2GDYA

Solution structure of the b. brevis tycc3-pcp in a-state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/transport protein
molecule keywords Tyrocidine synthetase III
publication title Conformational switches modulate protein interactions in peptide antibiotic synthetases
pubmed doi rcsb
source organism Brevibacillus parabrevis
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2gdyA01
5EJDA 2L4BA 1OR5A 1ACPA 2FVEA 1DNYA 2FACA 2K94A 2MY5A 2L0QA 2MVUA 2JQ4A 1DV5A 4BPHA 2CQ8A 2L9FA 2N5HA 2LMLA 2KORA 2FHSC 2KG8A 4H2WC 4CA3A 2KGDA 2FADA 3GZLA 4PWVB 2CGQA 4H2YC 2KG6A 1T8KA 2GDYA 5HVCA 2MF4A 5KP8B 2N6ZA 2JGPA 1L0IA 1F80D 2CNRA 2KGAA 2N5IA 2XZ1C 2KWLA 2X2BA 3LMOA 2KR5A 2KGEA 2N98A 2QNWA 2ROQA 1KLPA 4NEOA 2FVAA 2K92A 2VSQA 2LOLA 2LPKA 5KP6B 5HV8A 2K2QA 3CE7A 2AFEA 3EJDA 2K0YA 2KOSA 5KP7B 2DNWA 2FQ2A 2KOOA 2MR8A 2JU2A 2FVFA 2KGCA 2FAEA 1X3OA 4BPFA 4HKGA 2FQ0A 3NY7B 2CG5B 3EJBA 2KOPA 4PXHB 2N50A 3EJEA 4MRTC 2N6YA 1NQ4A 1HQBA 4BPGA 5CZDB 2AVAA 2FQ1A 2K0XA 2KG9A 2K93A 2PNGA 4H2XC 2KOQA 2LTEA 2XZ0D 4IZ6A 2MD9A 2GDWA 3RG2A 4R0MA 2AF8A 2EHSA 2LL8A 1VKUA 2KW2A 2MVVA 3GZMA 2EHTA 2JU1A 2GDXA 2L22A 2AFDA 2LKIA 2M5RA 2LIWA 1L0HA 1HY8A 2LIUA 4DG9A 1AF8A 2MR7A
chains in the Genus database with same CATH superfamily
1OR5A 1ACPA 1M74A 3VRLC 2BUOA 5F2NA 2MY5A 2L0QA 2MVUA 3CCRP 3E2DA 2KORA 2FHSC 1FR2A 4PWVB 2PEIA 1A43A 3CD6P 4H2YC 3NTEA 2MF4A 3G1GA 2K5XA 5I4TG 2KGAA 2M8NA 2WPTA 1Q86Q 1UNKA 4XFXA 2XV6A 3HYBA 4XRQA 1KLPA 1VQPP 2VSQA 1AYIA 1K8AQ 2EG5A 2K2QA 2EIAA 1IUQA 4PH1A 3EJDA 1YITP 1QRJA 2VLNA 2E1MA 3EJBA 3G6EP 2KOPA 3G21A 1KC8Q 1Z6MA 4PXHB 2N50A 4MRTC 1YJWP 2PEJA 2N6YA 1VQ9P 5HGNA 4BPGA 5BS1A 2FQ1A 4H2XC 1RNIA 3Q20A 2KOQA 1ZNVA 2MD9A 3G0VA 2EHSA 2GZEA 3GZMA 2MVVA 4PH0A 2ONTA 2PEKA 2JU1A 4XFYA 2LIWA 2ERHA 2LIUA 3CCEP 2L4BA 1Q81Q 3G4SP 3HZQA 3DS4A 2K94A 3DS3A 1EIAA 1VQ8P 4COCA 2OARA 2N5HA 3H47A 2LMLA 4XROA 4F37A 3WBHA 2KG8A 2JO0A 4H2WC 3GZLA 1YI2P 4U0EA 5HGLA 2CWOA 5HVCA 2JB0A 2JGPA 4U0FA 3DPHA 2OTLP 4UHPB 2N5IA 2VLPA 2X2BA 3LMOA 2XT1A 3CC7P 2JYLA 2N98A 1IMPA 2GZGA 3RG6C 2ROQA 2K92A 1M1KQ 5KP6B 1W2BO 1CEIA 2KOOA 3U43A 3I56P 2M8LA 2PY8A 1S72P 2DGYA 2JBGA 2K0XA 2PNGA 2Z44A 3I55P 2LF4A 2LTEA 2GDWA 3GKLC 3H4EA 1N8RQ 3CMEP 5BS2A 2GDXA 2L22A 2AFDA 2LKIA 2M5RA 1K9MQ 3CCSP 4WYMA 3DS2A 2Z46A 2EFJA 1AF8A 2MR7A 5EJDA 3MGEA 3B5IA 2FVEA 1UJZA 2FACA 2K0DX 1Q82Q 2JYGA 1DV5A 2CQ8A 2OTJP 1IMQA 1M6EX 1M90Q 2KGDA 2FADA 1NJIQ 2KG6A 2GDYA 1VQKP 1L0IA 1GPJA 1F80D 2CNRA 1D1DA 2KGEA 1ZMBA 4NEOA 2Z45A 1QVGO 2LOLA 2LPKA 2GYKA 3DS0A 3CE7A 3CMAP 1Q7YQ 2AFEA 2K0YA 2GZFA 2VLOA 3CPWO 3CCVP 5F2KA 2JU2A 2FVFA 2KGCA 2FAEA 4BPFA 2CG5B 3H0DA 1K73Q 1K30A 3EJEA 4U0DA 4U0BA 1VQLP 3CC2P 2AVAA 3GJNA 1VHNA 2JAZA 5F2OA 2K93A 1YJ9P 3DS1A 2PEOA 4IZ6A 3RG2A 3CCUP 1VQ7P 2AF8A 4U0AA 1GXHA 2LL8A 1VKUA 2KW2A 3CCMP 2EHTA 1MZ8A 2NO8A 4M0IA 1HY8A 2QEXP 2P9XA 1DNYA 3LRYA 3M1MA 3G71P 1VQ5P 4COPA 1EOQA 1EMVA 2PEMA 2JQ4A 4BPHA 1YJNP 2L9FA 1VQ4P 1BXIA 2GZIA 4IPYA 1VQOP 5EW5E 1RO2A 1JJ2O 3CCLP 3G1IA 4CA3A 1VQMP 2CGQA 3CCQP 1T8KA 5KP8B 3OW2O 2N6ZA 5HGOA 2PENA 2XZ1C 3CXCO 2QA4P 2KWLA 3DS5A 2KR5A 1GXGA 2BHVA 2QNWA 2FVAA 2M8PA 5DCKA 2GZJA 1E6JP 1KD1Q 5HV8A 3CCJP 5JPAA 2L6EA 4U0CA 2KOSA 5KP7B 2DNWA 2FQ2A 2MR8A 1E0HA 1VQ6P 2VLQA 4GR2A 1A8OA 1X3OA 4HKGA 1YIJP 2FQ0A 1KQSO 3NY7B 3P05A 2KODA 7CEIA 3G28A 3DTJA 3CC4P 1NQ4A 1HQBA 5CZDB 4QKOA 2KG9A 2XXMA 1BAJA 2XZ0D 1RO0A 4GR6A 4R0MA 1YHQP 3G29A 3G26A 2PEQA 1L0HA 5HGMA 1M6NA 1AUMA 3B4QA 1VQNP 1QVFO 4QNBA 4DG9A 4XFZA
chains in the Genus database with same CATH topology
5EJDA 2L4BA 1OR5A 1ACPA 2FVEA 1DNYA 2FACA 2K94A 2MY5A 2L0QA 2MVUA 2JQ4A 1DV5A 4BPHA 2CQ8A 2L9FA 2N5HA 2LMLA 2KORA 2FHSC 2KG8A 4H2WC 4CA3A 2KGDA 2FADA 3GZLA 4PWVB 2CGQA 4H2YC 2KG6A 1T8KA 2GDYA 5HVCA 2MF4A 5KP8B 2N6ZA 2JGPA 1L0IA 1F80D 2CNRA 2KGAA 2N5IA 2XZ1C 2KWLA 2X2BA 3LMOA 2KR5A 2KGEA 2N98A 2QNWA 2ROQA 1KLPA 4NEOA 2FVAA 2K92A 2VSQA 2LOLA 2LPKA 5KP6B 5HV8A 2K2QA 3CE7A 2AFEA 3EJDA 2K0YA 2KOSA 5KP7B 2DNWA 2FQ2A 2KOOA 2MR8A 2JU2A 2FVFA 2KGCA 2FAEA 1X3OA 4BPFA 4HKGA 2FQ0A 3NY7B 2CG5B 3EJBA 2KOPA 4PXHB 2N50A 3EJEA 4MRTC 2N6YA 1NQ4A 1HQBA 4BPGA 5CZDB 2AVAA 2FQ1A 2K0XA 2KG9A 2K93A 2PNGA 4H2XC 2KOQA 2LTEA 2XZ0D 4IZ6A 2MD9A 2GDWA 3RG2A 4R0MA 2AF8A 2EHSA 2LL8A 1VKUA 2KW2A 2MVVA 3GZMA 2EHTA 2JU1A 2GDXA 2L22A 2AFDA 2LKIA 2M5RA 2LIWA 1L0HA 1HY8A 2LIUA 4DG9A 1AF8A 2MR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EJD A;  2L4B A;  1OR5 A;  1ACP A;  2FVE A;  1DNY A;  2FAC A;  2K94 A;  2MY5 A;  2L0Q A;  2MVU A;  2JQ4 A;  1DV5 A;  4BPH A;  2CQ8 A;  2L9F A;  2N5H A;  2LML A;  2KOR A;  2FHS C;  2KG8 A;  4H2W C;  4CA3 A;  2KGD A;  2FAD A;  3GZL A;  4PWV B;  2CGQ A;  4H2Y C;  2KG6 A;  1T8K A;  2GDY A;  5HVC A;  2MF4 A;  5KP8 B;  2N6Z A;  2JGP A;  1L0I A;  1F80 D;  2CNR A;  2KGA A;  2N5I A;  2XZ1 C;  2KWL A;  2X2B A;  3LMO A;  2KR5 A;  2KGE A;  2N98 A;  2QNW A;  2ROQ A;  1KLP A;  4NEO A;  2FVA A;  2K92 A;  2VSQ A;  2LOL A;  2LPK A;  5KP6 B;  5HV8 A;  2K2Q A;  3CE7 A;  2AFE A;  3EJD A;  2K0Y A;  2KOS A;  5KP7 B;  2DNW A;  2FQ2 A;  2KOO A;  2MR8 A;  2JU2 A;  2FVF A;  2KGC A;  2FAE A;  1X3O A;  4BPF A;  4HKG A;  2FQ0 A;  3NY7 B;  2CG5 B;  3EJB A;  2KOP A;  4PXH B;  2N50 A;  3EJE A;  4MRT C;  2N6Y A;  1NQ4 A;  1HQB A;  4BPG A;  5CZD B;  2AVA A;  2FQ1 A;  2K0X A;  2KG9 A;  2K93 A;  2PNG A;  4H2X C;  2KOQ A;  2LTE A;  2XZ0 D;  4IZ6 A;  2MD9 A;  2GDW A;  3RG2 A;  4R0M A;  2AF8 A;  2EHS A;  2LL8 A;  1VKU A;  2KW2 A;  2MVV A;  3GZM A;  2EHT A;  2JU1 A;  2GDX A;  2L22 A;  2AFD A;  2LKI A;  2M5R A;  2LIW A;  1L0H A;  1HY8 A;  2LIU A;  4DG9 A;  1AF8 A;  2MR7 A; 
#chains in the Genus database with same CATH topology
 1OR5 A;  1ACP A;  1M74 A;  3VRL C;  2BUO A;  5F2N A;  2MY5 A;  2L0Q A;  2MVU A;  3CCR P;  3E2D A;  2KOR A;  2FHS C;  1FR2 A;  4PWV B;  2PEI A;  1A43 A;  3CD6 P;  4H2Y C;  3NTE A;  2MF4 A;  3G1G A;  2K5X A;  5I4T G;  2KGA A;  2M8N A;  2WPT A;  1Q86 Q;  1UNK A;  4XFX A;  2XV6 A;  3HYB A;  4XRQ A;  1KLP A;  1VQP P;  2VSQ A;  1AYI A;  1K8A Q;  2EG5 A;  2K2Q A;  2EIA A;  1IUQ A;  4PH1 A;  3EJD A;  1YIT P;  1QRJ A;  2VLN A;  2E1M A;  3EJB A;  3G6E P;  2KOP A;  3G21 A;  1KC8 Q;  1Z6M A;  4PXH B;  2N50 A;  4MRT C;  1YJW P;  2PEJ A;  2N6Y A;  1VQ9 P;  5HGN A;  4BPG A;  5BS1 A;  2FQ1 A;  4H2X C;  1RNI A;  3Q20 A;  2KOQ A;  1ZNV A;  2MD9 A;  3G0V A;  2EHS A;  2GZE A;  3GZM A;  2MVV A;  4PH0 A;  2ONT A;  2PEK A;  2JU1 A;  4XFY A;  2LIW A;  2ERH A;  2LIU A;  3CCE P;  2L4B A;  1Q81 Q;  3G4S P;  3HZQ A;  3DS4 A;  2K94 A;  3DS3 A;  1EIA A;  1VQ8 P;  4COC A;  2OAR A;  2N5H A;  3H47 A;  2LML A;  4XRO A;  4F37 A;  3WBH A;  2KG8 A;  2JO0 A;  4H2W C;  3GZL A;  1YI2 P;  4U0E A;  5HGL A;  2CWO A;  5HVC A;  2JB0 A;  2JGP A;  4U0F A;  3DPH A;  2OTL P;  4UHP B;  2N5I A;  2VLP A;  2X2B A;  3LMO A;  2XT1 A;  3CC7 P;  2JYL A;  2N98 A;  1IMP A;  2GZG A;  3RG6 C;  2ROQ A;  2K92 A;  1M1K Q;  5KP6 B;  1W2B O;  1CEI A;  2KOO A;  3U43 A;  3I56 P;  2M8L A;  2PY8 A;  1S72 P;  2DGY A;  2JBG A;  2K0X A;  2PNG A;  2Z44 A;  3I55 P;  2LF4 A;  2LTE A;  2GDW A;  3GKL C;  3H4E A;  1N8R Q;  3CME P;  5BS2 A;  2GDX A;  2L22 A;  2AFD A;  2LKI A;  2M5R A;  1K9M Q;  3CCS P;  4WYM A;  3DS2 A;  2Z46 A;  2EFJ A;  1AF8 A;  2MR7 A;  5EJD A;  3MGE A;  3B5I A;  2FVE A;  1UJZ A;  2FAC A;  2K0D X;  1Q82 Q;  2JYG A;  1DV5 A;  2CQ8 A;  2OTJ P;  1IMQ A;  1M6E X;  1M90 Q;  2KGD A;  2FAD A;  1NJI Q;  2KG6 A;  2GDY A;  1VQK P;  1L0I A;  1GPJ A;  1F80 D;  2CNR A;  1D1D A;  2KGE A;  1ZMB A;  4NEO A;  2Z45 A;  1QVG O;  2LOL A;  2LPK A;  2GYK A;  3DS0 A;  3CE7 A;  3CMA P;  1Q7Y Q;  2AFE A;  2K0Y A;  2GZF A;  2VLO A;  3CPW O;  3CCV P;  5F2K A;  2JU2 A;  2FVF A;  2KGC A;  2FAE A;  4BPF A;  2CG5 B;  3H0D A;  1K73 Q;  1K30 A;  3EJE A;  4U0D A;  4U0B A;  1VQL P;  3CC2 P;  2AVA A;  3GJN A;  1VHN A;  2JAZ A;  5F2O A;  2K93 A;  1YJ9 P;  3DS1 A;  2PEO A;  4IZ6 A;  3RG2 A;  3CCU P;  1VQ7 P;  2AF8 A;  4U0A A;  1GXH A;  2LL8 A;  1VKU A;  2KW2 A;  3CCM P;  2EHT A;  1MZ8 A;  2NO8 A;  4M0I A;  1HY8 A;  2QEX P;  2P9X A;  1DNY A;  3LRY A;  3M1M A;  3G71 P;  1VQ5 P;  4COP A;  1EOQ A;  1EMV A;  2PEM A;  2JQ4 A;  4BPH A;  1YJN P;  2L9F A;  1VQ4 P;  1BXI A;  2GZI A;  4IPY A;  1VQO P;  5EW5 E;  1RO2 A;  1JJ2 O;  3CCL P;  3G1I A;  4CA3 A;  1VQM P;  2CGQ A;  3CCQ P;  1T8K A;  5KP8 B;  3OW2 O;  2N6Z A;  5HGO A;  2PEN A;  2XZ1 C;  3CXC O;  2QA4 P;  2KWL A;  3DS5 A;  2KR5 A;  1GXG A;  2BHV A;  2QNW A;  2FVA A;  2M8P A;  5DCK A;  2GZJ A;  1E6J P;  1KD1 Q;  5HV8 A;  3CCJ P;  5JPA A;  2L6E A;  4U0C A;  2KOS A;  5KP7 B;  2DNW A;  2FQ2 A;  2MR8 A;  1E0H A;  1VQ6 P;  2VLQ A;  4GR2 A;  1A8O A;  1X3O A;  4HKG A;  1YIJ P;  2FQ0 A;  1KQS O;  3NY7 B;  3P05 A;  2KOD A;  7CEI A;  3G28 A;  3DTJ A;  3CC4 P;  1NQ4 A;  1HQB A;  5CZD B;  4QKO A;  2KG9 A;  2XXM A;  1BAJ A;  2XZ0 D;  1RO0 A;  4GR6 A;  4R0M A;  1YHQ P;  3G29 A;  3G26 A;  2PEQ A;  1L0H A;  5HGM A;  1M6N A;  1AUM A;  3B4Q A;  1VQN P;  1QVF O;  4QNB A;  4DG9 A;  4XFZ A; 
#chains in the Genus database with same CATH homology
 5EJD A;  2L4B A;  1OR5 A;  1ACP A;  2FVE A;  1DNY A;  2FAC A;  2K94 A;  2MY5 A;  2L0Q A;  2MVU A;  2JQ4 A;  1DV5 A;  4BPH A;  2CQ8 A;  2L9F A;  2N5H A;  2LML A;  2KOR A;  2FHS C;  2KG8 A;  4H2W C;  4CA3 A;  2KGD A;  2FAD A;  3GZL A;  4PWV B;  2CGQ A;  4H2Y C;  2KG6 A;  1T8K A;  2GDY A;  5HVC A;  2MF4 A;  5KP8 B;  2N6Z A;  2JGP A;  1L0I A;  1F80 D;  2CNR A;  2KGA A;  2N5I A;  2XZ1 C;  2KWL A;  2X2B A;  3LMO A;  2KR5 A;  2KGE A;  2N98 A;  2QNW A;  2ROQ A;  1KLP A;  4NEO A;  2FVA A;  2K92 A;  2VSQ A;  2LOL A;  2LPK A;  5KP6 B;  5HV8 A;  2K2Q A;  3CE7 A;  2AFE A;  3EJD A;  2K0Y A;  2KOS A;  5KP7 B;  2DNW A;  2FQ2 A;  2KOO A;  2MR8 A;  2JU2 A;  2FVF A;  2KGC A;  2FAE A;  1X3O A;  4BPF A;  4HKG A;  2FQ0 A;  3NY7 B;  2CG5 B;  3EJB A;  2KOP A;  4PXH B;  2N50 A;  3EJE A;  4MRT C;  2N6Y A;  1NQ4 A;  1HQB A;  4BPG A;  5CZD B;  2AVA A;  2FQ1 A;  2K0X A;  2KG9 A;  2K93 A;  2PNG A;  4H2X C;  2KOQ A;  2LTE A;  2XZ0 D;  4IZ6 A;  2MD9 A;  2GDW A;  3RG2 A;  4R0M A;  2AF8 A;  2EHS A;  2LL8 A;  1VKU A;  2KW2 A;  2MVV A;  3GZM A;  2EHT A;  2JU1 A;  2GDX A;  2L22 A;  2AFD A;  2LKI A;  2M5R A;  2LIW A;  1L0H A;  1HY8 A;  2LIU A;  4DG9 A;  1AF8 A;  2MR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...