2FACA

Crystal structure of e. coli hexanoyl-acp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Acyl carrier protein
publication title Structural Studies of Fatty Acyl-(Acyl Carrier Protein) Thioesters Reveal a Hydrophobic Binding Cavity that Can Expand to Fit Longer Substrates.
pubmed doi rcsb
source organism Escherichia coli
total genus 25
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2facA00
3CE7A 2KGDA 4H2XC 2L0QA 5KP7B 2N6YA 2LIWA 2MD9A 2KOQA 2LIUA 4NEOA 3RG2A 2KGAA 2L4BA 1X3OA 1HQBA 2XZ0D 2MR7A 1ACPA 2K0YA 2FAEA 2MY5A 2JQ4A 2LOLA 4IZ6A 2FQ1A 5HV8A 2N5HA 1T8KA 2FHSC 2FQ0A 2LL8A 2LMLA 2AFEA 2CGQA 2K0XA 2EHSA 2LPKA 2FACA 1HY8A 5KP8B 2MVVA 2FVAA 2DNWA 4MRTC 4CA3A 4BPHA 4PXHB 1NQ4A 1AF8A 2KG8A 1L0IA 2M5RA 2JU1A 3EJDA 4DG9A 2N98A 4HKGA 1L0HA 5HVCA 2L9FA 2FADA 1DV5A 2KG6A 2QNWA 3GZMA 3NY7B 2ROQA 2AFDA 2AF8A 1F80D 4PWVB 3EJBA 2MF4A 2XZ1C 2KG9A 3LMOA 2KOPA 2CG5B 2L22A 2EHTA 5EJDA 2N6ZA 2KORA 2KOSA 2K2QA 2X2BA 3EJEA 2GDXA 2GDWA 2N50A 2GDYA 2KGEA 2K94A 2KR5A 2KWLA 2AVAA 2LTEA 2FVEA 2KGCA 2FQ2A 2KOOA 1KLPA 4H2YC 1VKUA 4BPGA 2CQ8A 2PNGA 1DNYA 4BPFA 3GZLA 2VSQA 1OR5A 4H2WC 2CNRA 2LKIA 2K93A 2MR8A 4R0MA 2JGPA 2K92A 2N5IA 5CZDB 2FVFA 2JU2A 2MVUA 5KP6B 2KW2A
chains in the Genus database with same CATH superfamily
3CE7A 5BS1A 2N6YA 2LIWA 4GR6A 4F37A 4XRQA 1M74A 1UNKA 2JBGA 1BXIA 5BS2A 2GZEA 2LIUA 2KGAA 1VQLP 1X3OA 3G6EP 1VQ6P 3CCQP 3CCVP 2K0YA 2EFJA 2FAEA 2OTJP 5HV8A 2NO8A 1VQMP 3B5IA 2LL8A 3Q20A 5KP8B 2MVVA 1VQKP 3G1GA 2DNWA 4MRTC 4CA3A 1K73Q 2GZGA 1Q7YQ 2M5RA 2EIAA 2N98A 1YI2P 2KG6A 4U0CA 2QNWA 4GR2A 4UHPB 3NY7B 1F80D 2OTLP 1EOQA 3LMOA 2KOPA 1KC8Q 2EHTA 4COPA 1RO0A 2GDXA 3G21A 2GDYA 2KGEA 1CEIA 3H0DA 2FQ2A 2FVEA 1IMQA 1ZMBA 1VQPP 2VSQA 1EIAA 3LRYA 1FR2A 2K92A 1KD1Q 1K30A 2JAZA 5CZDB 5I4TG 2KW2A 3G71P 3G29A 2MD9A 2XT1A 2KOQA 1Q82Q 1VQ8P 2L4BA 1YJWP 3DS5A 1ACPA 4U0DA 4IZ6A 5JPAA 2FQ1A 2K5XA 2M8PA 2LMLA 2OARA 4QKOA 2PEMA 2K0XA 1RO2A 2FACA 2VLPA 1HY8A 2LF4A 2Z44A 1AF8A 1IUQA 5HGOA 1L0IA 3I56P 2JU1A 3EJDA 3DPHA 1L0HA 4HKGA 1VQ5P 2FADA 3GZMA 1VHNA 3P05A 4U0FA 2L6EA 2AF8A 3EJBA 2MF4A 2XZ1C 2KG9A 5EJDA 2N6ZA 2ERHA 4U0BA 1D1DA 2KWLA 2AVAA 2JYGA 3DS3A 1KLPA 4H2YC 1VKUA 2CWOA 4QNBA 2KODA 4BPFA 5DCKA 2CNRA 3CCRP 1QVGO 2PEKA 1AYIA 5HGNA 3CC2P 2Z45A 3H4EA 2EG5A 1Q86Q 2JU2A 1M90Q 1MZ8A 2KGDA 4XROA 2VLOA 5KP7B 3CXCO 2PY8A 2QA4P 1GXGA 2GZIA 3RG2A 1GPJA 2P9XA 2XZ0D 3CCMP 1RNIA 2MY5A 2Z46A 1Z6MA 2N5HA 5HGLA 1KQSO 1Q81Q 2FHSC 1A43A 1IMPA 2BHVA 2JO0A 2CGQA 2EHSA 3DS0A 3HYBA 2GYKA 1YIJP 4WYMA 4BPHA 1NQ4A 2KG8A 2PEIA 1GXHA 4U0AA 4DG9A 3CCJP 3G1IA 1VQ7P 1DV5A 1BAJA 2QEXP 4XFXA 2AFDA 2PENA 7CEIA 4PWVB 3G26A 1YJ9P 3CPWO 2CG5B 2JB0A 2L22A 2VLNA 2KORA 3EJEA 5EW5E 1EMVA 1YITP 3HZQA 1YJNP 1W2BO 3CMEP 1AUMA 1VQ9P 2BUOA 4XFYA 2LTEA 2KGCA 3OW2O 2KOOA 3E2DA 4U0EA 2CQ8A 2PNGA 3DS4A 1DNYA 3GZLA 2XV6A 2LKIA 2K93A 2K0DX 1N8RQ 4XFZA 4R0MA 4COCA 2JGPA 3CCUP 2N5IA 3DS1A 3B4QA 3U43A 3CCEP 4H2XC 2L0QA 4M0IA 3H47A 2M8LA 3DTJA 1QVFO 3WBHA 4NEOA 2GZJA 3I55P 3CC7P 2DGYA 1HQBA 5F2NA 2MR7A 2WPTA 1E0HA 1M6NA 2JQ4A 2LOLA 5F2OA 5F2KA 5HGMA 1E6JP 1T8KA 1YHQP 2FQ0A 2AFEA 3NTEA 1VQOP 2LPKA 1A8OA 2FVAA 3CD6P 2JYLA 2PEQA 1VQNP 4PXHB 3CCSP 5HVCA 2L9FA 3GKLC 1K8AQ 2ROQA 3GJNA 1K9MQ 2KOSA 3G28A 2K2QA 2X2BA 4PH0A 2GZFA 3M1MA 2GDWA 3DS2A 2ONTA 3VRLC 2N50A 1M6EX 2XXMA 1S72P 2PEOA 2K94A 2KR5A 4BPGA 3CMAP 1VQ4P 2PEJA 2E1MA 1OR5A 1UJZA 1JJ2O 4H2WC 3G4SP 4IPYA 3RG6C 4PH1A 2MR8A 3CCLP 1ZNVA 1QRJA 1NJIQ 2VLQA 2FVFA 2MVUA 1M1KQ 3CC4P 3G0VA 3MGEA 5KP6B 2M8NA
chains in the Genus database with same CATH topology
3CE7A 2KGDA 4H2XC 2L0QA 5KP7B 2N6YA 2LIWA 2MD9A 2KOQA 2LIUA 4NEOA 3RG2A 2KGAA 2L4BA 1X3OA 1HQBA 2XZ0D 2MR7A 1ACPA 2K0YA 2FAEA 2MY5A 2JQ4A 2LOLA 4IZ6A 2FQ1A 5HV8A 2N5HA 1T8KA 2FHSC 2FQ0A 2LL8A 2LMLA 2AFEA 2CGQA 2K0XA 2EHSA 2LPKA 2FACA 1HY8A 5KP8B 2MVVA 2FVAA 2DNWA 4MRTC 4CA3A 4BPHA 4PXHB 1NQ4A 1AF8A 2KG8A 1L0IA 2M5RA 2JU1A 3EJDA 4DG9A 2N98A 4HKGA 1L0HA 5HVCA 2L9FA 2FADA 1DV5A 2KG6A 2QNWA 3GZMA 3NY7B 2ROQA 2AFDA 2AF8A 1F80D 4PWVB 3EJBA 2MF4A 2XZ1C 2KG9A 3LMOA 2KOPA 2CG5B 2L22A 2EHTA 5EJDA 2N6ZA 2KORA 2KOSA 2K2QA 2X2BA 3EJEA 2GDXA 2GDWA 2N50A 2GDYA 2KGEA 2K94A 2KR5A 2KWLA 2AVAA 2LTEA 2FVEA 2KGCA 2FQ2A 2KOOA 1KLPA 4H2YC 1VKUA 4BPGA 2CQ8A 2PNGA 1DNYA 4BPFA 3GZLA 2VSQA 1OR5A 4H2WC 2CNRA 2LKIA 2K93A 2MR8A 4R0MA 2JGPA 2K92A 2N5IA 5CZDB 2FVFA 2JU2A 2MVUA 5KP6B 2KW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CE7 A;  2KGD A;  4H2X C;  2L0Q A;  5KP7 B;  2N6Y A;  2LIW A;  2MD9 A;  2KOQ A;  2LIU A;  4NEO A;  3RG2 A;  2KGA A;  2L4B A;  1X3O A;  1HQB A;  2XZ0 D;  2MR7 A;  1ACP A;  2K0Y A;  2FAE A;  2MY5 A;  2JQ4 A;  2LOL A;  4IZ6 A;  2FQ1 A;  5HV8 A;  2N5H A;  1T8K A;  2FHS C;  2FQ0 A;  2LL8 A;  2LML A;  2AFE A;  2CGQ A;  2K0X A;  2EHS A;  2LPK A;  2FAC A;  1HY8 A;  5KP8 B;  2MVV A;  2FVA A;  2DNW A;  4MRT C;  4CA3 A;  4BPH A;  4PXH B;  1NQ4 A;  1AF8 A;  2KG8 A;  1L0I A;  2M5R A;  2JU1 A;  3EJD A;  4DG9 A;  2N98 A;  4HKG A;  1L0H A;  5HVC A;  2L9F A;  2FAD A;  1DV5 A;  2KG6 A;  2QNW A;  3GZM A;  3NY7 B;  2ROQ A;  2AFD A;  2AF8 A;  1F80 D;  4PWV B;  3EJB A;  2MF4 A;  2XZ1 C;  2KG9 A;  3LMO A;  2KOP A;  2CG5 B;  2L22 A;  2EHT A;  5EJD A;  2N6Z A;  2KOR A;  2KOS A;  2K2Q A;  2X2B A;  3EJE A;  2GDX A;  2GDW A;  2N50 A;  2GDY A;  2KGE A;  2K94 A;  2KR5 A;  2KWL A;  2AVA A;  2LTE A;  2FVE A;  2KGC A;  2FQ2 A;  2KOO A;  1KLP A;  4H2Y C;  1VKU A;  4BPG A;  2CQ8 A;  2PNG A;  1DNY A;  4BPF A;  3GZL A;  2VSQ A;  1OR5 A;  4H2W C;  2CNR A;  2LKI A;  2K93 A;  2MR8 A;  4R0M A;  2JGP A;  2K92 A;  2N5I A;  5CZD B;  2FVF A;  2JU2 A;  2MVU A;  5KP6 B;  2KW2 A; 
#chains in the Genus database with same CATH topology
 3CE7 A;  5BS1 A;  2N6Y A;  2LIW A;  4GR6 A;  4F37 A;  4XRQ A;  1M74 A;  1UNK A;  2JBG A;  1BXI A;  5BS2 A;  2GZE A;  2LIU A;  2KGA A;  1VQL P;  1X3O A;  3G6E P;  1VQ6 P;  3CCQ P;  3CCV P;  2K0Y A;  2EFJ A;  2FAE A;  2OTJ P;  5HV8 A;  2NO8 A;  1VQM P;  3B5I A;  2LL8 A;  3Q20 A;  5KP8 B;  2MVV A;  1VQK P;  3G1G A;  2DNW A;  4MRT C;  4CA3 A;  1K73 Q;  2GZG A;  1Q7Y Q;  2M5R A;  2EIA A;  2N98 A;  1YI2 P;  2KG6 A;  4U0C A;  2QNW A;  4GR2 A;  4UHP B;  3NY7 B;  1F80 D;  2OTL P;  1EOQ A;  3LMO A;  2KOP A;  1KC8 Q;  2EHT A;  4COP A;  1RO0 A;  2GDX A;  3G21 A;  2GDY A;  2KGE A;  1CEI A;  3H0D A;  2FQ2 A;  2FVE A;  1IMQ A;  1ZMB A;  1VQP P;  2VSQ A;  1EIA A;  3LRY A;  1FR2 A;  2K92 A;  1KD1 Q;  1K30 A;  2JAZ A;  5CZD B;  5I4T G;  2KW2 A;  3G71 P;  3G29 A;  2MD9 A;  2XT1 A;  2KOQ A;  1Q82 Q;  1VQ8 P;  2L4B A;  1YJW P;  3DS5 A;  1ACP A;  4U0D A;  4IZ6 A;  5JPA A;  2FQ1 A;  2K5X A;  2M8P A;  2LML A;  2OAR A;  4QKO A;  2PEM A;  2K0X A;  1RO2 A;  2FAC A;  2VLP A;  1HY8 A;  2LF4 A;  2Z44 A;  1AF8 A;  1IUQ A;  5HGO A;  1L0I A;  3I56 P;  2JU1 A;  3EJD A;  3DPH A;  1L0H A;  4HKG A;  1VQ5 P;  2FAD A;  3GZM A;  1VHN A;  3P05 A;  4U0F A;  2L6E A;  2AF8 A;  3EJB A;  2MF4 A;  2XZ1 C;  2KG9 A;  5EJD A;  2N6Z A;  2ERH A;  4U0B A;  1D1D A;  2KWL A;  2AVA A;  2JYG A;  3DS3 A;  1KLP A;  4H2Y C;  1VKU A;  2CWO A;  4QNB A;  2KOD A;  4BPF A;  5DCK A;  2CNR A;  3CCR P;  1QVG O;  2PEK A;  1AYI A;  5HGN A;  3CC2 P;  2Z45 A;  3H4E A;  2EG5 A;  1Q86 Q;  2JU2 A;  1M90 Q;  1MZ8 A;  2KGD A;  4XRO A;  2VLO A;  5KP7 B;  3CXC O;  2PY8 A;  2QA4 P;  1GXG A;  2GZI A;  3RG2 A;  1GPJ A;  2P9X A;  2XZ0 D;  3CCM P;  1RNI A;  2MY5 A;  2Z46 A;  1Z6M A;  2N5H A;  5HGL A;  1KQS O;  1Q81 Q;  2FHS C;  1A43 A;  1IMP A;  2BHV A;  2JO0 A;  2CGQ A;  2EHS A;  3DS0 A;  3HYB A;  2GYK A;  1YIJ P;  4WYM A;  4BPH A;  1NQ4 A;  2KG8 A;  2PEI A;  1GXH A;  4U0A A;  4DG9 A;  3CCJ P;  3G1I A;  1VQ7 P;  1DV5 A;  1BAJ A;  2QEX P;  4XFX A;  2AFD A;  2PEN A;  7CEI A;  4PWV B;  3G26 A;  1YJ9 P;  3CPW O;  2CG5 B;  2JB0 A;  2L22 A;  2VLN A;  2KOR A;  3EJE A;  5EW5 E;  1EMV A;  1YIT P;  3HZQ A;  1YJN P;  1W2B O;  3CME P;  1AUM A;  1VQ9 P;  2BUO A;  4XFY A;  2LTE A;  2KGC A;  3OW2 O;  2KOO A;  3E2D A;  4U0E A;  2CQ8 A;  2PNG A;  3DS4 A;  1DNY A;  3GZL A;  2XV6 A;  2LKI A;  2K93 A;  2K0D X;  1N8R Q;  4XFZ A;  4R0M A;  4COC A;  2JGP A;  3CCU P;  2N5I A;  3DS1 A;  3B4Q A;  3U43 A;  3CCE P;  4H2X C;  2L0Q A;  4M0I A;  3H47 A;  2M8L A;  3DTJ A;  1QVF O;  3WBH A;  4NEO A;  2GZJ A;  3I55 P;  3CC7 P;  2DGY A;  1HQB A;  5F2N A;  2MR7 A;  2WPT A;  1E0H A;  1M6N A;  2JQ4 A;  2LOL A;  5F2O A;  5F2K A;  5HGM A;  1E6J P;  1T8K A;  1YHQ P;  2FQ0 A;  2AFE A;  3NTE A;  1VQO P;  2LPK A;  1A8O A;  2FVA A;  3CD6 P;  2JYL A;  2PEQ A;  1VQN P;  4PXH B;  3CCS P;  5HVC A;  2L9F A;  3GKL C;  1K8A Q;  2ROQ A;  3GJN A;  1K9M Q;  2KOS A;  3G28 A;  2K2Q A;  2X2B A;  4PH0 A;  2GZF A;  3M1M A;  2GDW A;  3DS2 A;  2ONT A;  3VRL C;  2N50 A;  1M6E X;  2XXM A;  1S72 P;  2PEO A;  2K94 A;  2KR5 A;  4BPG A;  3CMA P;  1VQ4 P;  2PEJ A;  2E1M A;  1OR5 A;  1UJZ A;  1JJ2 O;  4H2W C;  3G4S P;  4IPY A;  3RG6 C;  4PH1 A;  2MR8 A;  3CCL P;  1ZNV A;  1QRJ A;  1NJI Q;  2VLQ A;  2FVF A;  2MVU A;  1M1K Q;  3CC4 P;  3G0V A;  3MGE A;  5KP6 B;  2M8N A; 
#chains in the Genus database with same CATH homology
 3CE7 A;  2KGD A;  4H2X C;  2L0Q A;  5KP7 B;  2N6Y A;  2LIW A;  2MD9 A;  2KOQ A;  2LIU A;  4NEO A;  3RG2 A;  2KGA A;  2L4B A;  1X3O A;  1HQB A;  2XZ0 D;  2MR7 A;  1ACP A;  2K0Y A;  2FAE A;  2MY5 A;  2JQ4 A;  2LOL A;  4IZ6 A;  2FQ1 A;  5HV8 A;  2N5H A;  1T8K A;  2FHS C;  2FQ0 A;  2LL8 A;  2LML A;  2AFE A;  2CGQ A;  2K0X A;  2EHS A;  2LPK A;  2FAC A;  1HY8 A;  5KP8 B;  2MVV A;  2FVA A;  2DNW A;  4MRT C;  4CA3 A;  4BPH A;  4PXH B;  1NQ4 A;  1AF8 A;  2KG8 A;  1L0I A;  2M5R A;  2JU1 A;  3EJD A;  4DG9 A;  2N98 A;  4HKG A;  1L0H A;  5HVC A;  2L9F A;  2FAD A;  1DV5 A;  2KG6 A;  2QNW A;  3GZM A;  3NY7 B;  2ROQ A;  2AFD A;  2AF8 A;  1F80 D;  4PWV B;  3EJB A;  2MF4 A;  2XZ1 C;  2KG9 A;  3LMO A;  2KOP A;  2CG5 B;  2L22 A;  2EHT A;  5EJD A;  2N6Z A;  2KOR A;  2KOS A;  2K2Q A;  2X2B A;  3EJE A;  2GDX A;  2GDW A;  2N50 A;  2GDY A;  2KGE A;  2K94 A;  2KR5 A;  2KWL A;  2AVA A;  2LTE A;  2FVE A;  2KGC A;  2FQ2 A;  2KOO A;  1KLP A;  4H2Y C;  1VKU A;  4BPG A;  2CQ8 A;  2PNG A;  1DNY A;  4BPF A;  3GZL A;  2VSQ A;  1OR5 A;  4H2W C;  2CNR A;  2LKI A;  2K93 A;  2MR8 A;  4R0M A;  2JGP A;  2K92 A;  2N5I A;  5CZD B;  2FVF A;  2JU2 A;  2MVU A;  5KP6 B;  2KW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...