2FACA

Crystal structure of e. coli hexanoyl-acp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural Studies of Fatty Acyl-(Acyl Carrier Protein) Thioesters Reveal a Hydrophobic Binding Cavity that Can Expand to Fit Longer Substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 25
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2facA00
2QNWA 4IZ6A 2LOLA 2AFEA 2MD9A 2K93A 2KW2A 1NQ4A 2N50A 2CNRA 4BPFA 2L0QA 4HKGA 2ROQA 2K0XA 2PNGA 3GZLA 5EJDA 2K92A 1L0HA 4R0MA 2K94A 2KGDA 1L0IA 5HVCA 1KLPA 3GZMA 2LKIA 4CA3A 2K0YA 2K2QA 2VSQA 2FHSC 2KOPA 2FADA 2N6ZA 3CE7A 2EHSA 2L4BA 3EJEA 2LMLA 1AF8A 2FVAA 2X2BA 3LMOA 2KORA 2GDXA 2KWLA 4H2YC 4PWVB 1DNYA 3EJDA 2FQ1A 2KR5A 5KP6B 2MR8A 4DG9A 2KOQA 2MF4A 2LIUA 3EJBA 2MR7A 1OR5A 2JU2A 2L9FA 2LL8A 2N5IA 2FAEA 2DNWA 2KG6A 1DV5A 2GDWA 2CQ8A 4NEOA 1T8KA 2EHTA 3RG2A 3NY7B 1HQBA 2N98A 5HV8A 2GDYA 2FVEA 2N5HA 2KG8A 2FQ2A 2KG9A 4BPHA 2M5RA 2MVUA 2MVVA 2LIWA 1HY8A 2FVFA 1X3OA 1VKUA 1ACPA 2KOSA 2AFDA 2FQ0A 2JQ4A 1F80D 2N6YA 2AF8A 2L22A 2AVAA 2KOOA 2XZ0D 2CG5B 4H2WC 2CGQA 2KGEA 2XZ1C 2MY5A 4BPGA 2LPKA 5KP8B 2KGCA 5KP7B 2JGPA 5CZDB 2KGAA 4H2XC 2JU1A 4MRTC 4PXHB 2FACA 2LTEA
chains in the Genus database with same CATH superfamily
2OARA 1K9MQ 1K30A 2XXMA 2Z44A 2QNWA 2MD9A 1KC8Q 2KW2A 2GZGA 2PEJA 1VQOP 1IMQA 4QKOA 1VQ7P 1E0HA 2KGDA 2Z46A 2M8LA 3HZQA 3P05A 3CCMP 5F2NA 5HGLA 2E1MA 7CEIA 2L4BA 2LMLA 1YIJP 1Q81Q 1AF8A 3GJNA 4UHPB 4XRQA 4COPA 2VLQA 2EIAA 3U43A 1OR5A 1N8RQ 2JU2A 4U0BA 2KG6A 2GDWA 1HQBA 2QEXP 1MZ8A 2JO0A 2N5HA 1AYIA 2KG8A 2GZIA 2JB0A 2FVFA 3G28A 1VKUA 4XFYA 2N6YA 3CCJP 2QA4P 2AF8A 1JJ2O 5F2OA 2KOOA 3OW2O 3CMAP 3DS3A 4PH0A 2XZ0D 1Q86Q 1KD1Q 5BS2A 2EG5A 2XZ1C 5KP8B 2M8NA 5DCKA 1M1KQ 1D1DA 4IZ6A 2K93A 4GR2A 3CCUP 1NQ4A 1UJZA 1A8OA 2JAZA 4BPFA 2L0QA 3G0VA 1GXHA 2K0DX 2PNGA 3GZLA 3VRLC 4U0AA 5EJDA 2K92A 4R0MA 5JPAA 2K94A 3CCSP 3CC7P 1L0IA 2LKIA 2GZJA 2K5XA 3M1MA 2FADA 2ONTA 2EHSA 3DS1A 3EJEA 5I4TG 1QVFO 3DS5A 2PEKA 1YJNP 3HYBA 1VQ5P 2GDXA 2NO8A 2KWLA 3G1GA 3Q20A 2WPTA 2DGYA 4U0CA 3CD6P 2KR5A 5BS1A 3CCQP 3G71P 2KODA 3CC4P 1ZMBA 2LIUA 1M6NA 3B4QA 2CQ8A 4NEOA 3NY7B 1ZNVA 5HV8A 1IMPA 2KG9A 2BHVA 2M5RA 4U0EA 2LIWA 3WBHA 1ACPA 2BUOA 2PEQA 2AVAA 2GZFA 3CMEP 3CXCO 5HGOA 1EIAA 4H2WC 3G26A 4QNBA 1VQNP 1VQPP 3DPHA 1GXGA 1YI2P 4BPGA 1A43A 3CCEP 2PEIA 4MRTC 2FACA 2VLPA 3E2DA 1M74A 2JYLA 1VQLP 2AFEA 4GR6A 3DTJA 2N50A 2CNRA 2ROQA 2K0XA 4WYMA 3I56P 2M8PA 1M90Q 1UNKA 1L0HA 2LF4A 1RNIA 2JYGA 2GYKA 4PH1A 2PENA 3RG6C 1FR2A 2PEOA 2VLNA 3CPWO 1VQ9P 2K2QA 2FHSC 2KOPA 2N6ZA 3CE7A 1GPJA 2Z45A 2FVAA 2X2BA 3LMOA 2KORA 4XFXA 5EW5E 4PWVB 3EJDA 2FQ1A 4U0FA 1CEIA 5KP6B 3CC2P 2OTLP 4DG9A 1Z6MA 2KOQA 3DS0A 1NJIQ 3DS2A 3CCLP 1BXIA 3EJBA 2MR7A 5F2KA 2EFJA 2L9FA 2LL8A 2CWOA 2XV6A 1DV5A 4IPYA 3DS4A 1QVGO 2EHTA 3RG2A 2N98A 2GDYA 1Q82Q 2FVEA 4BPHA 2MVUA 2MVVA 1HY8A 2OTJP 3G21A 2KOSA 2FQ0A 2JQ4A 1E6JP 2L22A 4M0IA 3G29A 3CCVP 3MGEA 2CG5B 2CGQA 1YJWP 2KGEA 1EMVA 2KGCA 3H4EA 5CZDB 1QRJA 4F37A 2LTEA 2XT1A 1VQ8P 2LOLA 3G1IA 1K8AQ 2JBGA 1VQ6P 4HKGA 3G6EP 4XFZA 1Q7YQ 1EOQA 1VQ4P 1VQKP 1S72P 2VLOA 3I55P 3B5IA 3H0DA 3G4SP 5HVCA 1K73Q 1KLPA 3GZMA 4CA3A 3CCRP 2K0YA 1YHQP 2PY8A 2VSQA 2PEMA 4COCA 1RO0A 2ERHA 4U0DA 4H2YC 1DNYA 2MR8A 2L6EA 1VQMP 1M6EX 2MF4A 1W2BO 5HGNA 2N5IA 2FAEA 2DNWA 1YJ9P 3GKLC 1T8KA 1RO2A 2GZEA 2FQ2A 3LRYA 1X3OA 2AFDA 1F80D 5HGMA 1YITP 1VHNA 1IUQA 1KQSO 2MY5A 3H47A 2LPKA 1BAJA 5KP7B 2JGPA 2KGAA 4H2XC 2JU1A 2P9XA 4PXHB 1AUMA 3NTEA 4XROA
chains in the Genus database with same CATH topology
2QNWA 4IZ6A 2LOLA 2AFEA 2MD9A 2K93A 2KW2A 1NQ4A 2N50A 2CNRA 4BPFA 2L0QA 4HKGA 2ROQA 2K0XA 2PNGA 3GZLA 5EJDA 2K92A 1L0HA 4R0MA 2K94A 2KGDA 1L0IA 5HVCA 1KLPA 3GZMA 2LKIA 4CA3A 2K0YA 2K2QA 2VSQA 2FHSC 2KOPA 2FADA 2N6ZA 3CE7A 2EHSA 2L4BA 3EJEA 2LMLA 1AF8A 2FVAA 2X2BA 3LMOA 2KORA 2GDXA 2KWLA 4H2YC 4PWVB 1DNYA 3EJDA 2FQ1A 2KR5A 5KP6B 2MR8A 4DG9A 2KOQA 2MF4A 2LIUA 3EJBA 2MR7A 1OR5A 2JU2A 2L9FA 2LL8A 2N5IA 2FAEA 2DNWA 2KG6A 1DV5A 2GDWA 2CQ8A 4NEOA 1T8KA 2EHTA 3RG2A 3NY7B 1HQBA 2N98A 5HV8A 2GDYA 2FVEA 2N5HA 2KG8A 2FQ2A 2KG9A 4BPHA 2M5RA 2MVUA 2MVVA 2LIWA 1HY8A 2FVFA 1X3OA 1VKUA 1ACPA 2KOSA 2AFDA 2FQ0A 2JQ4A 1F80D 2N6YA 2AF8A 2L22A 2AVAA 2KOOA 2XZ0D 2CG5B 4H2WC 2CGQA 2KGEA 2XZ1C 2MY5A 4BPGA 2LPKA 5KP8B 2KGCA 5KP7B 2JGPA 5CZDB 2KGAA 4H2XC 2JU1A 4MRTC 4PXHB 2FACA 2LTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QNW A;  4IZ6 A;  2LOL A;  2AFE A;  2MD9 A;  2K93 A;  2KW2 A;  1NQ4 A;  2N50 A;  2CNR A;  4BPF A;  2L0Q A;  4HKG A;  2ROQ A;  2K0X A;  2PNG A;  3GZL A;  5EJD A;  2K92 A;  1L0H A;  4R0M A;  2K94 A;  2KGD A;  1L0I A;  5HVC A;  1KLP A;  3GZM A;  2LKI A;  4CA3 A;  2K0Y A;  2K2Q A;  2VSQ A;  2FHS C;  2KOP A;  2FAD A;  2N6Z A;  3CE7 A;  2EHS A;  2L4B A;  3EJE A;  2LML A;  1AF8 A;  2FVA A;  2X2B A;  3LMO A;  2KOR A;  2GDX A;  2KWL A;  4H2Y C;  4PWV B;  1DNY A;  3EJD A;  2FQ1 A;  2KR5 A;  5KP6 B;  2MR8 A;  4DG9 A;  2KOQ A;  2MF4 A;  2LIU A;  3EJB A;  2MR7 A;  1OR5 A;  2JU2 A;  2L9F A;  2LL8 A;  2N5I A;  2FAE A;  2DNW A;  2KG6 A;  1DV5 A;  2GDW A;  2CQ8 A;  4NEO A;  1T8K A;  2EHT A;  3RG2 A;  3NY7 B;  1HQB A;  2N98 A;  5HV8 A;  2GDY A;  2FVE A;  2N5H A;  2KG8 A;  2FQ2 A;  2KG9 A;  4BPH A;  2M5R A;  2MVU A;  2MVV A;  2LIW A;  1HY8 A;  2FVF A;  1X3O A;  1VKU A;  1ACP A;  2KOS A;  2AFD A;  2FQ0 A;  2JQ4 A;  1F80 D;  2N6Y A;  2AF8 A;  2L22 A;  2AVA A;  2KOO A;  2XZ0 D;  2CG5 B;  4H2W C;  2CGQ A;  2KGE A;  2XZ1 C;  2MY5 A;  4BPG A;  2LPK A;  5KP8 B;  2KGC A;  5KP7 B;  2JGP A;  5CZD B;  2KGA A;  4H2X C;  2JU1 A;  4MRT C;  4PXH B;  2FAC A;  2LTE A; 
#chains in the Genus database with same CATH topology
 2OAR A;  1K9M Q;  1K30 A;  2XXM A;  2Z44 A;  2QNW A;  2MD9 A;  1KC8 Q;  2KW2 A;  2GZG A;  2PEJ A;  1VQO P;  1IMQ A;  4QKO A;  1VQ7 P;  1E0H A;  2KGD A;  2Z46 A;  2M8L A;  3HZQ A;  3P05 A;  3CCM P;  5F2N A;  5HGL A;  2E1M A;  7CEI A;  2L4B A;  2LML A;  1YIJ P;  1Q81 Q;  1AF8 A;  3GJN A;  4UHP B;  4XRQ A;  4COP A;  2VLQ A;  2EIA A;  3U43 A;  1OR5 A;  1N8R Q;  2JU2 A;  4U0B A;  2KG6 A;  2GDW A;  1HQB A;  2QEX P;  1MZ8 A;  2JO0 A;  2N5H A;  1AYI A;  2KG8 A;  2GZI A;  2JB0 A;  2FVF A;  3G28 A;  1VKU A;  4XFY A;  2N6Y A;  3CCJ P;  2QA4 P;  2AF8 A;  1JJ2 O;  5F2O A;  2KOO A;  3OW2 O;  3CMA P;  3DS3 A;  4PH0 A;  2XZ0 D;  1Q86 Q;  1KD1 Q;  5BS2 A;  2EG5 A;  2XZ1 C;  5KP8 B;  2M8N A;  5DCK A;  1M1K Q;  1D1D A;  4IZ6 A;  2K93 A;  4GR2 A;  3CCU P;  1NQ4 A;  1UJZ A;  1A8O A;  2JAZ A;  4BPF A;  2L0Q A;  3G0V A;  1GXH A;  2K0D X;  2PNG A;  3GZL A;  3VRL C;  4U0A A;  5EJD A;  2K92 A;  4R0M A;  5JPA A;  2K94 A;  3CCS P;  3CC7 P;  1L0I A;  2LKI A;  2GZJ A;  2K5X A;  3M1M A;  2FAD A;  2ONT A;  2EHS A;  3DS1 A;  3EJE A;  5I4T G;  1QVF O;  3DS5 A;  2PEK A;  1YJN P;  3HYB A;  1VQ5 P;  2GDX A;  2NO8 A;  2KWL A;  3G1G A;  3Q20 A;  2WPT A;  2DGY A;  4U0C A;  3CD6 P;  2KR5 A;  5BS1 A;  3CCQ P;  3G71 P;  2KOD A;  3CC4 P;  1ZMB A;  2LIU A;  1M6N A;  3B4Q A;  2CQ8 A;  4NEO A;  3NY7 B;  1ZNV A;  5HV8 A;  1IMP A;  2KG9 A;  2BHV A;  2M5R A;  4U0E A;  2LIW A;  3WBH A;  1ACP A;  2BUO A;  2PEQ A;  2AVA A;  2GZF A;  3CME P;  3CXC O;  5HGO A;  1EIA A;  4H2W C;  3G26 A;  4QNB A;  1VQN P;  1VQP P;  3DPH A;  1GXG A;  1YI2 P;  4BPG A;  1A43 A;  3CCE P;  2PEI A;  4MRT C;  2FAC A;  2VLP A;  3E2D A;  1M74 A;  2JYL A;  1VQL P;  2AFE A;  4GR6 A;  3DTJ A;  2N50 A;  2CNR A;  2ROQ A;  2K0X A;  4WYM A;  3I56 P;  2M8P A;  1M90 Q;  1UNK A;  1L0H A;  2LF4 A;  1RNI A;  2JYG A;  2GYK A;  4PH1 A;  2PEN A;  3RG6 C;  1FR2 A;  2PEO A;  2VLN A;  3CPW O;  1VQ9 P;  2K2Q A;  2FHS C;  2KOP A;  2N6Z A;  3CE7 A;  1GPJ A;  2Z45 A;  2FVA A;  2X2B A;  3LMO A;  2KOR A;  4XFX A;  5EW5 E;  4PWV B;  3EJD A;  2FQ1 A;  4U0F A;  1CEI A;  5KP6 B;  3CC2 P;  2OTL P;  4DG9 A;  1Z6M A;  2KOQ A;  3DS0 A;  1NJI Q;  3DS2 A;  3CCL P;  1BXI A;  3EJB A;  2MR7 A;  5F2K A;  2EFJ A;  2L9F A;  2LL8 A;  2CWO A;  2XV6 A;  1DV5 A;  4IPY A;  3DS4 A;  1QVG O;  2EHT A;  3RG2 A;  2N98 A;  2GDY A;  1Q82 Q;  2FVE A;  4BPH A;  2MVU A;  2MVV A;  1HY8 A;  2OTJ P;  3G21 A;  2KOS A;  2FQ0 A;  2JQ4 A;  1E6J P;  2L22 A;  4M0I A;  3G29 A;  3CCV P;  3MGE A;  2CG5 B;  2CGQ A;  1YJW P;  2KGE A;  1EMV A;  2KGC A;  3H4E A;  5CZD B;  1QRJ A;  4F37 A;  2LTE A;  2XT1 A;  1VQ8 P;  2LOL A;  3G1I A;  1K8A Q;  2JBG A;  1VQ6 P;  4HKG A;  3G6E P;  4XFZ A;  1Q7Y Q;  1EOQ A;  1VQ4 P;  1VQK P;  1S72 P;  2VLO A;  3I55 P;  3B5I A;  3H0D A;  3G4S P;  5HVC A;  1K73 Q;  1KLP A;  3GZM A;  4CA3 A;  3CCR P;  2K0Y A;  1YHQ P;  2PY8 A;  2VSQ A;  2PEM A;  4COC A;  1RO0 A;  2ERH A;  4U0D A;  4H2Y C;  1DNY A;  2MR8 A;  2L6E A;  1VQM P;  1M6E X;  2MF4 A;  1W2B O;  5HGN A;  2N5I A;  2FAE A;  2DNW A;  1YJ9 P;  3GKL C;  1T8K A;  1RO2 A;  2GZE A;  2FQ2 A;  3LRY A;  1X3O A;  2AFD A;  1F80 D;  5HGM A;  1YIT P;  1VHN A;  1IUQ A;  1KQS O;  2MY5 A;  3H47 A;  2LPK A;  1BAJ A;  5KP7 B;  2JGP A;  2KGA A;  4H2X C;  2JU1 A;  2P9X A;  4PXH B;  1AUM A;  3NTE A;  4XRO A; 
#chains in the Genus database with same CATH homology
 2QNW A;  4IZ6 A;  2LOL A;  2AFE A;  2MD9 A;  2K93 A;  2KW2 A;  1NQ4 A;  2N50 A;  2CNR A;  4BPF A;  2L0Q A;  4HKG A;  2ROQ A;  2K0X A;  2PNG A;  3GZL A;  5EJD A;  2K92 A;  1L0H A;  4R0M A;  2K94 A;  2KGD A;  1L0I A;  5HVC A;  1KLP A;  3GZM A;  2LKI A;  4CA3 A;  2K0Y A;  2K2Q A;  2VSQ A;  2FHS C;  2KOP A;  2FAD A;  2N6Z A;  3CE7 A;  2EHS A;  2L4B A;  3EJE A;  2LML A;  1AF8 A;  2FVA A;  2X2B A;  3LMO A;  2KOR A;  2GDX A;  2KWL A;  4H2Y C;  4PWV B;  1DNY A;  3EJD A;  2FQ1 A;  2KR5 A;  5KP6 B;  2MR8 A;  4DG9 A;  2KOQ A;  2MF4 A;  2LIU A;  3EJB A;  2MR7 A;  1OR5 A;  2JU2 A;  2L9F A;  2LL8 A;  2N5I A;  2FAE A;  2DNW A;  2KG6 A;  1DV5 A;  2GDW A;  2CQ8 A;  4NEO A;  1T8K A;  2EHT A;  3RG2 A;  3NY7 B;  1HQB A;  2N98 A;  5HV8 A;  2GDY A;  2FVE A;  2N5H A;  2KG8 A;  2FQ2 A;  2KG9 A;  4BPH A;  2M5R A;  2MVU A;  2MVV A;  2LIW A;  1HY8 A;  2FVF A;  1X3O A;  1VKU A;  1ACP A;  2KOS A;  2AFD A;  2FQ0 A;  2JQ4 A;  1F80 D;  2N6Y A;  2AF8 A;  2L22 A;  2AVA A;  2KOO A;  2XZ0 D;  2CG5 B;  4H2W C;  2CGQ A;  2KGE A;  2XZ1 C;  2MY5 A;  4BPG A;  2LPK A;  5KP8 B;  2KGC A;  5KP7 B;  2JGP A;  5CZD B;  2KGA A;  4H2X C;  2JU1 A;  4MRT C;  4PXH B;  2FAC A;  2LTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...