2GDYA

Solution structure of the b. brevis tycc3-pcp in a-state
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
MGVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational switches modulate protein interactions in peptide antibiotic synthetases
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase/transport protein
molecule keywords Tyrocidine synthetase III
total genus 15
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2gdyA01
2JU1A 4H2XC 4HKGA 4PWVB 2M5RA 2K94A 3LMOA 4IZ6A 2FQ1A 2MY5A 2L9FA 1VKUA 2KOQA 2AF8A 2K92A 2GDXA 2N5HA 2K0YA 4PXHB 2MVVA 2VSQA 3RG2A 4BPFA 2LOLA 4MRTC 1L0HA 2LPKA 1HQBA 2AFDA 2QNWA 2FADA 1KLPA 4H2YC 2AVAA 5KP8B 1NQ4A 4CA3A 2N6ZA 2KGCA 2JQ4A 5CZDB 2LMLA 2PNGA 2FACA 2KOPA 2JU2A 2AFEA 1ACPA 1X3OA 2CGQA 2KG6A 2XZ0D 2L0QA 3GZLA 3EJEA 2LTEA 2EHTA 2FVFA 2KGEA 2MR7A 2CQ8A 3CE7A 2KG8A 1OR5A 2L22A 1HY8A 2K2QA 2FAEA 2N5IA 2N98A 4NEOA 5KP7B 2N50A 2X2BA 2KGAA 2KORA 4R0MA 1DNYA 2L4BA 2GDYA 2MVUA 2KW2A 2ROQA 2FHSC 3EJBA 2LIUA 2LKIA 2KGDA 2XZ1C 4BPGA 1F80D 2N6YA 2FQ2A 2MR8A 2KOOA 3EJDA 2K93A 2KWLA 4H2WC 2K0XA 2DNWA 4BPHA 2CG5B 2FVEA 3NY7B 2JGPA 2KOSA 1T8KA 2LL8A 5HV8A 4DG9A 2LIWA 5EJDA 2GDWA 1DV5A 2FVAA 5KP6B 2EHSA 2KR5A 1AF8A 2MD9A 2FQ0A 1L0IA 5HVCA 3GZMA 2CNRA 2KG9A 2MF4A
chains in the Genus database with same CATH superfamily
5F2OA 1IUQA 4HKGA 3WBHA 4XROA 1Q82Q 2L9FA 1VQ6P 2K0YA 1QRJA 3NTEA 1K73Q 4XFYA 2QNWA 1KLPA 1A8OA 3CPWO 4H2YC 5KP8B 3CD6P 2PEOA 5F2KA 2QEXP 2KGCA 3DS5A 4U0DA 1FR2A 4COPA 1ACPA 4UHPB 2LTEA 4U0BA 2Z46A 2JO0A 3DS2A 3CCMP 2KG8A 1Z6MA 1M6NA 3I55P 2L22A 1HY8A 1Q81Q 1W2BO 3CCUP 1A43A 2N50A 4U0AA 4IPYA 3P05A 3G21A 2KW2A 3EJBA 2DGYA 4XRQA 3RG6C 2CWOA 1RO0A 1F80D 2N6YA 5F2NA 1ZNVA 2VLQA 1M90Q 2PEMA 2OTJP 2E1MA 5BS2A 2JGPA 2PEKA 2LL8A 3B5IA 5BS1A 2L6EA 1M1KQ 1VQNP 1AF8A 3CCSP 2FQ0A 3CCQP 2KODA 2CNRA 2KG9A 3HZQA 1YJNP 1E6JP 3G6EP 2OARA 3CCJP 2GZIA 1YI2P 2KOQA 2PEIA 1VQMP 1YHQP 1QVGO 3CCEP 3CMEP 5HGOA 4PXHB 1YITP 3RG2A 4BPFA 1D1DA 2LOLA 1KQSO 1VQ8P 2AFDA 2FADA 2JB0A 2AVAA 2K5XA 1YJWP 1NQ4A 3GJNA 1UNKA 4QNBA 3H0DA 2JAZA 2ONTA 3DS3A 2M8PA 4XFXA 2XXMA 3CMAP 1M74A 2MR7A 3E2DA 3CE7A 1AYIA 1OR5A 2K2QA 2N5IA 2FAEA 3CXCO 2N98A 2XV6A 2M8LA 4R0MA 3G26A 2GDYA 2ROQA 2EG5A 2XZ1C 2PEQA 2MR8A 2Z44A 2K93A 3H47A 1YJ9P 3G0VA 4BPHA 1ZMBA 1K8AQ 2FVEA 2BUOA 3OW2O 1VQ4P 2JYGA 5HV8A 4DG9A 1VQPP 4PH0A 5EJDA 2GDWA 2ERHA 3CC4P 2KR5A 2M8NA 3CC7P 2NO8A 1YIJP 2JU1A 4H2XC 2M5RA 4IZ6A 4XFZA 3DS1A 1EMVA 1RO2A 2AF8A 4M0IA 2GDXA 2VLNA 3DTJA 1CEIA 2JBGA 2MVVA 5DCKA 2GZEA 1Q7YQ 1L0HA 3G1GA 3MGEA 5I4TG 4U0CA 2P9XA 2XT1A 1S72P 4CA3A 2JQ4A 2FACA 3CCRP 5EW5E 2KOPA 1KC8Q 2JU2A 2CGQA 2XZ0D 2L0QA 3EJEA 3G28A 2EHTA 2Z45A 1EOQA 2VLPA 2FVFA 1QVFO 2CQ8A 2WPTA 1Q86Q 2BHVA 3Q20A 1DNYA 1VHNA 2L4BA 4GR2A 2FHSC 2LIUA 1GXHA 3G29A 1MZ8A 1UJZA 3G4SP 2EIAA 3CC2P 2FQ2A 2GYKA 3VRLC 4H2WC 2K0XA 2DNWA 1M6EX 1GXGA 2CG5B 2KOSA 1VQOP 2LIWA 1DV5A 2FVAA 3DPHA 1EIAA 2LF4A 3CCVP 1L0IA 5JPAA 1NJIQ 1N8RQ 2MF4A 2EFJA 1E0HA 4PWVB 3HYBA 2K94A 3LMOA 4U0EA 2FQ1A 1K30A 2MY5A 1BXIA 1VKUA 2GZGA 2OTLP 2K92A 1RNIA 1VQKP 2N5HA 2JYLA 1IMPA 2VSQA 2PY8A 4MRTC 3U43A 3G71P 2LPKA 1HQBA 3H4EA 4GR6A 4WYMA 4COCA 2N6ZA 5HGNA 4QKOA 5CZDB 2LMLA 2PNGA 2PENA 3M1MA 1VQ9P 2AFEA 2K0DX 1X3OA 3GKLC 2KG6A 4PH1A 3GZLA 3LRYA 3CCLP 7CEIA 1GPJA 2KGEA 3DS4A 2GZJA 4NEOA 1K9MQ 5KP7B 2X2BA 2KGAA 2KORA 2MVUA 1VQ5P 5HGLA 3B4QA 2LKIA 2KGDA 2QA4P 4F37A 3DS0A 2VLOA 4BPGA 1JJ2O 1KD1Q 5HGMA 2KOOA 3EJDA 1VQLP 2KWLA 3I56P 1AUMA 1VQ7P 3NY7B 1T8KA 1BAJA 3G1IA 4U0FA 5KP6B 2EHSA 2MD9A 5HVCA 3GZMA 2GZFA 1IMQA 2PEJA
chains in the Genus database with same CATH topology
2JU1A 4H2XC 4HKGA 4PWVB 2M5RA 2K94A 3LMOA 4IZ6A 2FQ1A 2MY5A 2L9FA 1VKUA 2KOQA 2AF8A 2K92A 2GDXA 2N5HA 2K0YA 4PXHB 2MVVA 2VSQA 3RG2A 4BPFA 2LOLA 4MRTC 1L0HA 2LPKA 1HQBA 2AFDA 2QNWA 2FADA 1KLPA 4H2YC 2AVAA 5KP8B 1NQ4A 4CA3A 2N6ZA 2KGCA 2JQ4A 5CZDB 2LMLA 2PNGA 2FACA 2KOPA 2JU2A 2AFEA 1ACPA 1X3OA 2CGQA 2KG6A 2XZ0D 2L0QA 3GZLA 3EJEA 2LTEA 2EHTA 2FVFA 2KGEA 2MR7A 2CQ8A 3CE7A 2KG8A 1OR5A 2L22A 1HY8A 2K2QA 2FAEA 2N5IA 2N98A 4NEOA 5KP7B 2N50A 2X2BA 2KGAA 2KORA 4R0MA 1DNYA 2L4BA 2GDYA 2MVUA 2KW2A 2ROQA 2FHSC 3EJBA 2LIUA 2LKIA 2KGDA 2XZ1C 4BPGA 1F80D 2N6YA 2FQ2A 2MR8A 2KOOA 3EJDA 2K93A 2KWLA 4H2WC 2K0XA 2DNWA 4BPHA 2CG5B 2FVEA 3NY7B 2JGPA 2KOSA 1T8KA 2LL8A 5HV8A 4DG9A 2LIWA 5EJDA 2GDWA 1DV5A 2FVAA 5KP6B 2EHSA 2KR5A 1AF8A 2MD9A 2FQ0A 1L0IA 5HVCA 3GZMA 2CNRA 2KG9A 2MF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JU1 A;  4H2X C;  4HKG A;  4PWV B;  2M5R A;  2K94 A;  3LMO A;  4IZ6 A;  2FQ1 A;  2MY5 A;  2L9F A;  1VKU A;  2KOQ A;  2AF8 A;  2K92 A;  2GDX A;  2N5H A;  2K0Y A;  4PXH B;  2MVV A;  2VSQ A;  3RG2 A;  4BPF A;  2LOL A;  4MRT C;  1L0H A;  2LPK A;  1HQB A;  2AFD A;  2QNW A;  2FAD A;  1KLP A;  4H2Y C;  2AVA A;  5KP8 B;  1NQ4 A;  4CA3 A;  2N6Z A;  2KGC A;  2JQ4 A;  5CZD B;  2LML A;  2PNG A;  2FAC A;  2KOP A;  2JU2 A;  2AFE A;  1ACP A;  1X3O A;  2CGQ A;  2KG6 A;  2XZ0 D;  2L0Q A;  3GZL A;  3EJE A;  2LTE A;  2EHT A;  2FVF A;  2KGE A;  2MR7 A;  2CQ8 A;  3CE7 A;  2KG8 A;  1OR5 A;  2L22 A;  1HY8 A;  2K2Q A;  2FAE A;  2N5I A;  2N98 A;  4NEO A;  5KP7 B;  2N50 A;  2X2B A;  2KGA A;  2KOR A;  4R0M A;  1DNY A;  2L4B A;  2GDY A;  2MVU A;  2KW2 A;  2ROQ A;  2FHS C;  3EJB A;  2LIU A;  2LKI A;  2KGD A;  2XZ1 C;  4BPG A;  1F80 D;  2N6Y A;  2FQ2 A;  2MR8 A;  2KOO A;  3EJD A;  2K93 A;  2KWL A;  4H2W C;  2K0X A;  2DNW A;  4BPH A;  2CG5 B;  2FVE A;  3NY7 B;  2JGP A;  2KOS A;  1T8K A;  2LL8 A;  5HV8 A;  4DG9 A;  2LIW A;  5EJD A;  2GDW A;  1DV5 A;  2FVA A;  5KP6 B;  2EHS A;  2KR5 A;  1AF8 A;  2MD9 A;  2FQ0 A;  1L0I A;  5HVC A;  3GZM A;  2CNR A;  2KG9 A;  2MF4 A; 
#chains in the Genus database with same CATH topology
 5F2O A;  1IUQ A;  4HKG A;  3WBH A;  4XRO A;  1Q82 Q;  2L9F A;  1VQ6 P;  2K0Y A;  1QRJ A;  3NTE A;  1K73 Q;  4XFY A;  2QNW A;  1KLP A;  1A8O A;  3CPW O;  4H2Y C;  5KP8 B;  3CD6 P;  2PEO A;  5F2K A;  2QEX P;  2KGC A;  3DS5 A;  4U0D A;  1FR2 A;  4COP A;  1ACP A;  4UHP B;  2LTE A;  4U0B A;  2Z46 A;  2JO0 A;  3DS2 A;  3CCM P;  2KG8 A;  1Z6M A;  1M6N A;  3I55 P;  2L22 A;  1HY8 A;  1Q81 Q;  1W2B O;  3CCU P;  1A43 A;  2N50 A;  4U0A A;  4IPY A;  3P05 A;  3G21 A;  2KW2 A;  3EJB A;  2DGY A;  4XRQ A;  3RG6 C;  2CWO A;  1RO0 A;  1F80 D;  2N6Y A;  5F2N A;  1ZNV A;  2VLQ A;  1M90 Q;  2PEM A;  2OTJ P;  2E1M A;  5BS2 A;  2JGP A;  2PEK A;  2LL8 A;  3B5I A;  5BS1 A;  2L6E A;  1M1K Q;  1VQN P;  1AF8 A;  3CCS P;  2FQ0 A;  3CCQ P;  2KOD A;  2CNR A;  2KG9 A;  3HZQ A;  1YJN P;  1E6J P;  3G6E P;  2OAR A;  3CCJ P;  2GZI A;  1YI2 P;  2KOQ A;  2PEI A;  1VQM P;  1YHQ P;  1QVG O;  3CCE P;  3CME P;  5HGO A;  4PXH B;  1YIT P;  3RG2 A;  4BPF A;  1D1D A;  2LOL A;  1KQS O;  1VQ8 P;  2AFD A;  2FAD A;  2JB0 A;  2AVA A;  2K5X A;  1YJW P;  1NQ4 A;  3GJN A;  1UNK A;  4QNB A;  3H0D A;  2JAZ A;  2ONT A;  3DS3 A;  2M8P A;  4XFX A;  2XXM A;  3CMA P;  1M74 A;  2MR7 A;  3E2D A;  3CE7 A;  1AYI A;  1OR5 A;  2K2Q A;  2N5I A;  2FAE A;  3CXC O;  2N98 A;  2XV6 A;  2M8L A;  4R0M A;  3G26 A;  2GDY A;  2ROQ A;  2EG5 A;  2XZ1 C;  2PEQ A;  2MR8 A;  2Z44 A;  2K93 A;  3H47 A;  1YJ9 P;  3G0V A;  4BPH A;  1ZMB A;  1K8A Q;  2FVE A;  2BUO A;  3OW2 O;  1VQ4 P;  2JYG A;  5HV8 A;  4DG9 A;  1VQP P;  4PH0 A;  5EJD A;  2GDW A;  2ERH A;  3CC4 P;  2KR5 A;  2M8N A;  3CC7 P;  2NO8 A;  1YIJ P;  2JU1 A;  4H2X C;  2M5R A;  4IZ6 A;  4XFZ A;  3DS1 A;  1EMV A;  1RO2 A;  2AF8 A;  4M0I A;  2GDX A;  2VLN A;  3DTJ A;  1CEI A;  2JBG A;  2MVV A;  5DCK A;  2GZE A;  1Q7Y Q;  1L0H A;  3G1G A;  3MGE A;  5I4T G;  4U0C A;  2P9X A;  2XT1 A;  1S72 P;  4CA3 A;  2JQ4 A;  2FAC A;  3CCR P;  5EW5 E;  2KOP A;  1KC8 Q;  2JU2 A;  2CGQ A;  2XZ0 D;  2L0Q A;  3EJE A;  3G28 A;  2EHT A;  2Z45 A;  1EOQ A;  2VLP A;  2FVF A;  1QVF O;  2CQ8 A;  2WPT A;  1Q86 Q;  2BHV A;  3Q20 A;  1DNY A;  1VHN A;  2L4B A;  4GR2 A;  2FHS C;  2LIU A;  1GXH A;  3G29 A;  1MZ8 A;  1UJZ A;  3G4S P;  2EIA A;  3CC2 P;  2FQ2 A;  2GYK A;  3VRL C;  4H2W C;  2K0X A;  2DNW A;  1M6E X;  1GXG A;  2CG5 B;  2KOS A;  1VQO P;  2LIW A;  1DV5 A;  2FVA A;  3DPH A;  1EIA A;  2LF4 A;  3CCV P;  1L0I A;  5JPA A;  1NJI Q;  1N8R Q;  2MF4 A;  2EFJ A;  1E0H A;  4PWV B;  3HYB A;  2K94 A;  3LMO A;  4U0E A;  2FQ1 A;  1K30 A;  2MY5 A;  1BXI A;  1VKU A;  2GZG A;  2OTL P;  2K92 A;  1RNI A;  1VQK P;  2N5H A;  2JYL A;  1IMP A;  2VSQ A;  2PY8 A;  4MRT C;  3U43 A;  3G71 P;  2LPK A;  1HQB A;  3H4E A;  4GR6 A;  4WYM A;  4COC A;  2N6Z A;  5HGN A;  4QKO A;  5CZD B;  2LML A;  2PNG A;  2PEN A;  3M1M A;  1VQ9 P;  2AFE A;  2K0D X;  1X3O A;  3GKL C;  2KG6 A;  4PH1 A;  3GZL A;  3LRY A;  3CCL P;  7CEI A;  1GPJ A;  2KGE A;  3DS4 A;  2GZJ A;  4NEO A;  1K9M Q;  5KP7 B;  2X2B A;  2KGA A;  2KOR A;  2MVU A;  1VQ5 P;  5HGL A;  3B4Q A;  2LKI A;  2KGD A;  2QA4 P;  4F37 A;  3DS0 A;  2VLO A;  4BPG A;  1JJ2 O;  1KD1 Q;  5HGM A;  2KOO A;  3EJD A;  1VQL P;  2KWL A;  3I56 P;  1AUM A;  1VQ7 P;  3NY7 B;  1T8K A;  1BAJ A;  3G1I A;  4U0F A;  5KP6 B;  2EHS A;  2MD9 A;  5HVC A;  3GZM A;  2GZF A;  1IMQ A;  2PEJ A; 
#chains in the Genus database with same CATH homology
 2JU1 A;  4H2X C;  4HKG A;  4PWV B;  2M5R A;  2K94 A;  3LMO A;  4IZ6 A;  2FQ1 A;  2MY5 A;  2L9F A;  1VKU A;  2KOQ A;  2AF8 A;  2K92 A;  2GDX A;  2N5H A;  2K0Y A;  4PXH B;  2MVV A;  2VSQ A;  3RG2 A;  4BPF A;  2LOL A;  4MRT C;  1L0H A;  2LPK A;  1HQB A;  2AFD A;  2QNW A;  2FAD A;  1KLP A;  4H2Y C;  2AVA A;  5KP8 B;  1NQ4 A;  4CA3 A;  2N6Z A;  2KGC A;  2JQ4 A;  5CZD B;  2LML A;  2PNG A;  2FAC A;  2KOP A;  2JU2 A;  2AFE A;  1ACP A;  1X3O A;  2CGQ A;  2KG6 A;  2XZ0 D;  2L0Q A;  3GZL A;  3EJE A;  2LTE A;  2EHT A;  2FVF A;  2KGE A;  2MR7 A;  2CQ8 A;  3CE7 A;  2KG8 A;  1OR5 A;  2L22 A;  1HY8 A;  2K2Q A;  2FAE A;  2N5I A;  2N98 A;  4NEO A;  5KP7 B;  2N50 A;  2X2B A;  2KGA A;  2KOR A;  4R0M A;  1DNY A;  2L4B A;  2GDY A;  2MVU A;  2KW2 A;  2ROQ A;  2FHS C;  3EJB A;  2LIU A;  2LKI A;  2KGD A;  2XZ1 C;  4BPG A;  1F80 D;  2N6Y A;  2FQ2 A;  2MR8 A;  2KOO A;  3EJD A;  2K93 A;  2KWL A;  4H2W C;  2K0X A;  2DNW A;  4BPH A;  2CG5 B;  2FVE A;  3NY7 B;  2JGP A;  2KOS A;  1T8K A;  2LL8 A;  5HV8 A;  4DG9 A;  2LIW A;  5EJD A;  2GDW A;  1DV5 A;  2FVA A;  5KP6 B;  2EHS A;  2KR5 A;  1AF8 A;  2MD9 A;  2FQ0 A;  1L0I A;  5HVC A;  3GZM A;  2CNR A;  2KG9 A;  2MF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...