2EFJA

The structure of 1,7 dimethylxanthine methyltransferase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
377
structure length
348
Chain Sequence
b'LQEVLHMNGTSYAKNSSYNLFLIRVKPVLEQCIQELLRANLPNINKCFKVGDLGCASGPNTFSTVRDIVQSIDKVPTIQIFLNDLFQNDFNSVFKLLPSFYRNLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLHWLSQVPSGISVNKGCIYSSKASRPPIQKAYLDQFTKDFTTFLRIHSEELISRGRMLLTFICKEDEFDHPNSMDLLEMSINDLVIEGHLEEEKLDSFNVPIYAPSTEEVKRIVEEEGSFEILYLETFNAPYDAGFSISPVSCDEHARAAHVASVVRSIYEPILASHFGEAILPDLSHRIAKNAAKVLRSGKGFYDSVIISLAKKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3,7-dimethylxanthine methyltransferase
publication title The structure of two N-methyltransferases from the caffeine biosynthetic pathway
pubmed doi rcsb
source organism Coffea canephora
molecule tags Transferase
total genus 129
structure length 348
sequence length 377
ec nomenclature ec 2.1.1.160: Caffeine synthase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.270 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2efjA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2efjA02
4PWYA 2FHPA 3SM3A 2R3SA 1XDZA 3FPFA 5K01A 1N7IA 4RTNA 1SG9A 2YQZA 3OPNA 5FUBA 4C08A 1P91A 2P3OA 3ANXA 3OU2A 3OZSA 4OQDA 4QDKA 5LSAA 2XYRA 5P8WA 4CWAA 2WK1A 4QVGA 5GP1A 5F2OA 4EVIA 3ELDA 4EKIA 4PONA 2HNKA 3Q7EA 3RW9A 3G5TA 1VL5A 3ELWA 2YX1A 4RTRA 1WXXA 5ICEA 4RV9A 4XCXA 4FT4A 1AV6A 2ZWVA 2O57A 3KU1A 1WXWA 5LQCA 2UZ4A 3MGGA 4ER3A 2OB2A 5FHQA 4M37A 2UYCA 2G8NA 4FZVA 4QQKA 2EG5A 2PWPA 1V39A 3HVJA 3IYLW 3HCDA 3OU7A 1RI5A 4OX9Y 2ZBRA 1UFKA 3LDFA 4EK9A 5GIPE 3TPZA 3G2PA 3SSOA 2FYTA 3THRA 2QRVA 2ZZKA 1D2CA 2AS0A 2ONZA 5DM1A 5K05A 3GU3A 1FJXA 3HVHA 3M70A 5HFJA 5FADA 2FRXA 4E2WA 1L3BA 2ZTHA 4PYLA 4WXHA 2V74B 2NP7A 2P40A 4K6MA 5CIYA 2P8JA 3R24A 3KQVA 2VS1A 3LBFA 1Z3CA 3D2LA 5FQNA 5LQAA 4Y30A 5T6BA 5D1NA 4QDJA 1L3CA 2BM9A 1EG2A 2XVMA 4RYLA 2PVCA 4C04A 4P7GA 1WS6A 2H00A 2JHCA 1YFJA 2Z6QA 3UFBA 2ZIEA 1L3IA 3QOWA 2CMHA 2YXLA 2AN4A 3FYCA 3AWIA 3F4KA 3DMGA 3GWZA 1PRYA 1YB2A 3MERA 3R6TA 3FPHA 2ZIGA 3DOUA 4HGYA 5C9ZA 4XUEA 1FP2A 4R8RA 5FCDA 3GJYA 5LQNA 2HMYB 1IXKA 4FS8A 1NBIA 2DPMA 3LGAA 3CC8A 3QV2A 1KXZA 1RI2A 2FPOA 3KQPA 4LWOA 4Y2HA 4BLVA 1BC5A 4RVGA 5E1OA 5F2KA 1BOOA 1FPQA 1P39A 4RSRA 3B3JA 3T7RA 4C06A 3T7SA 5T64A 4IKPA 3FZGA 5E2BA 4QTUB 4AZWA 2O06A 5EZQA 1R8XA 3B3GA 4AUKA 4OQEA 1R00A 1ZKDA 4BLUA 2JHAA 2PX5A 3KQQA 2C7OA 1RI4A 1U2ZA 2PBFA 4KIGA 1M6EX 3HA7A 3PFGA 3A26A 5K0GA 3GIWA 3CCFA 2ZBPA 3MCTA 1T43A 4X41A 2B9EA 1KPIA 1H1DA 1AQIA 1QANA 1TW3A 4PINA 5HIKA 5DXAA 2PT9A 1UWVA 3X0DA 4DM3A 2YXDA 3BKWA 3EVFA 4HTFA 5CVEA 3GDHA 1SUSA 1FP1D 5DWQA 3LSTA 3DUWA 4GEKA 3EVZA 1G55A 4X63A 3FRHA 2WA1A 2R6ZA 2Y1XA 3A7DA 2I6GA 5HIIA 2YUIA 2IP2A 3EVAA 2BR3A 3HA5A 5K0JA 5FWDA 5K0BA 1DCTA 3MHTA 5G02A 4RTMA 5CCBA 3RIEA 2IPXA 4MQ4A 3DULA 2G1PA 3OZTA 3BWCA 5D1HA 2IDKA 4V0RA 5EPEA 3VSEA 2XYVA 2IDJA 2PX4A 3AY0A 4QPPA 4QQNA 2JH8A 3NDJA 4ISCA 1X1CA 2ZCJA 3K6RA 1KIAA 2BR5A 2UYQA 4OA8A 1N7JA 3M4XA 4AZVA 2QE6A 5HZMA 2A14A 2P3LA 3LL7A 1BHJA 4R6XA 3TR6A 3DMFA 3C6MA 3SMQA 3O31A 2I62A 2AOUA 3EVCA 3TLJA 4E70A 3GRUA 5GWXA 4GC9A 1D2HA 4PYIA 3P8ZA 2H11A 3LKZA 2AN5A 4IV0A 4AZTA 1P1CA 3P2KA 1EQAA 2OYRA 2I9KA 4IWNA 5DXJA 4QVKA 2VDWA 1ORIA 3C3PA 2PV0A 3KPYA 4MTLA 4X61A 4RTSA 2PXXA 4DZRA 1SUIA 3HNRA 2V7EA 2NXNA 5DPMA 1EAMA 3LKDA 4PYJA 1JG3A 1XCJA 2PXCA 4X1OA 5DSXA 2OZVA 4E33A 3H2BA 3E23A 3TM4A 3TM5A 4XUCA 2BH2A 4P58A 1QAOA 2HWKA 5EVJA 5EKXA 3SGLA 3PFHA 3P2IA 3UJCA 3KQSA 1XDSA 3CJQA 2EJTA 3TKAA 3GRRA 3HP7A 2GAFA 4GQBA 3G8BA 2C7RA 2IBTA 1RJDA 4BP1A 3T7TA 5EIFA 3L8DA 4KW7A 5BW5A 4KVZA 7MHTA 1JSXA 1QAMA 1JG2A 3FUTA 1D2GA 1ZQ9A 3HCEA 3EVGA 3KR1A 4IV8A 1MHTA 5FULA 1I9GA 1SQFA 3DLIA 1NV9A 2ZIFA 5E2AA 3UJDA 3A4TA 1XXLA 3G2OA 5M5BA 3HM2A 3P97A 4RTPA 2Q41A 1VP9A 3TQSA 4KRGA 5GIOE 5FQOA 3OFJA 4MHTA 2AR0A 1NKVA 2IGTA 3KHKA 1WG8A 3U81A 1QAQA 1JTEA 3LPMA 3P9NA 3IHTA 5DX1A 3LX6A 3FTDA 1FBNA 5CM2Z 3OE5A 4GUAA 5K0CA 4RTOA 5GOZA 1BKYA 2ZVJA 2H1RA 1ZGAA 1O9HA 2O07A 3CKKA 3KKZA 2AVNA 3PX3A 4DF3A 4M38A 5DT2A 1XCLA 5DRYA 2IIPA 3UA4A 3B3FA 3EMDA 5DSTA 3SSNA 3V97A 2FK8A 3C6KA 4P7KA 1TW2A 2Y1WA 4PIMA 3PLAE 1QYRA 2FCAA 2LD4A 4AZSA 2PY6A 3GNLA 4OA5A 1B42A 5ICGA 5KQSA 2AOWA 1Q0SA 2OY0A 2QRVB 3G8AA 5DTRA 2NXJA 1IY9A 2GPYA 5EOVA 4DMGA 1G60A 5KYGA 4JXJA 1EJ6A 1NE2A 4KDCA 1HMYA 3NWEA 3PS9A 4NECA 4BLWA 5E9WA 3BT7A 3B7PA 3CJTA 3MQ2A 5IH3A 4AX8A 5KS2A 4CKCA 3UWPA 5FTWA 3P2EA 5DX0A 3E7PA 3FRIA 5E8RA 5CVUA 3I58A 3BXOA 4E30A 3DR5A 5FA5A 3IEIA 2XVAA 2OKCA 5EMKA 3SSMA 3FTFA 4PCLA 3MAGA 4FR0A 5EMJA 1NW3A 4YUZA 1PJZA 3P9KA 3NVKI 4FP9A 3PT9A 1KHHA 2OO3A 5B1SA 2C7QA 2VP3A 2IH5A 2BZGA 1AQJA 3EGIA 4ER6A 3G5LA 4F85A 4UOEA 5BXYA 2UYOA 4H0NA 1YUBA 2PXAA 4FSDA 5E8JA 1IM8A 5EEGA 1NW7A 3O4FA 2EX4A 5E9QA 5EMMA 5EMLA 1KYZA 3C3YA 3KPJA 4V0QA 4YUVA 4YV0A 4PGHA 1JSZA 4HC4A 2PWYA 4DKJA 3KR0A 3HCBA 4YUWA 5GM1A 5JUWA 4U7TB 2G70A 1JR4A 5HIMA 1X1BA 3A27A 3NTVA 5U4XA 1NV8A 4M7RA 3R3HA 3A7EA 3VC1A 4R8SA 4O29A 3UJ8A 2CWWA 2CL5A 2GB4A 5K0LA 3G7UA 4C05A 4YMHA 1YF3A 3TOSA 3HA3A 4R6WA 5LQKA 4HTFB 3DTNA 2B25A 4WVLA 2JH9A 2GA9A 2PGXA 2VDVE 1NW8A 3FUWA 3EGEA 3LECA 1G6Q1 3DMHA 3I53A 3DXYA 4HG2A 1DL5A 2P1DA 5ERGB 3BGVA 3KQOA 1OR8A 1ZGJA 1INLA 1AF7A 1VBFA 5E9JA 5EIWA 5T67A 4C03A 2PKWA 1VPTA 3BGIA 2GLUA 3GCZA 3LHDA 4YUXA 2B3TA 4QTTB 4RVFA 4E2YA 2E5WA 2P7HA 4PYMA 3FPEA 4E32A 4YMGA 1YZHA 3PVCA 4KIFA 3G2MA 2ZZMA 1EIZA 1O9GA 1YZ3A 3DLCA 4GOOD 3HCAA 3FUVA 4L7VA 5FWAA 2NXEA 2QM3A 2QYOA 1SVUA 5GINE 5HOQA 3HVKA 2C7PA 4G56A 3MB5A 3E8SA 3GRYA 4PYNA 3V8VA 3EVBA 4QPNA 2P41A 4CTKA 2P7IA 2AOUB 3AXSA 4LECA 2OXTA 1KYWA 3JWIA 2IH4A 2GH1A 1XTPA 3NW9A 2OPBA 5KQRA 1VQ1A 3QOXA 2HR1A 4BP3A 3G88A 4DCGA 3OE4A 2IH2A 2ZSUA 4CTJA 1NW6A 3G89A 5EHIA 5EHGA 3FUUA 2P3QA 3MTIA 2P35A 3GRVA 4HRAA 4RVHA 2ZZNA 2XBMA 3FPGA 1KPGA 4MWZA 5CVJA 3LCVB 3I9FA 4PYQA 1ORHA 1M6YA 1R74A 1WZNA 2N47A 3UJ9A 5HIJA 2NP6A 5E1BA 4U7PB 5DTQA 4GBED 5CUQA 1EJ0A 5EC8A 5KVAA 3HCFA 1KP9A 3TRKA 3BWBA 5EKUA 4HSGA 2G71A 2CKDA 2QY6A 2YR0A 3CGGA 3UJAA 3BZBA 3R0QA 3FPJA 2AVDA 3GXOA 3IV6A 4LG1A 3S68A 3WSTA 3ER8A 2AN3A 1JQDA 4A6DA 3ER9A 4DCMA 3OFKA 3BWMA 2ZBQA 1RI3A 3ELYA 5DM4A 4GC5A 2YTZA 1F38A 1I4WA 3DP7A 3KR9A 3Q87B 2ADMA 4R05A 3SVZA 4KDRA 3GGDA 5EG5A 1L1EA 3KPWA 4EMSA 5GM2A 3A25A 3M6XA 3DXXA 4DA4A 4E2XA 3GRZA 2IBSA 4XUDA 1G8AA 1G38A 1KPHA 3SXJA 4F84A 1JQ3A 5CVDA 1Q0TA 3GO4A 3KQYA 2Z6UA 3EVDA 4B17A 3TMAA 1HNNA 1RI1A 3BKXA 5C1IA 1JTFA 3VC2A 4E2ZA 5DLYA 2AOTA 5CD1A 1KR5A 5BP7A 2O0LA 1I1NA 3P9IA 2O05A 4GOMD 4RX1A 2ORED 5EQJB 3UJBA 2ZLBA 3UZUA 4YV2A 4RTJA 1X1DA 3G2QA 2NXCA 3MCZA 5E1DA 3KQWA 2AOTB 3E05A 3HCCA 2ZWAA 3LDUA 3ORHA 2ZW9A 4PYKA 3TKYA 4EQZA 3FTCA 1RJFA 1SQGA 4PYOA 4YV1A 2PX8A 1DUSA 4Z2YA 5K09A 5DTMA 5EZSA 2JG3A 5F2NA 1R8YA 1X1AA 2PT6A 3P9CA 3PTAA 1TPYA 2NYUA 1YFLA 5C0OE 2ZULA 1VE3A 5ICFA 3HVIA 3NDIA 5EGSA 3M6WA 3RODA 3HTXA 3JWJA 3ID6C 3MTEA 4PNEA 4PGGA 3T0IA 3UJ7A 4C4AA 2YXEA 3FUXA 5CVVA 5EEHA 1RJGA 2DULA 1N2XA 3LCUA 2B78A 3THSA 1F3LA 2YVLA 3EEYA 1NBHA 3KR2A 4OBXA 3EVEA 5DM2A 3UJ6A 3C0KA 2OBFA 3SR4A 1SKMA 2BM8A 3HEMA 3JWHA 4OBWA 3VYWA 5IKMA 3EPPA 3NJRA 9MHTA 2PSSA 1XVAA 2ONYA 3UA3A 1R6AA 3M6VA 4RTLA 4P7FA 3B5IA 5DM0A 1X19A 1XDUA 2ERCA 3PX2A 5K0FA 3CVOA 5K0EA 1Y8CA 1L9KA 2AZTA 2AOXA 4RWZA 4YUYA 2IFTA 2KW5A 5HEKA 5DX8A 3LCCA 2AOVA 1VIDA 3LBYA 2EFJA 3KPVA 1VLMA 2ESRA 4DQ0A 2G72A 3KQMA 2PX2A 5CCXA 3EEOA 4BY9E 4FGZA 1O54A 4ER0A 1NT2A 4ZTBA 5K8VA 4GF5A 2NNWB 1G8SA 1JQEA 3OZRA 4HH4A 3I5UA 3FYDA 1JG4A 5DRTA 3TFWA 4A6EA 4POOA 5JR3A 2UYHA 2JJQA 3BGDA 4F86A 2XYQA 3KQTA 3BWYA 4CKBA 5LQJA 3ME5A 1P1BA 3UBTA 10MHA 3K0BA 3BUSA 3AXTA 4EKGA 4PIPA 4GOND 2OB1A 2B2CA 3OU6A 3OCJA 1NW5A 2WA2A 1XJ5A 5K03A 3KPUA 5ICCA 2HV9A 1JG1A 3CBGA 5LQRA 5LQUA 3ELUA 1M0EA 3NMUF 8MHTA 3CJRA 4P7JA 2VZ9A 2FK7A 4RVDA 4RTKA 1UIRA 3I64A 4LWPA 2JHPA 3DH0A 1WY7A 2Z6AA 2EJUA 2HTEA 4MIKA 4C07A 4FT2A 5K0NA 5MHTA 2GS9A 1ZHFA 4X60A 5LR6A 3FTEA 3R9XB 4HGZA 4ER5A 5FA8A 3O7WA 3P71T 4CKEA 2F8LA 1QZZA 1MJFA 3JWGA 3NWBA 3PB3A 4RTQA 2ZFUA 3M6UA 4KWCA 4ATNA 3AJDA 3B89A 3REOA 4E31A 3M33A 5FHRA 2BR4A 1VP3A 2I7CA 5BW4A 3ERCA 3NVMB 4M36A 3DXZA 2VDUE 2K4MA 2PLWA 5E1MA 1RJEA 1ZG3A 3EGVA 3EMBA 3LDGA 4CXMA 1R18A 5H02A 3SX0A 4PCAA 2PJDA 4GOLD 5HILA 4FSXA 4ER7A 2CMGA
chains in the Genus database with same CATH superfamily
4MV5A 5I5EA 2WPTA 3OD5A 1PW7A 1WEHA 2OWDA 1J8VA 3KB8A 3RAPR 1IZYA 5KI6A 2XRZA 3QIAA 2NTNA 3L8GA 5GAJA 3WL7A 3ZY3A 5EJ8A 4OQDA 3K15A 4KQ9A 2X3UA 4FCCA 1F5SA 1T8RA 1C4XA 2BKXA 2CVZA 2PT5A 2XYRA 4ZRNA 5TGDA 5MN6A 1T2FA 4NOMA 1CZNA 2OC9A 2PGDA 3ON5A 4RVSA 4KXUA 3SBXA 4K3VA 1B1AA 2B4YA 1EE2A 3O3NB 4JBXA 4PZEA 3U0VA 2CLIB 2FFBA 3IPYA 3WICA 2YCBA 1E1YA 2XUFA 1ZGBA 3W6NA 4Q47A 3K09A 3B2EA 4HAVA 5KDOA 5LQCA 4DCTA 3B8EA 4N7BA 1WPQA 3BF7A 4P93A 4GR2A 4PFQA 2ARKA 2JFNA 2YVAA 5D3QA 2C7VA 3HBNA 4MR9A 5AFSA 2UYCA 1ACLA 2PVSA 1VM6A 3IDZA 4NDNE 3ESRA 1IUPA 3X1WA 1E7RA 2ZI5A 3UWDA 3WLTA 5B64A 1UC5B 1P2TA 3KSAC 1Z7WA 2VI5A 4IOMA 1S3SA 4IMPA 4NYIR 2ZTHA 2GDXA 4EYOA 4DSTA 2IHVA 4RPCA 1ZSNA 1IZ7A 1JEOA 2ODNA 1MJGA 3LBFA 3NWJA 4IG4A 1WUKS 2QQFA 4B6JA 3LFTA 1QOZA 5KIAA 1FFCA 3GEPA 5JWHA 5AJTA 1YR7A 3E2PA 1CCWA 2JFUA 4WESB 1DTSA 4ZEOA 3IUPA 4C3OB 3ZW8A 2LTEA 1WZCA 5LIPA 3ZHQA 5C9ZA 2GYKA 1FP2A 2J31A 2N46A 5B3LA 3GJYA 3JAWA 5CCEA 3VZCA 1VE6A 2IUTA 2RKBA 3EAFA 5AI0A 4LOLA 2C07A 3PXCX 1H4QA 5BSUA 4MQUA 1QFXA 1I36A 1YDFA 5BV2P 1F2VA 2ENUA 1JG6A 3A1UA 4JBHA 4R98A 5BNFA 3TW8B 1B0UA 2YC2C 1RXWA 4G0UA 1R8XA 4X64B 4EJSA 4WJLA 4ZHQF 2Z2YA 3G02A 2DF8A 2HLPA 3LOQA 5LQSA 5ALJA 2C5EA 1PKEA 3IV7A 4E51A 1NM5C 4TM8A 5IBRA 1VQLP 4QUDA 1QF6A 4BRSA 1URPA 4NFHA 5E3HA 3HXTA 4B34A 3FTNA 1TW3A 1QANA 2IYQA 3O8QB 4QYIA 1M9NA 1ZEJA 4V0ME 4HMQA 4M9UA 1H2FA 2C1ZA 5DGHA 1S8AA 2I33A 3CC4P 4OXIA 1H5UA 5JG7A 3LGXA 4FR2A 3NHZA 5A3SA 3G7NA 3AUSA 4X1YB 1D6SA 1KAQA 2DC1A 2PL5A 2BJHA 4ZCQA 1DIRA 2FZEA 3QUTA 1A9RA 2AJ8A 4DGSA 3IAFA 3MHTA 1WCIB 1YIAA 5AJZA 1LVGA 3LQ2A 1QTIA 3OZTA 1G2IA 2JIQA 3R40A 4JSTA 4R3UC 4TMYA 4QU9A 4TUYF 5DYTA 1N6OA 3GLIA 5E9AA 4G8BA 2GEUA 4C6TA 4K87A 1S8FA 2YV5A 1R9JA 4DBVO 1FFAA 1Q7RA 4BO2A 2XIQA 1ZAKA 4RADA 1S2MA 2ZBEA 3EWNA 3LY8A 1XF9A 3M3PA 4HVAA 2Z08A 2JLRA 4EY7A 2JBGA 1MOZA 1NBEA 3NNSA 3BMXA 4R6XA 1TTPB 1KORA 1DC7A 3CB4A 1H6CA 3MBOA 3EVCA 1BE8A 5EJDA 3R2JA 4QUKA 1KMHB 4AROA 2EFGA 1WQ1R 1HEYA 3TSCA 5I7UA 1DC3A 4DHEA 4AZTA 3GRKA 4JXZA 1XMPA 1BDBA 3QUCA 3VBCA 2LDBA 1MB4A 3IIKA 2FX5A 1L7PA 4P3YA 1BE6A 1DUIA 1BX0A 1CR4A 2BI7A 4EY5A 1XDGA 2QMOA 4O8ZA 2W2PA 1FVXA 2WVAA 1H2EA 4L5JA 3ZQ4A 1FYVA 4L0QA 3CQ9A 3VJLA 3U7FB 5EFOA 2O8NA 5GADl 4NZ9A 3FHLA 4LJSA 4D42A 5E6SB 3EULA 4YJGA 4R1OA 4A36A 1RJDA 3TMYA 5G0VA 3WQBA 4NCJA 2PYDA 3LX4A 3TNLA 5FIUA 5DSZA 5IT4A 2K7ZA 1NBME 5AVYA 4O4LF 2CNBA 5CK4A 1R0SA 4B4DA 4PFKA 4CKZA 1DQPA 1SQFA 2JYGA 1GLVA 1L4FA 1QVGO 1XXLA 3P97A 5KNBH 4IGIA 4JYPA 3SX4A 1J0EA 1QC5B 9GPBA 4GYYA 3KOMA 3RTEA 4YBZA 1U3WA 3K2BA 1P0MA 4I46A 4MYHA 2BCEA 2PKQP 2X0DA 2JU2A 1REQA 2H1SA 2PX6A 2HA3A 1JTEA 3EUAA 2G83A 3LX6A 4U39A 1V3UA 1VIMA 2ZXEA 4OHPA 1PV1A 3U3DA 3UT6A 1YQXA 2EKBA 3BQNB 3NGXA 4FCVA 1JEYA 3HRKA 2IZ7A 5L3SB 5EW5E 3EEFA 2LUOA 3G1TA 3ZU6A 1SU8A 4F6LA 4NH0A 1PJLA 2GF2A 5L9AA 1WCXA 5LZ4A 1DARA 1VPVA 1VMIA 3DBLA 3OT1B 4DC9A 1KD1Q 4BZXA 3W9UA 1OREA 2VF2A 2I1VB 3L04A 5HPYB 1ZJJA 2KBEA 3A0UA 1IEQA 4D3SA 1TW2A 1VJCA 2J45A 2Y1WA 2AB0A 2OAQ1 4X8LA 4M49A 2JKVA 3M81A 3T35A 2QRQA 2QUBA 2RGUA 1TF2A 3C8ZA 4FMDF 4DV1B 1GUZA 3HUTA 4KODA 3Q2OA 2ZI7A 1ML3A 1DRKA 2TS1A 1E4EA 1E6KA 3NS7A 2WLSA 2RHGB 2ZB3A 4KDCA 4YI3A 3W9BA 1TM3E 2AXEA 3OLZA 3HDQA 1YTLA 2VYVA 3S1SA 1K98A 1PL6A 1QUEA 1L4YA 3Q9LA 2OBMA 3KKMA 2I6FA 1TGYA 2Z4TA 3PQEA 4MRRA 2F1HA 2R00C 1AKMA 3HP4A 2DHQA 4LK3A 5SZHB 1JDPA 3T5DA 1NUQA 3VC7A 4A10A 2OKCA 3EGDB 3QVUA 3R9WA 1GCGA 4QNBA 3ZCUA 3TL2A 4EGFA 1N75A 2LL8A 4ICIA 4FPXA 4QU8A 4RZHA 5BMOA 2OYSA 4F3CA 3KC2A 3WOHA 4DEYA 3RVLA 2BFEB 1E8NA 1AQJA 1KH1A 2E4YA 2AA3A 3AKDA 4OPMA 2UYOA 1C9EA 3WQRA 1YUBA 5CB8A 5DGTA 1TA4A 1MIHA 2FOXA 3R4CA 1M6WA 4PZUA 3HO1A 2EX4A 1T1GA 3A4NA 1RHQA 5EMMA 4CTNA 5BWMA 3FHJA 4YUVA 3AK4A 5FV4A 5DI9A 3T3EA 2ZYWX 3N2KB 4HPJB 1EFRA 4GRDA 4WNAA 2HOQA 2JGNA 3U3KA 2Q5LA 1Q6ZA 1L8AA 5CRIA 2EIAA 4V1CI 2PO5A 3WFJA 1GVHA 1CU1A 2GB4A 3K9BA 1XZBA 3OZXA 2FW6A 1T5HX 2JLSA 2XGSA 1FFYA 5LQKA 3HA3A 3D4BA 4L6CA 5EINA 1K7YA 4JLWA 1ZLXA 3MLBA 4XB2A 4ZV4A 1TZ2A 1WJGA 3EUEA 1EK6A 3PPYA 4B6OA 1BWSA 3RTBA 4D0GA 3MVEA 1DL5A 3L7DA 2V8OA 1OR8A 3II6X 1XVTA 2SKDA 4MQMA 1NLZA 1E9VA 4C03A 2PKWA 2E2WA 3EHEA 2ZB4A 5JAIA 2OBLA 1KVTA 5D8DA 1OH5A 3ENVA 3IALA 3GAZA 2MSDB 3GZ4A 3NRJA 3PVCA 4REMA 3JZAA 4FNMA 3ZNQA 1RLMA 3NB0A 2VKTA 1I1QB 3DLCA 1U9IA 2P9YA 3OSUA 4X8MA 3TYXA 2QF7A 4RMJA 5IDXA 3R3UA 9ABPA 4IIVA 2FJPA 1RHRA 4JOQA 4N3CA 4RIGA 4GYJA 2P2DA 3MB5A 4OHBA 1ZCZA 4RC9A 1DEOA 3V4SA 3HO6A 4KE6A 2ZRBA 3VVMA 3WB2A 4DIOA 3E7FA 3A6PC 1T15A 1G8FA 1JDTA 4IH9A 2QGFA 2CUKA 1Z2DA 2WOJA 1OZ0A 4LTNA 5KQRA 4OP2A 3OAAA 1VJ5A 5LD2C 1J9EA 1T26A 1XXHB 1T9CA 4OXNA 4B3FX 4BP3A 2RI0A 4DCGA 1FSSA 5FFNA 4EH1A 2CVPA 2DUJA 2RDMA 1Q0PA 2QTNA 1E64A 1Y3HA 2H2IA 3ORSA 4RVHA 3S0JA 4NAHA 4JL5A 4UUQA 1DI0A 4DLLA 1ORHA 2M32A 3GFQA 1VJDA 1NN3A 3A58B 1KU0A 1SWVA 2AR7A 4OBBA 3W8NA 1Z16A 2ZXUA 2GPWA 4G23A 1Q1BA 4JB2A 4H2WC 4IFBA 2NX2A 5E1BA 3E82A 3B9QA 1FNCA 2M1ZA 1I6WA 4KHPB 3TD6A 4ILEA 2CKDA 3TLKA 4MVCA 4RK6A 5D84A 5EFZA 1WRBA 5KVVA 1Z2CA 2HDHA 3ZVRA 1G41A 3AONB 1TE2A 3DAGA 4G5SA 3H5OA 4P0PB 4DCMA 3BWMA 3ZWKA 4EY3A 4CLDA 3CX7A 4KU4A 4GM4A 1F38A 1RXSA 4CHTA 2VYND 3KR9A 4R05A 1KY5A 5KDLA 5A5EA 3P0RA 2QW1A 3VU9B 4JYMA 3T5BA 4JFAA 5H3LA 5KCMA 4PXSA 3U1TA 1AKYA 1ESDA 4I08A 4OHMA 5DCWA 4MUYA 2R6FA 2IBSA 3STWA 1P0IA 4U7JA 4EEXA 1Q0TA 4DNQA 4NE2A 4AD8A 5MGBA 3LQKA 1M8KA 2NUTB 3TMAA 1UFVA 2FWIA 2HX1A 1TQHA 2IODA 4RVNA 4F4HA 5CD1A 1EHYA 5AM5A 5HR5A 4AZ3B 3U4DA 3QVJA 2R8RA 1AHIA 4YAIA 1YNSA 4GOMD 5FA6A 3W78A 3AVUA 1N2ZA 4INJA 2VT3A 4DVGA 1Q6YA 1TZJA 2IEYA 5KWEA 1DBSA 3KDAA 1I7QB 5M29A 1FFEA 1WW3A 2IUYA 1XRQA 2LV8A 1AKWA 2NLOA 4YCJA 4E13A 2VR1A 4DDUA 5A6VA 3PEWA 3SQLA 3MJRA 1CRQA 1T10A 4H2DA 2J8ZA 3TVTA 2GCOB 3ZZ0A 4PO1A 1S2NA 3N74A 4RXUA 2OHVA 5KC9A 4JOCA 1QFJA 3ACBA 4JJGA 3RODA 4TLCA 1M2HA 2ONJA 2BFWA 4ZD6A 2EX1A 4KUEA 1B6RA 2XT6A 3KELA 2ZBGA 7ABPA 1QYVA 1W73A 3TPCA 3OURA 2DULA 2JEOA 3PVZA 2A6PA 1GQRA 5KOYA 1FYXA 2WOOA 1A69A 1KBZA 1R6XA 4E3ZA 4PC3A 1BHQ1 2QAJA 3GGPA 4S04A 1F3LA 1Y1QA 5BN3B 4RE5A 2C04A 2QN3A 4L8WB 3I4LA 4RFLA 5TDHA 3IE2A 4OYHA 2JLYA 4Q3DA 3DPIA 2VBFA 1OGYA 3CM0A 3NJRA 3PD7A 3PUHA 4BVLA 1SUPA 1XDWA 4BU0A 5B7GA 5HBRA 3TW8A 1SOWA 1ZNZA 4KIUA 5COBA 5DNWA 4LRQA 4ARSA 4QOIA 1IK6A 1YL5A 4F11A 5DN6D 1GGJA 3EFHA 3FPSA 3I0MA 4KWIA 2OBYA 4F1JA 2PUWA 4DR3B 1O6GA 2ZB8A 5AKYA 4D3FA 3ZC3A 2OV1A 2F3QA 5HM6A 2IEBA 4O2BB 3TIGA 4I5GA 2ZT8A 2XDQB 2QQEA 3DC7A 4QC2A 5JJBA 5J3JA 3KXPA 3HG7A 4CV1A 4W63A 3R6DA 1WETA 1RFLA 3PLNA 3SMVA 3HLYA 2RARA 3CMCO 5TF0A 1Y5NA 4XYBA 3MWLA 1KIMA 5LMUB 3VMFA 2ECPA 1XLUA 2IKSA 3DFFA 4KXFB 3CO0S 3PNSA 3OVMA 4XJXA 5AXCA 4KITB 4GGOA 2QA5A 5IVPA 1M67A 3QMVA 1LNQA 4ER0A 3WAGA 4AMUA 5J4YA 3LBHA 5K8VA 2YS6A 1G0OA 1JQEA 2GNAA 1NJFA 1RBZA 1HYQA 2E1RA 3AVQA 3KSRA 4YP6A 1WCIA 4H3KB 4EOGA 4LDJA 4YV7A 3W5HA 2DT8A 1T3SA 1KMNA 1LZLA 1RAHA 4ZVUA 2PZFA 1OJ7A 1QWSA 1KH2A 5AJVB 5CFNA 2ZSDA 3AGPA 4OHWA 1QF9A 3DPUA 3Q12A 4RH3A 1FP7A 1MVLA 2O2JA 3B13B 3D6FA 1KE1A 1DV5A 2B2CA 2CXPA 4FMCB 5HF8A 4E4TA 2AEEA 2Q2QA 1K5PA 5LYJA 1VI2A 1PGPA 4I6GA 4BNXA 3I2IA 3AVOA 2H16A 3R9XA 1KS9A 4L72A 4OI1A 2VLNA 3BF8A 1T8KA 2QI9C 3BMCA 3MMXA 4HO1X 1YJQA 4JJ8A 1UXJA 4RHCA 2D1TA 4CV2A 5JCJA 2DJIA 4GZ6A 3B2QA 4KQ1A 5AUPB 1W85B 1OPXA 4JWTA 4ZVKA 4ER5A 1US8B 3RC1A 2EDCA 3VR4H 2H9IA 1JG7A 3OFND 2ILVA 4RHEA 1YRLA 1Z17A 3ORYA 4ON9A 1FPMA 2KHZA 2N75A 3UQYS 4NAUA 3QOFA 5KC8A 3S2SA 5KJFA 3VYTB 2Z3WA 5HOEA 4IQ8A 3UXHA 1SCJA 1U8XX 4A27A 2VAWA 4EJ2A 2DJ5A 5L45A 4W1RA 1ECFA 5FAXA 2X6RA 1WB5A 2W4MA 4LVNA 2YZMA 1A7AA 3LH5A 1N1DA 4MMZB 2G9UA 5EHZA 5FX2A 1CUCA 1XDZA 1LDGA 2KJQA 3WGZA 1QC5A 4RGYA 2YQZA 1M75A 2BHSA 3TZEA 2Y05A 1I30A 1EKXA 1I4OA 1M3SA 3ZHZA 3G1IA 3B6IA 3O26A 2R84A 5H3CA 5JEDA 1TAHA 3A3NA 1LLFA 5ARBA 2GJ9A 3MT7A 4CIAA 4PAWA 4LZJA 4IINA 4J03A 1SRQA 3PGKA 1GGFA 3D64A 3ELWA 1W2HA 1GL3A 2P2CA 4J7XA 4X3OA 4XCXA 3VU8A 1CR0A 3KG2A 3WYBA 1KI1A 2O57A 5L3SA 2Q4OA 2W37A 3H83A 4LXHA 3TBHA 4ER3A 5KTNA 1VQ8P 1J20A 3OLWA 2H4FA 3OT1A 3DTYA 1XD2B 5TVKA 1TJ5A 1U0NA 3L4SO 4QQKA 2AFIA 1MR3F 4HZGA 3ZGLA 2C9OA 3AJRA 3ZCVA 4EY6A 3WLIA 3F3MA 2QUHA 3PXEA 1NN5A 5TQJA 4KPYA 2VCYA 3G2PA 4C5BA 4MVXA 2GTPA 4GMDA 1R5BA 5K05A 1IZZA 5CFOA 1AB5A 4U0AA 2RHBA 5FXMA 2H7VA 3U37A 1MFPA 2XT0A 3EIHA 1DP4A 1JL3A 2A3RA 4S1TA 3TAHA 2O3TA 1FRFS 5A1JA 1NVAA 3CV3A 3GKLC 1JILA 4JI3B 3AEUB 4LQCA 1UM8A 2H85A 4H6PA 4WLOA 1YS2X 3WWEA 4DZTA 3ZOKA 1AN0A 4FVTA 1ZC4A 2VRWA 2H00A 3H86A 4JBWA 3P0JA 3H2JA 3EDMA 4YX9A 1XP5A 3GUVA 3JD2A 3K1ZA 5DSTA 1HQYE 4XUEA 2XUAA 1V8PA 3EGDA 3M7IA 3DLAA 4HB4A 1CZRA 1NXPA 2O6LA 2QRPA 3GBPA 4UMEA 3RTAA 3CC8A 1AOXA 1SBYA 4KVGA 1T34A 3KQPA 1GQFA 1C7IA 2B21A 4YHBA 3MMZA 3RARA 4EELA 2PEOA 4H2XC 4AICA 3T7RA 2J5KA 3ZXUB 3K9QO 4BE9A 7REQB 5EPUA 4PX3A 1RRCA 2ODTX 2IIBA 4FOLA 4MPTA 1EM6A 1K7EB 1VGVA 3EY9A 2KR5A 3P0FA 4B81A 3L7NA 3Q3CA 1LLUA 4LCJA 3N2KA 3TE6A 2OM6A 2AFVA 1IUOA 4NCHA 1M5UA 2JJYA 1GA4A 1S6YA 2XKJE 3B6ZA 4G1CA 4I4LA 4IXMA 1CNFA 3JQPA 5DHTA 3ZQ6A 4N03A 4BOYA 3NT4A 1J5XA 3L6BA 1A7UA 3KFLA 5BUCA 5LLTA 1QRTA 3NTOA 1ISPA 3P9ZA 2W6ZA 1GVNB 2Q6VA 1UBEA 3WWCA 1SG6A 4X63A 3P05A 4BTVA 1O96B 3H5VA 3HNPA 3NQ41 1M10A 4HF7A 2JLQA 2BR3A 2Z9DA 1FDUA 1T91A 2QVCA 3KT8A 2WUEA 3LKBA 1UXHA 1QRAA 1RKUA 2R5FA 4N9QA 4YA6A 1T2CA 2BUOA 2IPXA 1W35A 1JLRA 3VSCA 4ZYVA 1A9QA 3Q4GA 1Q0LA 5ETJA 2IDKA 1YKSA 1SJ9A 2IDJA 2JD0A 5B5SA 1GU0A 1P5RA 4MLCA 1CS4C 4OJMX 3H7IA 4I1RA 4P3NA 1XPUA 4N3AA 4OFZA 4XX0B 1YBFA 4NULA 3R5TA 3CLRD 2ODAA 3KLOA 4E5UA 1FIUA 4L3VA 2G5CA 3D6NB 3HJTA 1XRRA 3TDKA 2NTYC 1M7HA 4CETA 1Z6PA 5DM70 1MPXA 2WBLC 3QJ5A 2FP4B 2NSHA 5GWXA 1ZM4A 2BGMA 3P8ZA 3E22A 3KKNA 1UDRA 1KJZA 4O0LA 2I9KA 1HY3A 2EGGA 3D3KA 4MKFA 3AIKA 4DB4A 4X45A 2A35A 3DCYA 3MXTA 2P4SA 5CTAA 1A9XB 4H1TA 1OMOA 1Z2EA 4XRGA 4M86A 1GZSA 2AXPA 2ANBA 3D5QA 4YFVA 1JR2A 4QRIA 3K9WA 2W0SA 1RPNA 3PFCA 3QYFA 2WF9A 1N2BA 4UQPA 2JI6A 4X20A 3ZKAA 4TVSA 2PLFA 3AOGA 3L4BC 4EL5A 2FR0A 4UDNA 2HJSA 4UBNA 3HUEA 1QKJA 4ZVNA 1ZPDA 2XCTB 1O6ZA 2YJTD 1BFUA 5KQLA 1J5EB 1XO1A 3U31A 1VQOP 1A5BB 5FFMA 1E6UA 3C3WA 4K05A 4B4VA 2GCNA 3TRFA 1HGXA 3UXMA 3QEBZ 3L6DA 4BJHB 3KR1A 3VPDA 5EWJA 3PICA 3SOZA 4X6LA 5A3RA 4JGGA 2FRDC 2C5AA 2OO5A 3MUOA 4HLUA 4IFEA 2CJWB 5IJ0B 4EPYA 2HRBA 4KRGA 2DUWA 4BJ5A 2GILA 3N2GB 1SU4A 2OEPA 1QG0A 1Q7TA 3PWSA 4ZDIA 1CK4A 2A5JA 3CN9A 3NHKA 2DEUA 1Y7IA 4N65A 5DTEA 1U0RA 1QGED 3NDPA 4QBFA 5GOZA 4FI3F 2O2GA 5DBGA 4L85A 5J2TF 3VAZA 1WSWA 4ZYUA 2A7QA 5D6NA 3SHTA 4XVCA 2RK6A 1WU8A 3ESYA 2Y71A 1DAOA 2XEDA 1ETHA 4NMLA 5SY4A 3RT1A 2ECKA 1JZSA 1NDHA 3T3IA 1G4AE 1EP9A 4D4LA 2CJPA 4F3RA 2IVFA 3DKIA 5KYNA 2G9ZA 4TTRA 3AY3A 4OMCA 3P5BA 2BFMA 4URWR 5ARCA 1S02A 4HWTA 5KQSA 1KS2A 5HRUA 3K8ZA 3P52A 2LVBA 1QR2A 2VSFA 3LUGA 1SVLA 4NBWA 2Z5FA 4R0VA 1H2ZA 2WT4A 3IDFA 2NSYA 4EF6A 1F8UA 4IR7A 1GSAA 2J7KA 4W99A 3UWOA 3MQFA 1L4UA 2GAAA 3RDPA 1BA3A 4GXQA 3O2QB 4ALKA 5FTWA 4RWEA 2PEJA 2ZRNA 1VHNA 4XDYA 1XCMA 3F49S 3FYUB 3WWDA 5CLGA 2DPXA 3MMSA 1Z2AA 1WCV1 2BFPA 3K8YA 4WVFA 3TRHA 4BN0A 1IM2A 1D2MA 3F2VA 2QJWA 4PCLA 1CB7A 3JU3A 4XM0A 4ARVA 4ZHQB 1SXJD 1R27A 1DMSA 4YPFA 5CVCA 1U9CA 5GGYA 2Y6VA 4C7BA 1KMIY 3D7MA 1XLVA 3HPRA 1A1SA 3G5LA 4BQIA 1Z13A 3PLRA 1GTJ1 1JAIA 2P75A 4HB3A 1I3NA 4KOAA 1WEKA 5AM0A 1E3JA 1T9GS 3WHKA 1CVLA 4QYWA 2WD7B 3C3YA 4B4WA 2PHZA 5IJZA 1TZCA 1E69A 1O0CA 4J1NA 4XB1A 3G71P 3WLJA 2F43B 3JS5A 1OLUA 1KL7A 1U0OC 1YBHA 2XF8A 5LZ2A 4GZ3A 4MW1A 1OWPA 1BEZA 2VVTA 4O29A 4JJKA 1OXMA 2M2IA 2WFLB 3TCKA 3AETA 1YITP 4RGBA 1V43A 3UMJA 4C20A 3B51X 1G8MA 2PZBA 3SBEA 3MFYA 2V6FA 5C3UA 3M83A 4A03A 3QKRA 4TUYB 1SELA 2QVZX 4JKYA 2UXCB 1VA5A 2GA9A 2HF2A 4PZ9A 5EVCA 2SKEA 4G84A 1NG1A 1E2NA 3V80A 4A5SA 1C9MA 4BV3A 4N12A 2JEZA 3RSSA 3CZQA 5TQ2A 1YZTA 5K0ZA 1JNXX 3JYPA 3RJ9A 3QGMA 3M8KA 2R5WA 4MPDA 4O63O 3I9MA 2ZAYA 3ND8A 4UXJA 1PJQA 1XNJA 5AESA 1NQTA 4COKA 1XFDA 1R9MA 2ZRQA 3GVPA 2PKEA 3BE4A 4TQ9A 4DREA 3LMKA 1V8FA 3AMVA 1O89A 1KQFA 3IVMA 5SYNA 5BYAA 2ZUEA 3LW8A 2BRUA 2IIQA 1GYPA 5BR1A 1MXFA 1UBNA 4LJ7A 1R0XA 3LOUA 4TS9A 3R7NA 4WI1A 2H57A 2HQSA 4CLRA 1JIXA 1YC5A 1JKJA 3PI6A 1BHSA 4ZYYA 2ZQYA 4JP3A 3PL1A 3GLSA 1G8JA 4QATA 3T7EA 5FUMA 1OLSA 1W85A 3VNBA 3RKSA 2IZ0A 3G88A 2Z44A 1D0SA 4ZEVA 4ZOEA 4N8DA 4FFPA 4HAZA 4PSVA 1KQNA 4KN6A 2BOVA 4QT0A 4S1OA 3G0GA 4K6CA 5E6RB 1WPRA 4U0DA 1JS1X 3CUTA 2G1AA 2OQ2A 3S55A 5EJ9A 1OX4A 3QHPA 2IYWA 4M7OA 4B73A 4YLGA 3Q3GE 3WS7A 1YB7A 4YIHA 2A9JA 4A3SA 3NGLA 3U3JA 3F9IA 1M2NA 1OVMA 2Q3LA 3JQ8B 3KP1A 1Y98A 3D0OA 3G8DA 4PSAA 4RA9A 1ECLA 5C32A 5LMZA 1IBLB 2NVWA 4Z99A 1DZ3A 1V9CA 3NOVA 4MVJF 3RSFA 2HMUA 1KOFA 3K16A 2JL1A 4Q00A 1YB1A 5A4IS 4TV8B 2KMLA 1IY2A 2D59A 4JITA 4HWGA 1XTVA 1I5OA 1XQVA 2QDKA 2WVGA 3S2EA 1HT3A 4Q4DA 1IAQA 5CA0F 5LN1A 1RSZA 4KO2S 4N0PA 3BILA 2NU8B 6REQB 5B55A 1A9TA 1QIJA 3IELA 4IPTA 4H7JA 3OOEA 4B17A 1J2JA 1YS9A 3BSFA 1RI1A 2H2DA 4QDZA 3VRLC 2FZWA 3JALB 3PGLA 4PLVA 1C2YA 1BJRE 1KQSO 3Q0IA 2HCFA 4FMDB 3CZ5A 2QSUA 3P9IA 2C4NA 3E9MA 4FFDA 1CY6A 3KZXA 5D85A 5KUTA 1P61B 2OA0A 3L01A 4HEJA 2QPOA 1M6VA 3F4BA 3IQIX 5DWVA 4M46A 121PA 4QXOA 3PJRA 4B2IA 1N2CA 1B74A 2AOTB 3A9WA 1XTSA 5AW8A 2NQTA 2QXUA 3GZJA 1LV8A 5KOIA 3PE6A 1I80A 1ZK3A 4CLXA 1DUSA 2RCYA 4XDHA 2DWQA 3RYIA 4ZALA 2PT6A 3R8XA 3W05A 1NVEA 4CT5A 4DR2B 2BGKA 1KR2A 3ZG6A 3DJFA 3JZMA 2P6MA 3L8EA 2N42A 2Q2WA 4LISA 3EUFA 2O7QA 3U9TA 1QK4A 4L7QA 2QZZA 4NK5A 2FG6C 3MSCA 4UEQA 3WFIA 4AP6A 1A4UA 2W4IA 2QN6A 4FD2A 4ZPXA 1DWPA 5HV8A 1ZCJA 4JR2A 3AR2A 5E0OA 1NQOA 1OZGA 3TQOA 2OCKA 3AEXA 2OM2A 3SR4A 1U80A 1Z5VA 4ZTZB 3HEMA 1B7GO 2BMJA 1TC2A 3SJBA 4MP3A 2JCYA 1B43A 1C0EA 1PHPA 2PSSA 1U6IA 1NOIA 1KY3A 2ONYA 4MVJD 4DSOA 2OCPA 1GPJA 3F6CA 3QE4A 3AZOA 5F4ZA 3D0RA 1QXSA 1I2CA 4R68A 4RIHA 5JSZB 5CH3A 2ECOA 1I24A 2O3QA 3PC4A 2QDXA 4GO1A 5LB2A 1TTHA 1QZXA 2ZATA 2AHRA 1YFKA 3JVUA 1G5HA 1NLFA 4BWGA 1B6GA 3DS8A 3QFSA 4IDGA 2O7RA 2FKAA 1HQDA 2OORA 3HY4A 3OQVA 4HLNA 4XWTA 4O3MA 1M1NA 1H2HA 2GZAA 3ZVMA 5EMNA 4WLEA 5CU7A 2C97A 3B38A 3V00A 1QDLB 3L7JA 4R1MA 3QVTA 4HRYA 4TROA 4Y2RA 1XA3A 1OFUX 1TYDE 2DPGA 2VUIB 1SIWA 4OIMA 5JMPA 3ZXSA 4BY9E 2GDJA 1CX9B 2HIAA 1EXDA 3T7CA 5F21A 4JAVC 3IJPA 2W6JD 2PKQO 5JS7A 5EXXA 3OZRA 3CEAA 3QK7A 3AT1A 3FYSA 3WKCA 4JDPA 1D1TA 3G5MA 3BGDA 2Q5QA 4PYRA 3K9LA 4E5PA 3F7NA 5CG2A 1UM9A 1VBMA 2PJZA 3A6LA 3PGVA 2CLDX 4L9AA 1N8KA 4QPJC 4KR2A 1XZKA 2R96A 1O95C 1G17A 2O59A 3DYVA 3O83A 5HDQA 3RSCA 4W9NC 3K4QA 3M6LA 4XX0A 1F17A 5EUQB 1C0IA 1DRJA 4GOND 4JOBA 4UNRA 4ZIRB 2JGRA 1P2FA 1YCGA 2WJZB 4E14A 1OFGA 4Z7QB 3DAPA 3ILYA 1ANKA 1Y3CE 1IE3A 5FRDA 3EODA 5LQUA 1NSTA 3BMOB 4MV9A 8MHTA 2VHCA 2VZ9A 1EU1A 1U90A 2MSNA 2NZ8A 5IAGA 5T4HA 4UHKA 5ICSA 1QFSA 2JVKA 3E5NA 1Y4SA 3EA5A 4BBJA 2HNBA 4QX6A 3BTVA 1ZHFA 4X60A 1IG0A 1A9XA 1CJBA 1V5GA 3LPCA 3DT8A 4QWWA 3MD9A 4BATA 4EYEA 2Q9BA 3PXAA 1F0KA 1A2KC 1E6MA 1OXTA 3BSSA 3PGMA 2O5VA 4HSEA 3F5DA 2OLJA 4LXUA 5IC5A 4DQLA 2VTBA 2PJRA 4FB5A 3HB5X 3D8RA 4KC0A 3CSDA 1AIPA 3DONA 3U6KA 3ST7A 4E31A 2OD9A 1L4KA 2A67A 3RAJA 4E21A 2WHYA 1HOXA 4YJ2B 1X1EA 5ECYA 2ZTSA 4GW3A 4CKEB 5DGCA 3CCUP 2YDXA 4JOSA 2K0YA 3NG1A 4RD1A 3L1VA 1K7FB 3WGHA 3WL5A 4ER7A 3UAXA 4YWJA 1UT6A 1IHYA 1SCIA 3AF3A 2PKYX 2IYSA 2QPLA 4FOTA 4HX5A 1LW6E 1SPXA 3IUBA 3IQWA 1EE9A 2VPWA 3QVSA 2P2ZA 4HFJA 4YMSA 2J09A 2CJWA 2NZYA 1R8SA 4P1ZA 1I6KA 3GZLA 5ALQA 1EGMB 5FUBA 2X0IA 3AI2A 4ID9A 3W3AD 3ZZMA 4TVOA 5K99A 4CLOB 4A8JC 4CWAA 4ZQIA 2X2FA 3BMQB 3DMTA 4A0FA 5KP8B 2Q3DA 3V8RA 3OM0A 3U3ZA 2UYGA 4UCQA 1Y8RB 2VAVA 4AJ4A 2WMYA 3WLFA 2REBA 5IASA 2O5RA 4BZZA 8GPBA 3NV9A 4KMRA 2DY0A 2XLCA 4YROA 1TAQA 4G3XA 3TRDA 4AT1A 4QTZA 4BIIA 3A3KA 1N6IA 4KYIB 3OZCA 4QBTA 1LLQA 2B4AA 2VJKA 3JPWA 4AX4A 3KYJB 3I62A 2ZUDA 2QRZA 4WT7A 2VJDA 2VSYA 1C4WA 1HH4A 2F3UA 2EQBA 3IA7A 5LBIA 3F67A 1WDKA 2LW7A 2ZYRA 4ZAYA 3ZK9A 5JC8A 4FK8A 1YQUA 1ZL0A 2ZR7A 2BMEA 2WHPB 2OOKA 1JFSA 3RH0A 1ADGA 2HA2A 3R5FA 1WVIA 4WXHA 3QVVA 4ND3A 3BL6A 1XEWX 4WIAA 2XW6A 1USKA 1WV0A 1C7FA 3R24A 4MRVA 1AXEA 2C5GA 4B40A 4EJSB 2ZWOA 1Z5ZA 2PVCA 3H16A 3PUYA 1WS6A 4DT1A 3JV7A 1PFUA 3W5SA 4KMMA 5EHGA 1DPFA 5H82A 4X6YA 2P9CA 1N33B 4FLMA 4FEYA 1AQNA 2GAIA 1UBFA 4DLYA 1PVDA 2Q3MA 2ILTA 3T9EA 4ZHQA 4YT2A 5LQNA 3GLIE 1GTVA 1IOLA 3OWXA 4JC5A 2OCBA 4Q24A 1FS4A 4L02A 1YK0A 1LBSA 3BAFA 1S0UA 7AT1A 1Y80A 3D54D 4X00A 4NNPA 2WWFA 3I61A 2D4HA 4UQLA 3ETJA 1QH1B 4FS3A 4QDUA 4WINA 4BLUA 5EZQA 2JC3A 2QA4P 2VLBA 4LNHA 4D41A 3AI7A 2XMDA 3EQ9A 4WEOA 2F43A 3PU6A 1VYVA 1OAKA 4LHSA 4MMXB 3D7NA 2A7XA 2TMYA 3CKLA 5JXJA 3VR2D 1QSGA 2A9OA 3MINB 1AQIA 1DIGA 1WPGA 4XFDA 5JZMA 5BUSA 3EC1A 2FEPA 1HY8A 3QW2A 1QIGA 1Z29A 3IODA 2J4DA 4GOJA 2YXBA 5JWRA 3WYEA 1UK7A 3C3MA 2HQOA 3KT0A 4TUYA 1M0TA 5KAMA 1D0VA 2QG4A 2ZYIA 3OETA 4G2NA 5GY7A 5B2FA 2D3WA 1KVRA 3FI9A 4BC0A 2BL4A 3TWOA 2CUTA 3RYHA 4H4DA 5HYVA 5K0JA 3B3QA 5J23A 5IWAB 3AO0B 1UJ5A 1R0BA 1UK6A 1Z0SA 1PFQA 2Z95A 3LSYA 1QH8A 2PGIA 3TTTA 4D82A 1DFGA 3F5FA 4A8HA 3CO5A 3K0EA 4QRHA 4CEJB 2H08A 3RWMB 4KYUA 3LO5A 4URYR 3LP5A 3RREA 1K5DA 3M2TA 4YASA 5FOQA 3GA5A 1GAEO 1WXGA 2FFAA 2C96A 3KXIA 3QVGB 2HPHA 1QK3A 4AAYA 4C2UA 3FR7A 2DB3A 1JR6A 4AZVA 2BP7B 4MA0A 3PQ5A 1J2TA 4MGKR 1VC2A 3T9DA 2SKCA 4BMYA 3NHBA 4EZEA 1XMJA 3SF8B 1NNI1 3QXCA 2ZUSA 4YRKA 1FQKA 3MJFA 1C3OB 3OQMA 2QM8A 4D9IA 1KLPA 1NRIA 1BU8A 5C81A 3CRNA 4AY5A 1J09A 1K8YB 2WVHA 2W4QA 2C9ZA 2ZJ5A 3DHWC 1UMDB 3HYNA 4UULA 3UMCA 2QMYA 1B8VA 1PJTA 2WWYA 4B6RA 1XJWA 3DZFA 2LP4Y 2GAJA 2OZVA 1PE0A 2VDQB 3N53A 1FL9A 2F3TA 4KI0A 2L9FA 1SC9A 4FDLA 3PG5A 3W2HA 1ISHA 1LSOA 2AVAA 4O4LA 1L7DA 5ABPA 2Q4BA 3L8HA 3SGLA 1Q1EA 1W94A 2VZLA 4ODIA 2B82A 1N3LA 3G8BA 2JB0A 1XQXA 3JQ8A 5TVGA 1DKNA 1U02A 4CBVA 2V59A 2EIXA 1ZX1A 1D0IA 3NT2A 1PEYA 5C5EA 2Z09A 4WYMA 4O8CA 1KWKA 8OHMA 4KW7A 2IEGA 2KGDA 1LK0A 3P20A 4OU5A 3UTDA 5BW5A 2PAAA 1VI6A 4JC0A 5CYFA 4BXOB 4TV8A 2P27A 4EO4A 3DE2X 1W8DA 1CJCA 2Y8EA 3TUZC 1Z9BA 3JARB 3MHPA 3TQSA 1E1QD 1JHVA 2WYVA 2KODA 1G3IA 1P1JA 2CXOA 3MMPA 2OWEA 2R0QC 2JBWA 1NE7A 5B3AA 2CEKA 1LDNA 1QJ4A 1XC7A 4RIFA 3OHMA 5CM2Z 1CNEA 4LY9A 1EXWA 2BEUA 2P6UA 4C78A 3HCOA 1Z4OA 4LYEA 4I6JA 3KE8A 4W7SA 5FD8A 1YKFA 4ZVMA 2V58A 3CRRA 5CXXA 1RXIA 1AKTA 1ZUD1 3EPHA 3T9FA 3OW2O 3KLMX 4M1QA 1RKQA 2NV0A 1DX4A 5M2QA 3ZUGA 2AFDA 2ZPAA 2C2HA 2FCAA 3ZTWA 1PD0A 4KGXA 3VNVA 1K9SA 3FVWA 3ICWA 5TS2A 1ZOLA 4KP7A 3PA8A 2QLFA 3L93A 1QFZA 5DTRA 1Q84A 2JHGA 4GRAA 3COJA 2ZJ2A 1FFSA 2LGJA 1GARA 4DJTA 2GPYA 3CLHA 2A0YA 2VHYA 4ZU3A 3A6FA 1L8QA 2G80A 2ORIA 1H0SA 5SYMA 3QEAZ 3PC8C 4G8DA 3C6YA 1IJEA 1VRWA 3DDWA 4ZQBA 5HKKD 3CMAP 1QE3A 2B2XA 5LJLA 4QGHA 1K8ZB 2UKDA 4RDCA 2QWXA 4ANFA 3V4PB 4C2BA 4QM6A 5ESWA 4RK7A 5H0IA 3GXBA 5AK3A 3UOAB 2GJ8A 1W5TA 1RYBA 2W6PA 5ITVA 3H3FA 3FH0A 2D1YA 2AJTA 1XNRB 1V71A 4EG1A 1XZDA 2JD1A 3PQ7A 1YI8A 3WX0A 4W9MC 5I4IA 1R37A 5F9FA 4R31A 3RFUA 3NVKI 5JBNA 1P5FA 2ZSFA 5IFKA 4MCJA 4UNSA 1C3LA 1QB7A 4FDAA 4DHWA 4CIBA 2GFIA 2M9MA 2O3UA 3KSDO 1CRZA 1H2YA 1IIBA 3RUPA 1AK2A 2K5XA 4UC0A 1E1CB 1FW8A 4DV7B 2YMLA 3SF0A 1P2BA 4ZO4A 5DH9A 4I50B 4A2QA 2PWYA 2GKSA 3QEMB 3CHYA 1EHIA 3B20A 2VYNA 1K2WA 2HSJA 2WHEA 1X1BA 3C3CA 1SR8A 2JKZA 3CG0A 3NTVA 2IH2A 3R3HA 5JBIA 3HBAA 1HC7A 1AUVA 4JX9A 1NRJB 1E1LA 2OXRA 2XCQA 2VRBA 4OHRA 1CC1S 3IVAA 5F78A 1ULTA 3AHJA 3WLKX 2QRNA 1RPAA 3KLBA 4YP9A 4H7FA 2CF6A 3K7EA 4L27A 3V8MA 1IBMB 3RK0A 3N1UA 4BMSA 2A0WA 1YS7A 4X95A 1L7AA 1T9GR 2HMVA 2VNHA 4O4IB 5AH0A 1I9CA 2VJMA 2H2FA 3AY7A 4Z3KA 5JQGB 3GQVA 1R0CA 2QTRA 3A4YA 2CK3D 4OJYA 1SQ6A 2PFKA 2XTJA 2IYEA 2NV6A 2Z5GA 4TKMA 5FL7D 5EJEA 1EYZA 3AEKB 3PHIA 3CKYA 4QOHA 3V7UA 3U56A 1EIZA 5BORA 3E5RA 4GOOD 3Q98A 1OX5A 5LDHA 2HO4A 1FQJA 3FYTA 5C2JB 1YRWA 4DV6B 4G56A 1C4OA 2Z1DA 4PTZA 2EJBA 4YRDA 4PYNA 3V8VA 5EXSA 3N07A 3B6EA 5MN4A 3DBIA 5ED0A 1AXRA 2HTFA 2YNMD 1U1FA 1CUBA 1SZJG 4Z1OA 4ZO7A 1VL1A 3H2IA 2HBZA 3BERA 3QY0A 1FSGA 4MW5A 4AYWA 3CRW1 4JY7A 4RZIA 3AHFA 1TF7A 4FILA 2JLWA 4F0JA 5ESDA 4M89A 1RO2A 2P3QA 3QPAA 2Z5LA 3QVXA 3GDFA 2WWXA 4JSYA 5ESXA 1AMNA 5CVJA 1QP7A 2RHJA 1LTKA 1TZMA 4TSKA 4KKVA 3VUFA 3WLEA 2VC2B 1XMQB 2FZ4A 1DVRA 1PSDA 2C1XA 4CKYA 5CDTA 5KVAA 2I71A 4IS3A 3HSYA 1EIAA 3TRKA 3M4YA 4RH1A 2VRCA 1ZD2P 3BZBA 4G0NA 4DUPA 5C8VA 1C7JA 3R1IA 4BFUA 3ER8A 2KGEA 4H6VA 4F2HA 4NBKA 4X8OA 1GRVA 4D6YA 1E1NA 4OUDB 1DIBA 1Z6XA 2COUA 2QJFA 5ALZA 2UZ3A 4QECA 3WWPA 3DWFA 1KZYC 4TTJA 3R5SA 3V42A 1YHZA 3LRTA 3WQSB 1E2MA 2LPKA 2CN1A 3O8OB 3JCZA 4FWTA 1JHXA 1Y8RA 5HF5A 1G3RA 4DEVA 5FUYA 3IHLA 3ZS8A 4INOA 2X0KA 1AHNA 4DNXA 1NXWA 1QTRA 1KJQA 1XYYA 4X84A 5L7WA 4AB1A 4TT8A 1PD1A 1TOAA 4XGRA 2X2PA 1YJWP 3MJ4A 4NMWA 3ZBUA 1KJWA 4X6UA 1Q83A 2P1RA 2VNJA 1RQ2A 3NIFB 4YJFB 3FN4A 9LDTA 3C14C 1FB5A 2OKGA 1DT5A 4F4UA 5IRCD 4Q3AA 1F8YA 2CXTA 2Y2UA 1XZQA 5BWNA 4KBGA 4LDZA 2QTGA 2WHPA 1L8LA 1QVVA 3L8FA 2VF7A 2CLCX 3ORHA 5D6OA 1MO5A 3BPSA 1DFIA 4G09A 2VYFA 3SFZA 821PA 2AD5A 1UBUS 1E5VA 2PRZA 4GP6A 4PYOA 5ALTA 2IYAA 3GD7A 1X1AA 3IXMA 1NXOA 4DKXA 1FFHA 1LA2A 2NWQA 4P9NA 2WILA 1YDMA 3PJFA 1GCUA 5GV7A 4XFXA 1ZKMA 4PZDA 1I2MA 2CY0A 3N6VA 4Z7NB 5IT9A 3AB3A 1IOZA 4FC7A 2POQX 4JQOA 4YP1A 5CW2A 1QF7A 1DV2A 1P2SA 2I34A 1C1DB 4QA9A 2BFBA 3ROTA 3SIXA 1YJBA 3GA0A 1KP2A 1NHGA 1YJXA 3QMWA 5AW1A 1LX6A 3O8BA 3BREA 3OFNA 4D43A 1G5IA 5C8ZA 1JX6A 2BM8A 1D6MA 3AEQB 2C82A 2FVEA 3GR6A 5HK8A 2F2TA 3UA3A 4N4AA 2OBXA 1VI5A 2AW5A 4IJ6A 4XIIA 5GTDA 2O0JA 2OFOA 1ZUIA 1YAJA 5I4KA 3GJZA 1QG2A 3RS7A 5AT1A 4EFDA 4WFKA 4EHLA 1YVUA 2RHHA 1LTQA 1F6DA 3MGBA 4S3MA 2KGAA 3JYQA 4PANA 4LJ9A 1TJ4A 1MGPA 4LE1A 5JPIA 2IFTA 1QLJA 3ZHRA 3VU0A 1NATA 4FW8A 4UTPA 3D9QX 1JJ7A 1GR1A 2Y1CA 3AVPA 3KPVA 3H4IA 1O4VA 2IZZA 1L5SA 2UUPA 3UENA 4XCVA 3DZ8A 4BX9A 5IW8A 2AQHA 1G8SA 2CMFA 2ZS8A 3AY6A 4MRMB 4UMFA 5J59A 2IU3A 1RRKA 3Q7QA 4WKGA 3KZOA 3QU7A 1W49A 1B41A 4N8SA 3QEOA 1GXHA 1C41A 1U8AA 4CEJA 2QU7A 3T5TA 5L51A 3K71B 4LSMA 3ENNA 1JH8A 1YNOA 1ESZA 3HM9A 5TEWA 2FW9A 1RTTA 3AEZA 4MULA 4BCCA 1Y8AA 3C3JA 4DS3A 3L8ZA 1Z28A 2JFYA 3ONWA 2Y0CA 4C3VA 5JHHB 4FHDA 4XYMA 3B53X 4HI0E 4DWVA 3PHHA 1YI2P 1RWWA 3GBVA 2HV9A 4LC1A 5KP7B 1JG1A 4UDYX 4GQIA 1M0EA 2D7JA 1SO8A 4OGFA 1C3OA 1KQOA 1OGJA 1DOAA 4GR4A 5GVSA 2QAGB 4D26A 1Z8HA 1VJ0A 1LD3A 2AHOA 2EJUA 2INGX 3AL2A 5U9CA 4ACAA 1UBCA 3ANLA 3ZCXA 2HK8A 3EISA 4Q7JB 2R1TB 2FUG1 3FFXA 1GAJA 4G1BA 4DOMA 2I4RA 3P71T 2OV2A 5JY6A 2FW7A 2AFIE 4IX1A 3HXKA 2KE5A 3JQ7B 3HB4X 3QF7A 1WD7A 5JAHA 2ZR8A 3KSBC 1BWQA 3CVWA 3NNNA 1CY4A 1NLYA 1UPTA 4LV6A 3S5JA 2CHEA 3ESQA 2ZUTA 3LTNC 3EMBA 3CF6R 1RE1A 3J80A 4S1NA 3OZWA 3HU2A 2HY7A 1BYUA 5HILA 2IF2A 4HBZA 4GMKA 1BCRA 1E2LA 1YJ5A 4JR0A 5DLDA 3KQNA 3COPA 3H4MA 2OHHA 3REFA 3CVUA 1Z0JA 2L22A 5CA0B 1ZWKA 4YIKA 4AY4A 4O1IA 3WWZA 3JARA 5KYXA 5J58A 3IAM1 4MIOA 1P91A 3OU2A 4QUBA 3MN1A 4KQXA 1NBAA 3NKFA 1Y37A 1KYVA 4BTLA 3DLBA 4EVIA 5E38A 4DM7A 5JRDS 2ADOA 4FN5A 3G5TA 1NVBA 1VKHA 1HPLA 2B3DA 2YX1A 3JSXA 3PIDA 1T4CA 3IUYA 4IILA 3UKDA 2Z5VA 4PQYA 3RV4A 5K3EA 5EUMA 1E0DA 4MUXA 1NULA 2QUAA 2ZIUB 3GEDA 2PM8A 5AJHA 1DTWA 3F9RA 1U11A 2OB2A 4RVCA 1N25A 2FSFA 2XUZA 4I1OA 5LM3A 2IXBA 1Q50A 3DFIA 4TLAA 4YH1A 1HG1A 4M1ZA 2KGCA 2ZYGA 3IYLW 4MWCA 5CNIA 1T13A 3COSA 2PEQA 5AM1A 1JXOA 2ZM6B 1X87A 1JXMA 3C3EA 4UUAA 2XB2A 2AS0A 3PDCA 2ZTUA 3NKLA 1KDTA 4IMJB 3G0CA 3T4XA 2EJWA 3MJCA 3UFXB 4DDKA 4F5EA 4YXFA 2GDWA 1PJSA 2FRXA 3KHUA 2OXEA 2XYGA 3F9CA 3NHAA 1AC5A 3IAUA 4RF5A 4D4GA 2D8MA 4IDPA 2QMZA 3L7BA 4BV9A 1LY1A 1BSVA 1OXUA 3H1GA 4XFJA 3QV1A 2XVMA 5ADHA 1SCNE 1KKMA 4Z2AA 3N5CA 1TKRA 5HX7A 2YW2A 4ND5A 4EMTA 2FH5B 3DWEX 1L3IA 3S4YA 3IXQA 2AN4A 4BQPA 1YB2A 5ECWA 4YCCA 3MWKA 2CKMA 2HBQA 3VH2A 4G0MA 3SBOA 1Q7YQ 5FLYA 1T36B 4IQ0A 2ZCJA 1D5WA 2A94A 5ALUA 3GJ4A 3V1LA 3SOPA 3HEAA 4RGQA 2PQ0A 1VE5A 3B3JA 3UCXA 3FROA 2I8LA 3C70A 6NULA 3IA2A 1K4KA 2MYUA 4QXMA 5FOTA 4PY2A 2WTEA 1N2IA 3KQQA 1Q21A 4DJDC 4MARA 1VGQA 1M6EX 3I42A 1K0UA 1ZFNA 4GOXA 4U0JA 4KREA 3QEMA 2V7GA 3V6LA 4X41A 5B53A 1O08A 4QXAA 3U26A 5HP4A 2I6TA 4I3GA 5HIKA 1ZI6A 5DXAA 1IB6A 3EQ8A 1NBOA 3NM4A 1DLIA 2C5BA 3SR3A 3X0DA 4CL3A 4YAGA 5BSHA 1JKMA 3BKWA 1V9SA 4K0KB 2ZG6A 1EI9A 4HBGA 3PHCA 2VHVA 4CFSA 4UHHA 3GARA 4KWTA 2BKEA 3ADKA 3DUWA 4QL3A 1J2EA 2Y1XA 1ZN2A 1UZAA 2COEA 2X86A 3A7DA 1JQ5A 3EVAA 4UTZA 3HA5A 5FBWB 4Z9FA 5EKSA 4IYJA 1J8FA 4RTMA 1IN7A 3KAPA 3B12A 5HKLA 3A4LA 3HP1A 2FB9A 5CHYA 2Z83A 4ZVRA 5ALHA 1ADFA 1NVDA 2XYVA 3AEKA 4TMFA 2RAPA 2DHRA 2Q7XA 3FKSD 3CLTD 1QV6A 4WMLA 1THZA 2QD1A 1KK3A 4YAFA 1K8QA 1A2QA 2GNPA 3BFKA 1W1WA 4MZXA 3R7WA 1Y48E 3URKA 4W1PA 3QW4B 2IXGA 3IMEA 4F93B 4NU6A 3U0BA 1NJIQ 2I62A 5CM9C 4JEUA 1RYNA 5AVRA 3O03A 3FTPA 1R9NA 2J3DA 1KZ7B 2QXYA 3PNQA 5C7LO 1WM1A 1ONOA 1TYZA 3FBGA 1YE8A 3IX7A 2PMFA 1QX4A 2K2QB 2F4NA 2VL7A 3E1GA 4HXGA 4NYIQ 4MTLA 4OATA 4U63A 4UJ5A 5K4HA 1XRNA 5BSRA 4CA3A 1Q86Q 4GBJA 4DJJA 2IJGX 2B8TA 3LMOA 4R41A 2LF4A 4ZU6X 5JJCA 3KETA 2OUIA 4DSAA 4DUGD 1CHDA 4JL8A 1SXJA 2XE8A 1W4CA 4W8GA 3GP5A 3MT8A 3ZXXA 1CXZA 5AW6A 1HWYA 3OHPA 4P7BA 4L5IA 2H0QA 4G9GA 3VDMA 3CWZA 1WMDA 1ZRMA 5FL3A 3WI7A 2ALJA 1ZDMA 4AMYA 1JI0A 1G20B 5C80A 3CW9A 2W2LD 3R0VA 3BL8A 1J6UA 3Q0EA 4KVZA 4OUDA 3EPKA 1G8HA 2O8CB 1LX7A 3GZNA 2PWBA 4I4TB 4ZMRA 2AFHB 4ARUA 2H1OA 4CEIB 1C9DB 2QLMA 5B58T 1ZHOA 2QMQA 4YNBA 5J2TA 3KWFA 3HM2A 2AWNA 1M6NA 2MVUA 3WK5A 3DE1X 1IK4A 3W5VA 5KHAA 2DGDA 2I2FA 5HF6A 5K51A 3IKTA 4Y9SA 1SA0B 3GB9A 2NPOA 5DX1A 1T24A 1J24A 2B9VA 2CMKA 3B1FA 3GMTA 3KS9A 4UEJA 4ENSA 3OE5A 5BWCA 2PBZA 1Z5GA 4EF4A 5I9BA 1G64A 3RBVA 3LUHA 2GBPA 1ZH8A 3TG2A 2DUUA 1Z33A 1KSFX 3DE6X 1NVKA 2W6IA 2DHDA 2WHQA 4MS4A 4C43A 2H5EA 4MK4A 4EAAA 3U16A 1XPRA 2DR2A 3IB3A 1V8BA 3LY5A 2BKVA 1H1LA 1PTKA 2NYAA 3FOBA 2BHNA 4W7HA 3VKGA 1CT9A 2LD4A 3I5MA 4B3RB 1Y5MA 4ZN6A 4KACA 3DV0B 1Q0SA 1Y5RA 3SXPA 3WMWA 5BR4A 1GPDG 4L76A 4L8FA 4M0MA 1Z2NX 4UU0A 2LKDA 4U0CA 4OQLA 3MWDB 4OHZA 4PTLA 2JAUA 2PD4A 4CMEC 1XAJA 2WTBA 1O6CA 2BN4A 2VSNA 3PPWA 5CLHA 1OSNA 1Y33E 3IP5A 4I9GA 5FJIA 1KZHA 1IXRC 5B2EA 2JAXA 4FDUA 1YH3A 1EWRA 3DR5A 5IDYA 3C1UA 2EATA 4L73A 1VLZA 3LNTA 4IRUB 1Y6ZA 2OO7A 1KJ8A 3SSMA 1WUJS 3FTFA 4NYMQ 2W6NA 3NPMA 3PP8A 4PPFA 1MJGM 1BXIA 1DAFA 1PNTA 2RSLA 3GEMA 1EH5A 4Y6GB 1J7JA 1QM5A 5T41A 3UT5B 5C8DA 4GYWA 2O14A 4F85A 2YZGA 4HLCA 4FSDA 3BE8A 3U60B 1UMCA 2CFOA 3AU8A 3DUFB 2FAEA 3AU9A 3L0IB 3R7SA 1HUQA 3V2IA 2AZ4A 1G9SA 3SPXA 4KRFA 1KYZA 4KXQA 1M0SA 1EINA 1G9XA 3T52A 4LMRA 3I5YA 5BT9A 1P3JA 3OTWA 2L69A 1YZLA 1FF9A 3FDZA 2IOYA 2ZSHA 3BA6A 5K8CA 3OOHA 5DK6A 4I9HA 2CNWD 3HBMA 3IEXA 2QBYB 5FOSA 4Q03A 1P4HA 2B25A 1IXSB 5DYWA 2QZ9A 4HLQB 3JQCA 2RH4A 4KR7A 1ODLA 3HADA 1QHIA 2G4CA 2OHXA 3LECA 1DJQA 2Q3JA 3ASUA 4H35A 1XJCA 4HG2A 1AQUA 1EVEA 4OXQA 4Y2QA 4YDSA 1YR1A 1QP4A 2VN8A 3PEVA 1INLA 1ST2A 1A1VA 3QNMA 1Z0AA 1HDOA 3C98A 2B4QA 1TQ6A 3LHDA 4F5DA 1WVGA 3P4YA 1I7NA 4GICA 3WJ2A 4DCPA 4DRXB 3O2SB 4JBGA 2W7TA 4E09A 1KI7A 1YVEI 1FLNA 3AUAA 4IV5A 1YZ3A 3WMEA 4DXAA 2VF5X 3HCAA 1YS4A 1CHNA 5AIBA 4F3YA 1QBGA 3DAHA 4ZJYA 4RKQA 3B1XA 2DFTA 2W00A 3FUCA 4ZKEA 1N9GB 3FZEA 3A1WA 3EG9A 5CLIA 5TX7A 2R7LA 5HKAA 4O02B 5CHEA 4ZO8A 2CQ8A 3L05A 4E5NA 4MUMA 4CKWB 1XTPA 4RM3A 2V6IA 1PEDA 1X9HA 2WSIA 5DEOA 1K5GA 3RUHA 3JD3A 4Z49A 2H31A 4BEWA 5J4KA 3TR0A 4ZVOA 5F5XA 3KALA 1PGOA 2WC1A 1H6BA 1Z4IA 3GRVA 1P81A 4H59A 4JLNA 1U3DA 2VTVA 1SXIA 3EF1A 3U09A 4HDKA 1M2OB 4MVJA 1DU4A 3DP9A 3TZHA 3WLPA 2FETA 1T4BA 3HDVA 4R9UC 5EWLA 3S2FA 2II6A 2XUIA 3I9V1 1GUYA 5LMCA 2IY9A 1EJ0A 1SBQA 1X7GA 2IYLD 1P60A 4Y3UA 4QQRA 2NAFA 4UNNA 4Y9TA 3R0QA 4M76B 5CA0A 2DNWA 1ZISA 3S68A 5B4UA 4JL6A 4ESHA 4EGSA 5A5DA 3ZDDA 5TMEA 3JYLA 3ELYA 2YTZA 3B70A 1XQWA 1LF0A 1DCFA 2V8BA 4NFLA 3WAKA 1CJMA 3A1VA 3D7SA 1J39A 1J49A 5A4AA 3RS8A 3NBYC 3EWIA 1E9FA 1KE2A 4QPDA 1P17A 3GRCA 2C2GA 4NG5A 1N9KA 4HWOA 4XVRA 4WZBA 1LC3A 1PR6A 4BMPB 1G8AA 2XE4A 3IUQA 4OH7A 1XF1A 2OG1A 2W6JA 1NHWA 2E89A 3W5UA 2OV8A 4RORA 1SVKA 2AFEA 4MW0A 3C7CB 4JMLA 4EB6B 3UICA 4RD2A 1TQ2A 1FXSA 2WEKA 5NULA 2I78A 3NYRA 4BGUA 1TEHA 3PSHA 4MVJG 1GCIA 2C9MA 3RVNA 4F56A 3T7DA 1J07A 5KKCA 4KV9A 4U0FA 4X92A 2M8LA 4QQFA 4JI6B 1JW9B 3Q3VA 4AJEA 5GONB 2ZSAA 2PLAA 1R8YA 3NTQA 3N7AA 3QWIA 4D45A 3T5MA 2JIOA 1DADA 1C1XB 3FR8A 3QPUA 4GMFA 1Q19A 1EFPB 4H3HB 3WL3A 2IV3A 4AG5A 1XMVA 1MABA 4N6OA 1NPYA 4QOSA 5B37A 3TLCA 1JHYA 1L7EA 1TECE 3PYLA 4C4AA 4WWHA 5JIBA 2Z2KA 4CKCB 2KWLA 2GEVA 2IIVA 1E2PA 3I2FA 2RD2A 3CX8A 3UW1A 3BDAA 2JGJA 2PGAA 3PUKA 3CSSA 3PEFA 1SKMA 5I01A 3JWHA 1H4VB 4YJDA 4F5ZA 1OHHD 2RKOA 3LI2A 1WAMA 3OMLA 5CG1A 5IKMA 4ABTA 3EQZA 2H8KA 3OO1A 4KKXB 4LSZA 1I3OA 1YB4A 2JIBA 4U2KA 5EAIA 4EEZA 3E9ZA 4EHKA 4PSCA 3DL2A 4OFXA 1X19A 4OB8A 1VG9B 1IB0A 4OQFA 1CWUA 4Z8YA 1KMMA 1X13A 1RKVA 2CLMB 2XB4A 1G2PA 4IIBA 3T7JA 2SCUB 2AOXA 1AO0A 5DHAA 4E5MA 2OG2A 2JIDA 2H29A 1SXQA 1FNBA 2KW5A 1W75A 3LTEA 1EQ2A 2ZT6A 3NHMA 3W3AA 4QICA 5I4CA 3WK6A 4MA5A 1OTXA 1O94D 1F8GA 1U9ZA 2GK3A 1XKXA 2ESRA 3OMWA 5EJ7A 3RR2A 2PA0A 1HG0A 3NORA 1RZRD 4UBMA 4QKOA 3AILA 3H9BA 4ZV9A 3O8RA 3LQFA 4GF5A 2OSBA 4HH4A 1GCAA 2H9YA 4RF4A 1T8YA 2GZSA 1EK1A 5IJ9A 1IONA 3IUMA 3AUJB 5CBPB 4C0WA 2XWJI 5IWCA 3W2IA 4PS1A 5ADVA 1NG9A 5DE3A 4Z1MD 5B6IA 2HPVA 3AXTA 4GI7A 5FYQA 4EKGA 1LQ2A 2POCA 5L3VA 3MUFA 3R0ZA 2F8TA 3FDFA 1ZXXA 3TTSA 5HKOA 4BYGA 2VLPA 3KOOA 3G0DA 5DFAA 2HLNA 1E3IA 4AIRA 2V0GA 4KSYA 2GKOA 2QYSA 4RACA 4PBSA 4GGPA 5LQRA 2V97A 1A4IA 4IXNA 5HVCA 2QVXX 2D7CA 2TYSB 3SNHA 3E6AA 5SV2A 1Q3KA 4Y8VA 3A9UA 3VVLA 2XNHA 3ZDAA 1QHSA 2K2QA 1FYWA 4KQGA 4M87A 5EQDA 3W8FA 1WB4A 3C16C 1RQXA 1PUJA 4V02A 1YE5A 2ADFA 3FPKA 3P9RA 3R9IA 5JYEA 5KOHB 3UJNA 4PG7A 2AK2A 5CNMA 4B8WA 4H2YC 1P3DA 5FA8A 4GRIA 5G4KB 4B4OA 4DDTA 2I2WA 3H19A 1ORVA 4B3BA 5BN4B 3IIIA 4XLZA 3ND6A 2HDNB 1EFDN 3AJDA 4QYXA 4LV5B 4UTRA 1SHJA 5AM3A 2FOIA 4BNNA 5LVAA 3NVMB 4M36A 3SYTA 3WRXC 5I7OA 1GAXA 1RJEA 3NBFA 4JJ4A 3QH4A 4P4NA 4JB3A 4N40A 4RH0A 4RF2A 5TSDA 4OJTA 1A9YA 2VDMB 2WIJA 4NJEB 3ZTYA 3JPYA 4I4TA 2AFHA 3AM4A 4OM7A 1EBBA 1NR1A 1YKGA 2H4YA 4EG8A 4F4JA 4CEIA 5JH7B 4J0DA 3C3DA 4TLMB 4IUCS 3VR2A 1C5KA 3UUFA 4TGLA 4DJFC 3OJOA 1CY2A 4MR7A 5LSAA 3CPSA 1SA0A 1Z4MA 4QVGA 3L7IA 4ZRMA 2YQ4A 4ZXPA 4P4SB 5JAOA 2PH7A 2KG6A 1A82A 2N6ZA 1RWQA 3MTGA 3Q7EA 4I2VA 4YR9A 5JSFA 1SBIA 2ZAOA 2BZ0A 1WY5A 2EFHB 1KZ4A 2REXB 2V03A 4PR3A 3JQQA 5ICEA 5F9HA 2ZWVA 2GCIA 1HYBA 3A4MA 4HH3C 4UPVA 5B1DA 3ZIUA 3TGWA 2UZ4A 4TTIA 1WZEA 2QX4A 3O8NA 1I7SB 1DSSG 2JRCA 1QG6A 1O6BA 2KX7A 2PU5A 2HA0A 2Q3HA 4OHCA 2Q1TA 1RI5A 3LRPA 4TV9F 5LU9A 2ONTA 2XB8A 5BS1A 4EJ0A 3DVRX 4ZVPA 1JAHA 4M1OA 1HA3A 2RONA 3G6KA 2PE5A 4P3OA 2FACA 5FADA 1VKJA 1QGOA 2YJ5A 3EAGA 3F5MA 4PYLA 2FWNA 3WYNA 3C6ZA 4OHYA 1NMYA 3GCDA 4BV2A 5KNLA 5ITWA 3MWDA 3NFYA 1Z3CA 5FQNA 4CQNA 3FMVA 2XVYA 4M1MA 1UZMA 4QOJA 1ND5A 2J30A 5T8KA 4R8VA 3PC3A 3LLCA 3S7TA 2Z46A 3PC6A 4DGQA 4IQ4A 4RETA 2ZYHA 5E0KB 3CEJA 4TLEA 3S6JA 1T5OA 4GLLA 1VSBA 2P4UA 4HGYA 4BUJA 3DOUA 4HPXB 3NM6B 3NYIA 1IVSA 1CD5A 4XGNA 1XRLA 4LNUB 1CDOA 4FS8A 4KQEA 5I9LA 1K97A 3V8QA 5A0FA 3U5ZB 2XTAA 2L4BA 2FPMA 4MCHA 3U17A 2H2AA 2JBAB 5TGTA 1FSFA 1XDDA 2G3YA 3AJ8A 3NVAA 4OQQA 3H04A 2EL9A 2FQXA 4LSGA 3T7SA 4BEVA 5J1SB 4AY2A 5FKJA 1U0FA 5CAEA 3GVIA 2AT1A 1LJUA 1NXQA 4HFNA 2YOGA 1JFVA 1Q15A 2TMDA 4AUKA 1M66A 4UTNA 2E4XA 1X94A 4PAOA 1MJ5A 4PF1A 4CCYB 4RY9A 7ADHA 1RVV1 3BXEA 1QGUB 2FE4A 5JPAA 1EFVA 3WOVA 2HZBA 4KZKA 2HK7A 3TSYA 1UBOS 2PSDA 3FNFA 4M0KA 3FD8A 3WNDA 1RXVA 3WTCA 3PR1A 4JT9A 1E1QA 2ZI3A 3CA8A 3K70D 4O08A 3RGWS 2B7BA 4RCYA 1ODTC 1WMEA 3PNBA 3FETA 4DM3A 1CUAA 4TT3D 3SJUA 1UFRA 3GDHA 1GRCA 3NUZA 1KTVA 3VO2A 5KNDD 3C3BA 3ZZ1A 4MR8B 3KUCA 1V7CA 2NVOA 2FW1A 3U39A 2Z98A 4B9EA 4EFMA 2A4MA 4MHOA 4F4IA 1IBCA 4RZXA 2F7SA 3D5TA 3WGMA 4Q4LA 1T6BY 4RZQA 2PYIA 3BWCA 3C4JA 4JXXA 2UUCB 4DRXA 3GFTA 4B45A 2WAAA 2X7XA 1UKYA 4CKBB 5FFFA 4B6PA 3KUXA 4DLUA 1VB5A 2FF7A 4YRNA 1R9GA 4FGWA 4YRZA 1BWRA 2UYQA 2YWRA 4UBLA 1IU9A 1I6MA 2JVIA 4IDFA 2Q8PA 2W58A 3KJXA 3KZMA 3QYAA 4MH0R 1NKSA 1M34A 4P54A 5BSWA 2FPIA 5JANA 1JLLA 5I9IA 3O31A 9ATCA 3TLJA 3GRUA 1E3WA 1NX6A 1XP8A 2E0IA 4O6VA 4RL6A 4CKWA 3H8VA 5HKKA 2WPDD 1PL7A 1CY1A 2QNRA 2JIMA 3O75A 2WU0A 2XE6A 4B74A 5KWVA 1X1SA 4JEHA 4S05A 4QVKA 4KQ2A 1RIIA 1Y82A 4X61A 3RC7A 3QFCA 3AKZA 1KHTA 2PXXA 1ULAA 3W9YA 2NXNA 1VLVA 4MEJA 4E6PA 2O4UX 4TPKA 2LE0A 1JG3A 5KNCD 1IZ8A 4DJEC 1WA5A 4Q15A 4D56A 3B9BA 3E23A 1XZJA 3CCJP 2DHEA 2VQ3A 4XUCA 2BH2A 2H92A 3AV0B 4K9DA 4C7OB 3D0QA 1ZYUA 1YQDA 3LHSA 1ATIA 3U9SA 1FE8A 3PFHA 2Q5IA 5DLQC 4RULA 5IK2D 2GDZA 2C4WA 4GQBA 1SCAA 4I1IA 4RJJA 4E11A 3MB8A 1F8FA 4JYCA 4NTZA 3M1AA 3J81k 2D5BA 4LBWA 1C2TA 3TNDA 2DOKA 4YCBA 2P77A 4AYTA 4CTMA 2AC4A 2JD2A 1T5TA 3LK7A 3CIOA 5F9MA 5THKA 4QFDA 4C5CA 1MHTA 1TA9A 1G3MA 4P5EA 3A06A 1UJBA 2VNKA 1TZBA 2WG1A 3IKVA 4MW9A 5AHOA 3TL3A 5GIOE 2FUG6 5I5GA 2WMNB 1Y9AA 1JA1A 2WB4A 3E9NA 4CMJA 1E7SA 4FFBA 2IGTA 4FHEA 4GKKB 1USVA 1WG8A 1T2DA 3V2HA 3THXA 3MJHA 2RGYA 2HZ7A 2I4MA 5T5QA 2RGRA 1KYTA 1XA0A 1EM8B 3ZNPA 4EB6A 2V4MA 4CT4B 3CVVA 1AY0A 4TTVA 3TOCA 1KETA 2F1KA 3G9XA 4WNIA 2RCNA 3SHVA 1W88B 3QBTA 2BGGA 1JV2B 2E9SA 1AA6A 1ONSA 3O73A 1TX4B 2EKDA 3FFTA 1N5KA 2B37A 4YRQA 1FXUA 2IIPA 1TXGA 2CK3A 4ARZB 3BFPA 3SSNA 5FL7A 5KYWB 4L1KA 4NU8X 3OOWA 4M22A 3U13A 3IAM6 5AXAA 2WJIA 1WE2A 4MB0A 1KA9H 1BIFA 3PFKA 2Z8YA 1SBTA 5F4BA 2IYUA 2O8BB 1J33A 1C1XA 1WHTB 3EW7A 4ESVA 1EFPA 1NC3A 1C8LA 1RLIA 1U7TA 2ZPTX 1R5NA 2EBWA 2O8BA 4BTEA 2YNMA 3B7PA 3AYXB 2GBFA 4IAOA 4MS1B 4CKCA 3KLNA 3CR8A 4MS3B 4N0QA 1PNOA 3BK1A