KR5 A;  4H2Y C;  2N98 A;  2KWL A;  2KG8 A;  2KOQ A;  2LML A;  4BPH A;  1X3O A;  5EJD A;  2MY5 A;  2FQ0 A;  2KW2 A;  2LKI A;  2K0Y A;  1L0H A;  3NY7 B;  1F80 D;  2JU2 A;  2AF8 A;  3RG2 A;  2X2B A;  5KP8 B;  2L22 A;  5CZD B;  4BPG A;  3EJB A;  2K2Q A;  2FVA A;  3CE7 A;  4R0M A;  2CNR A;  2XZ1 C;  2CQ8 A;  2KGA A;  1VKU A;  2MR8 A;  4HKG A;  5KP7 B;  2EHS A;  1DNY A;  2MF4 A;  2LTE A;  2CGQ A;  2MR7 A;  2KG9 A;  2PNG A;  2GDX A;  2QNW A;  2FAE A;  4BPF A;  2M5R A;  2AFE A;  2N6Z A;  1AF8 A;  2FQ2 A;  2N6Y A;  2AFD A;  2JU1 A;  2KGC A;  1OR5 A;  2GDW A;  2JQ4 A;  2LIW A;  2JGP A;  1HY8 A;  1L0I A;  5HV8 A;  2VSQ A;  2FAD A;  1DV5 A;  2KOP A;  4PWV B;  2KOS A;  2L9F A;  2KOO A;  4NEO A;  4PXH B;  5HVC A;  3GZL A;  2K94 A;  2FHS C;  2N5I A;  3EJE A;  3EJD A;  4DG9 A;  4H2X C;  4MRT C; 
#chains in the Genus database with same CATH topology
 5HGM A;  3H47 A;  1Q7Y Q;  2LPK A;  2VLP A;  2MD9 A;  3G1I A;  2KG6 A;  1T8K A;  3VRL C;  1K9M Q;  3CMA P;  4U0F A;  3RG6 C;  1FR2 A;  2N50 A;  3HYB A;  2XZ0 D;  3B5I A;  1YI2 P;  1RO0 A;  3CME P;  4IPY A;  4QNB A;  1M1K Q;  3DS0 A;  3CCV P;  3M1M A;  2EFJ A;  3MGE A;  2EG5 A;  2KWL A;  4M0I A;  2L6E A;  5EJD A;  2KW2 A;  1A43 A;  2Z45 A;  3CCJ P;  4GR6 A;  2XT1 A;  2XXM A;  2X2B A;  5KP8 B;  2K2Q A;  4R0M A;  1VQO P;  2VLQ A;  2LTE A;  2CGQ A;  3DS1 A;  3HZQ A;  2CWO A;  2GDX A;  5F2K A;  4UHP B;  5I4T G;  1VQ6 P;  3DS5 A;  1VQK P;  1E6J P;  2N6Z A;  7CEI A;  2GZE A;  1AF8 A;  1EIA A;  2AFD A;  2JU1 A;  3U43 A;  1OR5 A;  1E0H A;  2ERH A;  3CCS P;  2KOP A;  1Q86 Q;  2KOS A;  2L9F A;  4U0B A;  1QVF O;  1BXI A;  2N5I A;  4QKO A;  3EJD A;  3CCU P;  2PEJ A;  2GZG A;  1AUM A;  1K73 Q;  1YJ9 P;  2MVV A;  2L0Q A;  2LIU A;  5F2N A;  5BS1 A;  3GZM A;  2K0X A;  2K93 A;  3Q20 A;  3G21 A;  3GJN A;  2ROQ A;  1JJ2 O;  4F37 A;  2DNW A;  2L4B A;  3H4E A;  2P9X A;  2PEQ A;  2KGE A;  2PEM A;  2LF4 A;  2LOL A;  4IZ6 A;  3LMO A;  2KR5 A;  1VQM P;  2KG8 A;  4BPH A;  4U0A A;  3DS4 A;  2MY5 A;  2EIA A;  2K0Y A;  1L0H A;  1S72 P;  4U0D A;  2E1M A;  2PEK A;  2K0D X;  3P05 A;  3CC2 P;  2AF8 A;  5EW5 E;  3RG2 A;  2L22 A;  4BPG A;  1VHN A;  2FVA A;  3CE7 A;  3CPW O;  1VKU A;  4HKG A;  2EHS A;  2PEN A;  3CCL P;  1M6E X;  2OTJ P;  2QNW A;  4U0E A;  2FAE A;  4BPF A;  4PH0 A;  2FQ2 A;  2N6Y A;  2DGY A;  3WBH A;  5DCK A;  1DV5 A;  5HGL A;  3I55 P;  1KD1 Q;  4XFZ A;  4PH1 A;  2FHS C;  3EJE A;  1AYI A;  1UJZ A;  2EHT A;  1VQN P;  1KQS O;  2N5H A;  2FVF A;  1ACP A;  4XRQ A;  4XFX A;  1VQP P;  1M90 Q;  3CC7 P;  2FVE A;  1VQ5 P;  2LL8 A;  3CC4 P;  3G6E P;  2FQ1 A;  2GDY A;  2CG5 B;  3G1G A;  3G28 A;  3G71 P;  1EOQ A;  2MVU A;  2Z44 A;  2JYL A;  2AVA A;  3DTJ A;  2Z46 A;  1YJW P;  5HGO A;  4CA3 A;  2VLN A;  2M8P A;  2KGD A;  4H2W C;  3CCM P;  2PEO A;  1Q82 Q;  2KOQ A;  2LML A;  1X3O A;  2JAZ A;  2FQ0 A;  2BHV A;  2JB0 A;  1K8A Q;  3NY7 B;  5JPA A;  1VQ7 P;  2JYG A;  1ZMB A;  1A8O A;  2OAR A;  3EJB A;  1RO2 A;  2KOD A;  2CNR A;  2KGA A;  5KP7 B;  1DNY A;  1NJI Q;  2WPT A;  2JBG A;  3G4S P;  2BUO A;  2M5R A;  1VQ9 P;  2AFE A;  2JO0 A;  3I56 P;  1W2B O;  2KGC A;  3GKL C;  2GDW A;  2JQ4 A;  2LIW A;  1EMV A;  2JGP A;  2ONT A;  2M8L A;  2VLO A;  2QA4 P;  5HV8 A;  1GPJ A;  2FAD A;  4PWV B;  5HGN A;  4PXH B;  1M74 A;  5HVC A;  1Z6M A;  4WYM A;  2QEX P;  2K94 A;  1YHQ P;  4H2X C;  1YJN P;  3G0V A;  1KC8 Q;  5KP6 B;  1VQ4 P;  2FAC A;  1VQL P;  2K92 A;  3LRY A;  1KLP A;  1K30 A;  3DPH A;  3CXC O;  2NO8 A;  1VQ8 P;  3OW2 O;  1YIT P;  2PY8 A;  1HQB A;  1D1D A;  5BS2 A;  2GZJ A;  1GXG A;  1QRJ A;  2KOR A;  1NQ4 A;  1IMP A;  3G26 A;  1MZ8 A;  4H2Y C;  2N98 A;  3CD6 P;  2OTL P;  1YIJ P;  3DS2 A;  2LKI A;  1F80 D;  1CEI A;  3CCR P;  2JU2 A;  2M8N A;  2PEI A;  5CZD B;  1ZNV A;  2GYK A;  3CCE P;  4COC A;  1RNI A;  2XZ1 C;  4GR2 A;  2CQ8 A;  5F2O A;  2MR8 A;  3E2D A;  1Q81 Q;  2MF4 A;  2MR7 A;  2KG9 A;  2PNG A;  1N8R Q;  4XFY A;  3B4Q A;  2GZF A;  4U0C A;  4XRO A;  2GZI A;  1IUQ A;  2K5X A;  2XV6 A;  3H0D A;  1HY8 A;  4COP A;  1L0I A;  2VSQ A;  1GXH A;  1QVG O;  2KOO A;  3G29 A;  4NEO A;  1M6N A;  1IMQ A;  1BAJ A;  3GZL A;  3CCQ P;  3DS3 A;  1UNK A;  4DG9 A;  3NTE A;  4MRT C; 
#chains in the Genus database with same CATH homology
 2MVV A;  2EHT A;  2LPK A;  5KP6 B;  2FAC A;  2N5H A;  2L0Q A;  2LIU A;  2K92 A;  2MD9 A;  2FVF A;  2KG6 A;  1ACP A;  1T8K A;  3GZM A;  2K0X A;  1KLP A;  2K93 A;  2FVE A;  2LL8 A;  2CG5 B;  2FQ1 A;  2GDY A;  2ROQ A;  2N50 A;  2XZ0 D;  2DNW A;  2L4B A;  2MVU A;  1HQB A;  2AVA A;  2KGE A;  4CA3 A;  2KOR A;  1NQ4 A;  2LOL A;  2KGD A;  4H2W C;  4IZ6 A;  3LMO A;  2KR5 A;  4H2Y C;  2N98 A;  2KWL A;  2KG8 A;  2KOQ A;  2LML A;  4BPH A;  1X3O A;  5EJD A;  2MY5 A;  2FQ0 A;  2KW2 A;  2LKI A;  2K0Y A;  1L0H A;  3NY7 B;  1F80 D;  2JU2 A;  2AF8 A;  3RG2 A;  2X2B A;  5KP8 B;  2L22 A;  5CZD B;  4BPG A;  3EJB A;  2K2Q A;  2FVA A;  3CE7 A;  4R0M A;  2CNR A;  2XZ1 C;  2CQ8 A;  2KGA A;  1VKU A;  2MR8 A;  4HKG A;  5KP7 B;  2EHS A;  1DNY A;  2MF4 A;  2LTE A;  2CGQ A;  2MR7 A;  2KG9 A;  2PNG A;  2GDX A;  2QNW A;  2FAE A;  4BPF A;  2M5R A;  2AFE A;  2N6Z A;  1AF8 A;  2FQ2 A;  2N6Y A;  2AFD A;  2JU1 A;  2KGC A;  1OR5 A;  2GDW A;  2JQ4 A;  2LIW A;  2JGP A;  1HY8 A;  1L0I A;  5HV8 A;  2VSQ A;  2FAD A;  1DV5 A;  2KOP A;  4PWV B;  2KOS A;  2L9F A;  2KOO A;  4NEO A;  4PXH B;  5HVC A;  3GZL A;  2K94 A;  2FHS C;  2N5I A;  3EJE A;  3EJD A;  4DG9 A;  4H2X C;  4MRT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...