2GDYA

Solution structure of the b. brevis tycc3-pcp in a-state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrocidine synthetase III
publication title Conformational switches modulate protein interactions in peptide antibiotic synthetases
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/transport protein
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2gdyA01
3EJEA 1HQBA 2AVAA 2CQ8A 1L0IA 2XZ1C 4BPGA 2FAEA 2K0YA 2LIUA 2K2QA 2N6YA 1VKUA 5KP6B 2DNWA 1L0HA 2MR7A 2FACA 2KWLA 5CZDB 2CG5B 2JU2A 4BPFA 4BPHA 3EJBA 5HVCA 2GDYA 2LMLA 4HKGA 4IZ6A 2FVAA 2MVVA 2FQ0A 2JU1A 2GDWA 1OR5A 1AF8A 2FADA 2LPKA 2AF8A 1T8KA 2KGEA 4R0MA 2KGAA 1NQ4A 1F80D 4H2XC 2LKIA 2MF4A 2MVUA 2L0QA 2KGCA 2EHSA 2KG8A 1ACPA 1HY8A 5KP7B 2KG9A 2KOOA 2FQ2A 2MR8A 3CE7A 2KW2A 2N6ZA 1DNYA 2L4BA 2VSQA 2AFDA 2PNGA 2FHSC 2LIWA 1KLPA 4CA3A 2X2BA 4DG9A 5KP8B 2N5HA 4PXHB 2GDXA 2N50A 3GZLA 4H2WC 5HV8A 2LL8A 4NEOA 2AFEA 2LOLA 2MY5A 2K92A 2KOPA 3RG2A 4PWVB 2FVFA 2KGDA 2L22A 2LTEA 2CGQA 2FVEA 2K94A 2ROQA 2EHTA 2FQ1A 2KOQA 2JGPA 2KR5A 2K93A 2N98A 2N5IA 1DV5A 2KORA 2JQ4A 2XZ0D 2CNRA 1X3OA 3GZMA 2MD9A 5EJDA 2KG6A 2L9FA 3NY7B 2KOSA 2QNWA 3LMOA 4MRTC 3EJDA 4H2YC 2K0XA 2M5RA
chains in the Genus database with same CATH superfamily
2OTLP 1HQBA 1S72P 2AVAA 2PEMA 1GPJA 2K5XA 4BPGA 2JYGA 3NTEA 1E0HA 2LIUA 2DGYA 2KODA 2QA4P 1Q86Q 3G4SP 3CCRP 1K9MQ 5CZDB 2XV6A 4BPHA 1YI2P 3H4EA 2VLPA 2VLQA 4M0IA 1ZNVA 2MVVA 2XT1A 2EFJA 3G1IA 4U0AA 2E1MA 2KGEA 2KGAA 1NQ4A 2M8NA 1VQMP 4XFYA 3CXCO 5F2OA 2L0QA 2KG8A 3G6EP 5JPAA 2N6ZA 3DS5A 4GR2A 3CCJP 2PNGA 4U0BA 3H0DA 1VQNP 4CA3A 5HGNA 3CCSP 3OW2O 4PXHB 2OARA 3DS0A 1YJ9P 1K73Q 3GKLC 2LOLA 3P05A 3DTJA 3G71P 2L22A 2QEXP 3DS1A 1VQ4P 2EHTA 2JGPA 2K93A 2N98A 5EW5E 2CNRA 2MD9A 2KG6A 3NY7B 3LMOA 1VQPP 4PH1A 2JO0A 7CEIA 2M5RA 5BS2A 1M1KQ 4XRQA 2GYKA 2XZ1C 2BUOA 2N6YA 1VKUA 3U43A 2Z44A 3DS3A 2JB0A 2JAZA 2JU2A 3I56P 4BPFA 3EJBA 1AYIA 2LMLA 4HKGA 3CCUP 4COCA 2GDWA 2VLNA 4F37A 2FADA 2AF8A 4R0MA 1F80D 1EOQA 4PH0A 2M8LA 2WPTA 2JBGA 3DPHA 1M90Q 1M6NA 3CCQP 1HY8A 2PEIA 2KG9A 1VQ8P 3CPWO 2PEJA 3CC4P 4IPYA 2GZJA 4COPA 3CMAP 1UNKA 4DG9A 1Z6MA 1YHQP 2JYLA 2PEQA 2GDXA 2ONTA 2XXMA 3GZLA 4H2WC 2BHVA 3B5IA 2M8PA 2P9XA 1RO0A 3RG2A 1QRJA 3CC2P 1RNIA 2GZFA 2FQ1A 1BXIA 5F2KA 2PY8A 2K0DX 2JQ4A 1X3OA 5EJDA 1VQ9P 1Q7YQ 1NJIQ 4MRTC 3EJDA 3DS2A 2GZGA 1MZ8A 3EJEA 1KQSO 4QNBA 3HZQA 4U0EA 3H47A 2EG5A 2FAEA 3CCLP 2PEOA 1VQ6P 3MGEA 2MR7A 1VQLP 3LRYA 4WYMA 3VRLC 1IUQA 1YJNP 1Q82Q 1K8AQ 5HVCA 1BAJA 2Z46A 2FVAA 4IZ6A 2FQ0A 2JU1A 3M1MA 1OR5A 1GXHA 3CCMP 4XROA 1A8OA 1QVFO 4XFZA 5HGOA 1T8KA 1Q81Q 5HGLA 1D1DA 1VQ7P 1EIAA 4H2XC 2LKIA 3E2DA 2MVUA 2VLOA 2KGCA 3I55P 5KP7B 1M6EX 5BS1A 1FR2A 2FQ2A 3CE7A 2KW2A 1DNYA 2L4BA 4XFXA 2VSQA 2AFDA 2LIWA 3WBHA 3G26A 2X2BA 5F2NA 5KP8B 2N5HA 2N50A 1UJZA 1E6JP 2K92A 2KOPA 2PENA 3DS4A 4UHPB 1YIJP 1YJWP 1AUMA 2CGQA 2FVEA 1RO2A 2KOQA 1VQ5P 2KORA 3GZMA 2L9FA 2ERHA 1GXGA 3G1GA 3G29A 2CWOA 2CQ8A 1L0IA 2K0YA 3HYBA 2K2QA 5KP6B 1KC8Q 3CC7P 2DNWA 4U0DA 3B4QA 1L0HA 3G0VA 2FACA 1K30A 2KWLA 2CG5B 2L6EA 1VHNA 3CCEP 2GDYA 2GZIA 2LF4A 2Z45A 1AF8A 1YITP 2PEKA 3G21A 1W2BO 1CEIA 2LPKA 5I4TG 4U0CA 3RG6C 2MF4A 1M74A 2EHSA 4QKOA 1VQKP 1N8RQ 1ACPA 3GJNA 2KOOA 1A43A 1ZMBA 2MR8A 5HGMA 2OTJP 1QVGO 2FHSC 3Q20A 1KLPA 1JJ2O 1VQOP 4U0FA 5HV8A 1IMPA 2LL8A 4NEOA 2NO8A 2AFEA 2MY5A 1KD1Q 4PWVB 3G28A 2FVFA 2KGDA 2LTEA 5DCKA 3CCVP 3CMEP 1IMQA 2EIAA 4GR6A 2GZEA 2K94A 2ROQA 2KR5A 2N5IA 1DV5A 2XZ0D 1EMVA 2KOSA 2QNWA 4H2YC 2K0XA 3CD6P
chains in the Genus database with same CATH topology
3EJEA 1HQBA 2AVAA 2CQ8A 1L0IA 2XZ1C 4BPGA 2FAEA 2K0YA 2LIUA 2K2QA 2N6YA 1VKUA 5KP6B 2DNWA 1L0HA 2MR7A 2FACA 2KWLA 5CZDB 2CG5B 2JU2A 4BPFA 4BPHA 3EJBA 5HVCA 2GDYA 2LMLA 4HKGA 4IZ6A 2FVAA 2MVVA 2FQ0A 2JU1A 2GDWA 1OR5A 1AF8A 2FADA 2LPKA 2AF8A 1T8KA 2KGEA 4R0MA 2KGAA 1NQ4A 1F80D 4H2XC 2LKIA 2MF4A 2MVUA 2L0QA 2KGCA 2EHSA 2KG8A 1ACPA 1HY8A 5KP7B 2KG9A 2KOOA 2FQ2A 2MR8A 3CE7A 2KW2A 2N6ZA 1DNYA 2L4BA 2VSQA 2AFDA 2PNGA 2FHSC 2LIWA 1KLPA 4CA3A 2X2BA 4DG9A 5KP8B 2N5HA 4PXHB 2GDXA 2N50A 3GZLA 4H2WC 5HV8A 2LL8A 4NEOA 2AFEA 2LOLA 2MY5A 2K92A 2KOPA 3RG2A 4PWVB 2FVFA 2KGDA 2L22A 2LTEA 2CGQA 2FVEA 2K94A 2ROQA 2EHTA 2FQ1A 2KOQA 2JGPA 2KR5A 2K93A 2N98A 2N5IA 1DV5A 2KORA 2JQ4A 2XZ0D 2CNRA 1X3OA 3GZMA 2MD9A 5EJDA 2KG6A 2L9FA 3NY7B 2KOSA 2QNWA 3LMOA 4MRTC 3EJDA 4H2YC 2K0XA 2M5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJE A;  1HQB A;  2AVA A;  2CQ8 A;  1L0I A;  2XZ1 C;  4BPG A;  2FAE A;  2K0Y A;  2LIU A;  2K2Q A;  2N6Y A;  1VKU A;  5KP6 B;  2DNW A;  1L0H A;  2MR7 A;  2FAC A;  2KWL A;  5CZD B;  2CG5 B;  2JU2 A;  4BPF A;  4BPH A;  3EJB A;  5HVC A;  2GDY A;  2LML A;  4HKG A;  4IZ6 A;  2FVA A;  2MVV A;  2FQ0 A;  2JU1 A;  2GDW A;  1OR5 A;  1AF8 A;  2FAD A;  2LPK A;  2AF8 A;  1T8K A;  2KGE A;  4R0M A;  2KGA A;  1NQ4 A;  1F80 D;  4H2X C;  2LKI A;  2MF4 A;  2MVU A;  2L0Q A;  2KGC A;  2EHS A;  2KG8 A;  1ACP A;  1HY8 A;  5KP7 B;  2KG9 A;  2KOO A;  2FQ2 A;  2MR8 A;  3CE7 A;  2KW2 A;  2N6Z A;  1DNY A;  2L4B A;  2VSQ A;  2AFD A;  2PNG A;  2FHS C;  2LIW A;  1KLP A;  4CA3 A;  2X2B A;  4DG9 A;  5KP8 B;  2N5H A;  4PXH B;  2GDX A;  2N50 A;  3GZL A;  4H2W C;  5HV8 A;  2LL8 A;  4NEO A;  2AFE A;  2LOL A;  2MY5 A;  2K92 A;  2KOP A;  3RG2 A;  4PWV B;  2FVF A;  2KGD A;  2L22 A;  2LTE A;  2CGQ A;  2FVE A;  2K94 A;  2ROQ A;  2EHT A;  2FQ1 A;  2KOQ A;  2JGP A;  2KR5 A;  2K93 A;  2N98 A;  2N5I A;  1DV5 A;  2KOR A;  2JQ4 A;  2XZ0 D;  2CNR A;  1X3O A;  3GZM A;  2MD9 A;  5EJD A;  2KG6 A;  2L9F A;  3NY7 B;  2KOS A;  2QNW A;  3LMO A;  4MRT C;  3EJD A;  4H2Y C;  2K0X A;  2M5R A; 
#chains in the Genus database with same CATH topology
 2OTL P;  1HQB A;  1S72 P;  2AVA A;  2PEM A;  1GPJ A;  2K5X A;  4BPG A;  2JYG A;  3NTE A;  1E0H A;  2LIU A;  2DGY A;  2KOD A;  2QA4 P;  1Q86 Q;  3G4S P;  3CCR P;  1K9M Q;  5CZD B;  2XV6 A;  4BPH A;  1YI2 P;  3H4E A;  2VLP A;  2VLQ A;  4M0I A;  1ZNV A;  2MVV A;  2XT1 A;  2EFJ A;  3G1I A;  4U0A A;  2E1M A;  2KGE A;  2KGA A;  1NQ4 A;  2M8N A;  1VQM P;  4XFY A;  3CXC O;  5F2O A;  2L0Q A;  2KG8 A;  3G6E P;  5JPA A;  2N6Z A;  3DS5 A;  4GR2 A;  3CCJ P;  2PNG A;  4U0B A;  3H0D A;  1VQN P;  4CA3 A;  5HGN A;  3CCS P;  3OW2 O;  4PXH B;  2OAR A;  3DS0 A;  1YJ9 P;  1K73 Q;  3GKL C;  2LOL A;  3P05 A;  3DTJ A;  3G71 P;  2L22 A;  2QEX P;  3DS1 A;  1VQ4 P;  2EHT A;  2JGP A;  2K93 A;  2N98 A;  5EW5 E;  2CNR A;  2MD9 A;  2KG6 A;  3NY7 B;  3LMO A;  1VQP P;  4PH1 A;  2JO0 A;  7CEI A;  2M5R A;  5BS2 A;  1M1K Q;  4XRQ A;  2GYK A;  2XZ1 C;  2BUO A;  2N6Y A;  1VKU A;  3U43 A;  2Z44 A;  3DS3 A;  2JB0 A;  2JAZ A;  2JU2 A;  3I56 P;  4BPF A;  3EJB A;  1AYI A;  2LML A;  4HKG A;  3CCU P;  4COC A;  2GDW A;  2VLN A;  4F37 A;  2FAD A;  2AF8 A;  4R0M A;  1F80 D;  1EOQ A;  4PH0 A;  2M8L A;  2WPT A;  2JBG A;  3DPH A;  1M90 Q;  1M6N A;  3CCQ P;  1HY8 A;  2PEI A;  2KG9 A;  1VQ8 P;  3CPW O;  2PEJ A;  3CC4 P;  4IPY A;  2GZJ A;  4COP A;  3CMA P;  1UNK A;  4DG9 A;  1Z6M A;  1YHQ P;  2JYL A;  2PEQ A;  2GDX A;  2ONT A;  2XXM A;  3GZL A;  4H2W C;  2BHV A;  3B5I A;  2M8P A;  2P9X A;  1RO0 A;  3RG2 A;  1QRJ A;  3CC2 P;  1RNI A;  2GZF A;  2FQ1 A;  1BXI A;  5F2K A;  2PY8 A;  2K0D X;  2JQ4 A;  1X3O A;  5EJD A;  1VQ9 P;  1Q7Y Q;  1NJI Q;  4MRT C;  3EJD A;  3DS2 A;  2GZG A;  1MZ8 A;  3EJE A;  1KQS O;  4QNB A;  3HZQ A;  4U0E A;  3H47 A;  2EG5 A;  2FAE A;  3CCL P;  2PEO A;  1VQ6 P;  3MGE A;  2MR7 A;  1VQL P;  3LRY A;  4WYM A;  3VRL C;  1IUQ A;  1YJN P;  1Q82 Q;  1K8A Q;  5HVC A;  1BAJ A;  2Z46 A;  2FVA A;  4IZ6 A;  2FQ0 A;  2JU1 A;  3M1M A;  1OR5 A;  1GXH A;  3CCM P;  4XRO A;  1A8O A;  1QVF O;  4XFZ A;  5HGO A;  1T8K A;  1Q81 Q;  5HGL A;  1D1D A;  1VQ7 P;  1EIA A;  4H2X C;  2LKI A;  3E2D A;  2MVU A;  2VLO A;  2KGC A;  3I55 P;  5KP7 B;  1M6E X;  5BS1 A;  1FR2 A;  2FQ2 A;  3CE7 A;  2KW2 A;  1DNY A;  2L4B A;  4XFX A;  2VSQ A;  2AFD A;  2LIW A;  3WBH A;  3G26 A;  2X2B A;  5F2N A;  5KP8 B;  2N5H A;  2N50 A;  1UJZ A;  1E6J P;  2K92 A;  2KOP A;  2PEN A;  3DS4 A;  4UHP B;  1YIJ P;  1YJW P;  1AUM A;  2CGQ A;  2FVE A;  1RO2 A;  2KOQ A;  1VQ5 P;  2KOR A;  3GZM A;  2L9F A;  2ERH A;  1GXG A;  3G1G A;  3G29 A;  2CWO A;  2CQ8 A;  1L0I A;  2K0Y A;  3HYB A;  2K2Q A;  5KP6 B;  1KC8 Q;  3CC7 P;  2DNW A;  4U0D A;  3B4Q A;  1L0H A;  3G0V A;  2FAC A;  1K30 A;  2KWL A;  2CG5 B;  2L6E A;  1VHN A;  3CCE P;  2GDY A;  2GZI A;  2LF4 A;  2Z45 A;  1AF8 A;  1YIT P;  2PEK A;  3G21 A;  1W2B O;  1CEI A;  2LPK A;  5I4T G;  4U0C A;  3RG6 C;  2MF4 A;  1M74 A;  2EHS A;  4QKO A;  1VQK P;  1N8R Q;  1ACP A;  3GJN A;  2KOO A;  1A43 A;  1ZMB A;  2MR8 A;  5HGM A;  2OTJ P;  1QVG O;  2FHS C;  3Q20 A;  1KLP A;  1JJ2 O;  1VQO P;  4U0F A;  5HV8 A;  1IMP A;  2LL8 A;  4NEO A;  2NO8 A;  2AFE A;  2MY5 A;  1KD1 Q;  4PWV B;  3G28 A;  2FVF A;  2KGD A;  2LTE A;  5DCK A;  3CCV P;  3CME P;  1IMQ A;  2EIA A;  4GR6 A;  2GZE A;  2K94 A;  2ROQ A;  2KR5 A;  2N5I A;  1DV5 A;  2XZ0 D;  1EMV A;  2KOS A;  2QNW A;  4H2Y C;  2K0X A;  3CD6 P; 
#chains in the Genus database with same CATH homology
 3EJE A;  1HQB A;  2AVA A;  2CQ8 A;  1L0I A;  2XZ1 C;  4BPG A;  2FAE A;  2K0Y A;  2LIU A;  2K2Q A;  2N6Y A;  1VKU A;  5KP6 B;  2DNW A;  1L0H A;  2MR7 A;  2FAC A;  2KWL A;  5CZD B;  2CG5 B;  2JU2 A;  4BPF A;  4BPH A;  3EJB A;  5HVC A;  2GDY A;  2LML A;  4HKG A;  4IZ6 A;  2FVA A;  2MVV A;  2FQ0 A;  2JU1 A;  2GDW A;  1OR5 A;  1AF8 A;  2FAD A;  2LPK A;  2AF8 A;  1T8K A;  2KGE A;  4R0M A;  2KGA A;  1NQ4 A;  1F80 D;  4H2X C;  2LKI A;  2MF4 A;  2MVU A;  2L0Q A;  2KGC A;  2EHS A;  2KG8 A;  1ACP A;  1HY8 A;  5KP7 B;  2KG9 A;  2KOO A;  2FQ2 A;  2MR8 A;  3CE7 A;  2KW2 A;  2N6Z A;  1DNY A;  2L4B A;  2VSQ A;  2AFD A;  2PNG A;  2FHS C;  2LIW A;  1KLP A;  4CA3 A;  2X2B A;  4DG9 A;  5KP8 B;  2N5H A;  4PXH B;  2GDX A;  2N50 A;  3GZL A;  4H2W C;  5HV8 A;  2LL8 A;  4NEO A;  2AFE A;  2LOL A;  2MY5 A;  2K92 A;  2KOP A;  3RG2 A;  4PWV B;  2FVF A;  2KGD A;  2L22 A;  2LTE A;  2CGQ A;  2FVE A;  2K94 A;  2ROQ A;  2EHT A;  2FQ1 A;  2KOQ A;  2JGP A;  2KR5 A;  2K93 A;  2N98 A;  2N5I A;  1DV5 A;  2KOR A;  2JQ4 A;  2XZ0 D;  2CNR A;  1X3O A;  3GZM A;  2MD9 A;  5EJD A;  2KG6 A;  2L9F A;  3NY7 B;  2KOS A;  2QNW A;  3LMO A;  4MRT C;  3EJD A;  4H2Y C;  2K0X A;  2M5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...