2EFJA

The structure of 1,7 dimethylxanthine methyltransferase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
377
structure length
348
Chain Sequence
LQEVLHMNGTSYAKNSSYNLFLIRVKPVLEQCIQELLRANLPNINKCFKVGDLGCASGPNTFSTVRDIVQSIDKVPTIQIFLNDLFQNDFNSVFKLLPSFYRNLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLHWLSQVPSGISVNKGCIYSSKASRPPIQKAYLDQFTKDFTTFLRIHSEELISRGRMLLTFICKEDEFDHPNSMDLLEMSINDLVIEGHLEEEKLDSFNVPIYAPSTEEVKRIVEEEGSFEILYLETFNAPYDAGFSISPVSCDEHARAAHVASVVRSIYEPILASHFGEAILPDLSHRIAKNAAKVLRSGKGFYDSVIISLAKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3,7-dimethylxanthine methyltransferase
publication title The structure of two N-methyltransferases from the caffeine biosynthetic pathway
pubmed doi rcsb
source organism Coffea canephora
total genus 129
structure length 348
sequence length 377
ec nomenclature ec 2.1.1.160: Caffeine synthase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.270 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2efjA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2efjA02
1RJGA 3ELUA 4HSGA 4DF3A 1VE3A 2Y1XA 2B3TA 5K0CA 2IGTA 3P2KA 3OE4A 2PXCA 3EVCA 2EG5A 5D1NA 4C03A 5KQRA 3ERCA 2ZBQA 3EVAA 3OZRA 1EAMA 3B7PA 5DSTA 2JG3A 2ZVJA 5CCBA 4RV9A 1JQ3A 1WXWA 3LBFA 2AS0A 1XDUA 5FHQA 2H1RA 1DUSA 3CBGA 4KDRA 5F2OA 1NV8A 1RI4A 2GB4A 3FUTA 3O7WA 4GUAA 2YX1A 3KQWA 4RTOA 1WG8A 4PYQA 4DA4A 1ZGAA 3AY0A 1KP9A 3Q7EA 1HNNA 4GEKA 2AVDA 4E31A 5K05A 4EK9A 3KR0A 3UA4A 3E7PA 2XVMA 3REOA 1ORIA 2ZWVA 5GIOE 1XJ5A 3CVOA 3TRKA 1Y8CA 3EGEA 4PCAA 1OR8A 2O57A 1FJXA 1N2XA 2WA2A 3DP7A 1JSXA 3TFWA 2Q41A 3G8BA 3HVKA 3TKYA 1FPQA 2PV0A 4ER3A 5K0EA 2QYOA 5DXAA 3R3HA 1I4WA 2BM9A 5DX8A 2IBSA 2B2CA 4RTMA 2BR4A 2AOXA 3OPNA 3PFHA 4LWOA 5CVUA 5K0LA 4XUDA 1KYWA 3T7TA 1I1NA 4C06A 3EVDA 4EKIA 5DTMA 5EVJA 9MHTA 3HCAA 3BWCA 3MB5A 3SX0A 3A4TA 3GGDA 2NP6A 3E23A 4OBXA 3A7DA 1G6Q1 1IY9A 5FQNA 2N47A 4IKPA 3UJ6A 1D2CA 2IDJA 5FA5A 4C05A 4E33A 2AOTB 3KPWA 3GJYA 3VSEA 3LECA 4ISCA 1BKYA 2ZFUA 4C4AA 2P41A 2ZLBA 3GO4A 5EIFA 5LQJA 4HTFA 1WY7A 3M4XA 2AOVA 3C0KA 5DTQA 4B17A 2GH1A 5HIJA 2NP7A 5KVAA 3B3FA 1SQGA 4YV2A 4RVHA 3EVBA 2C7OA 4JXJA 2Z6QA 1R8YA 3OCJA 4PIPA 3FUUA 1KPIA 5DPMA 5DWQA 1IXKA 4GOMD 1UWVA 1RI5A 2GAFA 3FPGA 2IP2A 3NTVA 3HP7A 4LECA 4K6MA 3EPPA 4EQZA 2JH9A 3FUVA 4RTJA 4PONA 2GPYA 3P8ZA 4PYMA 5B1SA 1M6EX 2P35A 3UA3A 3ME5A 5BP7A 5K8VA 5LQAA 2XYVA 1R8XA 2E5WA 3FUXA 3EVZA 2AVNA 3TKAA 1AV6A 5K0GA 5HOQA 1P91A 4XUEA 5E8JA 3EEOA 3NDIA 3KPVA 3UJCA 2GA9A 3KKZA 2PX8A 5CD1A 2PVCA 2QY6A 5FWAA 4PIMA 2I62A 1JTFA 2PJDA 2ZWAA 4F85A 4RTSA 4ATNA 1KYZA 3HCCA 4X61A 3NVMB 4YUZA 2UYHA 2OB1A 2V7EA 1RI2A 2B25A 1SG9A 2B9EA 1RJFA 4IWNA 4P58A 3EMDA 5EC8A 1AF7A 5ICEA 4PNEA 3FRHA 3R0QA 1I9GA 3NWBA 5F2NA 1QANA 1YZHA 5EGSA 3FRIA 3EGIA 1YFJA 4HG2A 5EPEA 1G8AA 3OFJA 2AOWA 4P7JA 4RYLA 2G1PA 2LD4A 3R9XB 4V0RA 3KPJA 3LL7A 3GU3A 1U2ZA 2AOUA 2AR0A 4R6WA 5EIWA 1QYRA 2FK8A 2XVAA 5GM2A 2PX4A 3M33A 4IV0A 4C04A 3G88A 4YUVA 5ICGA 4RTNA 3OE5A 5E2AA 2P7IA 5C1IA 3TMAA 10MHA 1BHJA 2BR5A 5LQRA 1V39A 4LWPA 2UZ4A 2HR1A 3DMGA 2PLWA 4CTJA 1H1DA 2YR0A 5FQOA 4BLWA 3THRA 3ELWA 4QPPA 4DKJA 2CL5A 2F8LA 1NBHA 1P1CA 5HZMA 2IH4A 5EMLA 2VDVE 3BGVA 4LG1A 3X0DA 2HMYB 5HEKA 1P1BA 2R6ZA 1TW3A 5CUQA 2IBTA 4OQEA 3V8VA 2BZGA 1RI1A 2CMHA 2OO3A 3DXYA 4OBWA 1JG3A 1G8SA 4IV8A 5DT2A 3DH0A 1L3BA 2C7QA 1NE2A 1DL5A 4R05A 5HIIA 5IH3A 1L1EA 1G55A 4KWCA 5H02A 3GIWA 1JQEA 3QOWA 3PVCA 4H0NA 4RX1A 3TM5A 3FPFA 4HTFB 2HV9A 4CTKA 4CWAA 4RTQA 3MHTA 1YZ3A 1XVAA 1QAMA 1L9KA 5GP1A 3AWIA 2EJTA 5GWXA 4FT2A 3GRUA 2OYRA 2ZIFA 4DCGA 5D1HA 1NW3A 1Z3CA 2JH8A 3KQVA 3EGVA 5EOVA 3ELDA 3UFBA 3KR2A 3FTDA 3KQPA 4AZTA 4E2WA 2ZW9A 1L3CA 3PS9A 3BWMA 4YMGA 4BP1A 4GC5A 3BGIA 2P8JA 2PT6A 1XDZA 3LDFA 2B78A 3I53A 1EJ0A 1O9GA 1VP9A 3G7UA 3NDJA 2ZBPA 5P8WA 4CKEA 5FCDA 4POOA 5DRTA 3SVZA 3NVKI 4M7RA 2PXXA 1YF3A 4KVZA 2BH2A 5IKMA 4FSDA 5ICCA 5CM2Z 2UYCA 2CMGA 4FR0A 3SXJA 4M36A 1XDSA 4MIKA 3NW9A 4GC9A 4HC4A 4CXMA 8MHTA 4L7VA 1EG2A 3E05A 2P40A 3PX2A 3UJ7A 5K0NA 2PT9A 5M5BA 1YFLA 3DMFA 5FUBA 4DCMA 2G70A 3P97A 3IV6A 4FT4A 2FPOA 3G2OA 3NWEA 4KW7A 4MHTA 3G2PA 4M38A 2EX4A 2VDWA 4PYKA 3PT9A 4RTLA 1JG2A 2IH5A 5KQSA 4BY9E 3CJTA 2ONYA 3LCUA 2FYTA 2UYQA 2AOUB 1KXZA 1X1AA 3C3PA 4G56A 3RW9A 3HCDA 2I6GA 3BUSA 3TQSA 2ZZMA 3LCVB 3LPMA 3UWPA 3K0BA 4YMHA 2ZZKA 3IEIA 4ZTBA 1SUSA 5E1MA 2IIPA 3P9IA 3P9KA 4ER0A 4YV1A 2YXEA 5DM0A 2UYOA 3FZGA 3G5TA 7MHTA 4PYIA 3TOSA 1ZG3A 3QV2A 3THSA 2ONZA 2IFTA 2OY0A 5K0BA 5E8RA 3EVEA 2JJQA 3MTEA 5DM4A 3ER8A 3DOUA 1O9HA 2YTZA 3TPZA 2HNKA 4YUWA 1QZZA 5DLYA 4ER5A 2VS1A 1MHTA 3M6XA 1X1CA 3LBYA 3CGGA 5K01A 1NBIA 3DMHA 2NYUA 3P2IA 5E1DA 3ELYA 2ERCA 2V74B 2O05A 3M6UA 5LQCA 2ZIEA 3VC1A 4FS8A 3AJDA 5FWDA 4EVIA 1KPGA 1KHHA 4RTKA 3HVHA 1VPTA 1AQIA 3EVGA 4RSRA 4C07A 4YUYA 4KRGA 5HIKA 4R8RA 5HIMA 1KPHA 2H11A 3OU2A 3AXTA 3LDGA 3P9NA 5EHIA 5GOZA 3SSMA 1M0EA 1FP2A 2P3LA 5ERGB 2O06A 4FZVA 4V0QA 4DQ0A 3HCFA 3P9CA 3SM3A 4XUCA 5CIYA 4R6XA 5EZSA 5EEHA 2NXCA 3FTCA 3NJRA 3RODA 3HTXA 5DM1A 2NXNA 5FADA 1IM8A 3FPHA 2HTEA 4OA5A 1VP3A 3P71T 4F84A 3HVIA 5EQJB 2P3OA 3OZSA 4HH4A 4E30A 2G72A 4OX9Y 3B5IA 5JUWA 4QDKA 4P7GA 5E9JA 5EEGA 1P39A 1PRYA 3HCBA 3TR6A 1KIAA 3OU7A 5EZQA 5C9ZA 3FYDA 3F4KA 1O54A 3T7RA 4RTPA 3CCFA 3KPUA 2P3QA 3JWGA 3D2LA 3KHKA 2I7CA 3KQMA 3KQTA 3GDHA 1R74A 3LHDA 3R6TA 3JWIA 3GRZA 3HA5A 3UJ8A 3HA3A 3NMUF 4AUKA 2XYRA 1NW6A 4P7KA 4OQDA 2OBFA 1G60A 2PX5A 3B89A 4E2ZA 4E70A 3KQYA 2Y1WA 3BKWA 4GOOD 1Q0SA 1WS6A 5K03A 1JG4A 5E9QA 3LSTA 1BOOA 2NXEA 3BXOA 3UZUA 2AN4A 1Q0TA 1NW8A 3GNLA 3SR4A 2DULA 3G8AA 1X1BA 3IYLW 4GOLD 5F2KA 2JHAA 2O07A 4FP9A 2EJUA 5E9WA 3FYCA 3TLJA 5BW4A 4FGZA 1L3IA 4AZVA 3HCEA 4ER6A 2YXLA 2JHPA 3SSNA 2C7PA 1RI3A 4KDCA 2PWYA 4HGZA 2G71A 2BR3A 3BT7A 4FSXA 2H00A 2QE6A 3JWHA 3FPJA 3C6KA 4PCLA 5C0OE 5KS2A 2P7HA 2QRVA 3HM2A 4BLUA 2ZZNA 3QOXA 2YUIA 4U7TB 1F3LA 1TPYA 3ID6C 1R00A 4Y30A 4DZRA 4RVDA 1RJEA 3MERA 3MCTA 3PFGA 5K09A 1EJ6A 3H2BA 3SSOA 1R18A 4A6DA 4RVGA 3DLIA 5DX1A 2C7RA 3DTNA 4MTLA 3BGDA 1NW5A 3DUWA 4MWZA 1NT2A 2ADMA 5HFJA 4X63A 5E1OA 2CKDA 4HGYA 3DR5A 3KQQA 4Y2HA 1R6AA 5HILA 1XXLA 3GCZA 5LQUA 3LX6A 5EKUA 1SKMA 3UJAA 1MJFA 1X1DA 5DTRA 4XCXA 2VZ9A 2OZVA 3HNRA 5CVEA 4CKCA 4RTRA 5GM1A 5T64A 1INLA 1EIZA 2NXJA 2FK7A 1UIRA 3EVFA 4P7FA 3GXOA 4R8SA 1N7IA 1YUBA 1JQDA 3ANXA 2Z6AA 2ZCJA 2YQZA 1ORHA 5EHGA 4MQ4A 3CKKA 4KIGA 4PYLA 3KQSA 3M6WA 4QVGA 2AN3A 1KR5A 3GRYA 2IPXA 3IHTA 1JSZA 5DSXA 3T7SA 2FCAA 3CJQA 3V97A 5BXYA 5GIPE 2VP3A 5DM2A 3KU1A 3MTIA 3C6MA 4E2XA 2KW5A 1DCTA 2YVLA 2HWKA 1WXXA 3DXXA 2ZULA 3SMQA 5K0FA 3KR1A 5T6BA 3ER9A 4DMGA 3UBTA 4AX8A 1VL5A 2K4MA 2O0LA 1BC5A 4X60A 4DM3A 4OA8A 4CKBA 3BWBA 3MAGA 3I9FA 4GOND 3O4FA 2BM8A 5E2BA 4UOEA 5BW5A 1G38A 4RVFA 2PBFA 1YB2A 1X19A 2ZTHA 3CJRA 3I5UA 4PGHA 1D2HA 3WSTA 3PTAA 3ORHA 1VQ1A 3VYWA 2OB2A 3AXSA 2XYQA 2ESRA 1SVUA 4BLVA 5JR3A 4QDJA 5EG5A 3GRVA 4QQKA 4M37A 2EFJA 4BP3A 1ZGJA 4GBED 4ER7A 1WZNA 5ICFA 4O29A 1B42A 4YV0A 2JHCA 3FUWA 3UJ9A 1JG1A 3UJDA 5LR6A 1TW2A 2A14A 3A7EA 2PY6A 3HVJA 4AZWA 2NNWB 4QTUB 1JTEA 3M6VA 4X1OA 2Z6UA 2FHPA 2PKWA 2ZSUA 2IDKA 3HA7A 5FTWA 2G8NA 3TM4A 4EMSA 3KPYA 3MQ2A 5EMJA 2YXDA 3PLAE 2I9KA 2IH2A 2XBMA 3LGAA 1HMYA 3G89A 3OFKA 3G2MA 4U7PB 4PYJA 1SUIA 1NKVA 2OKCA 5CCXA 5MHTA 5EMMA 5FHRA 4C08A 2QRVB 2WK1A 1VLMA 3R24A 5K0JA 4QTTB 2ZIGA 3MCZA 3U81A 4A6EA 5DRYA 3KQOA 3P2EA 1NW7A 3BZBA 5CVDA 4QPNA 4HRAA 1F38A 3A26A 1UFKA 2PWPA 3B3JA 3BWYA 1QAQA 3L8DA 3LKDA 5CVJA 3B3GA 3DLCA 3RIEA 3Q87B 3UJBA 4E32A 3M70A 3EMBA 4KIFA 4X41A 1VIDA 1FP1D 1ZKDA 2WA1A 4QVKA 3VC2A 3LCCA 5E1BA 3GWZA 2CWWA 4AZSA 5G02A 2R3SA 3LDUA 1XCLA 1N7JA 4RWZA 4Z2YA 5GINE 3C3YA 2AOTA 1XTPA 2ZBRA 3EEYA 3I64A 2PXAA 4WXHA 2QM3A 1T43A 1JR4A 3E8SA 3SGLA 4EKGA 2GLUA 4NECA 2PGXA 3HEMA 1ZHFA 2PX2A 3O31A 3PX3A 3PB3A 2OXTA 5LQNA 3K6RA 3FPEA 3CC8A 3A25A 4PYNA 3G2QA 4PGGA 1EQAA 3JWJA 5DXJA 4PWYA 4WVLA 5T67A 3S68A 1SQFA 5FULA 5U4XA 2PSSA 3GRRA 4GF5A 3DULA 4PINA 5DX0A 4F86A 3BKXA 3I58A 3LKZA 1PJZA 1QAOA 3G5LA 5EKXA 5LSAA 1NV9A 5LQKA 3A27A 1D2GA 1M6YA 4GQBA 2AN5A 3MGGA 4PYOA 3DXZA 2DPMA 2OPBA 3OU6A 2VDUE 3FTFA 5KYGA 3KR9A 3FTEA 5FA8A 3OZTA 4E2YA 1XCJA 1AQJA 1ZQ9A 2AZTA 2GS9A 1FBNA 5CVVA 1RJDA 5EMKA 1VBFA 4YUXA 3T0IA 2P1DA 4QQNA 2FRXA 2ORED
chains in the Genus database with same CATH superfamily
2JI7A 4M6WA 1EVLA 1NE7A 3AKZA 4DF3A 1VE3A 2DFDA 3F71A 2C2HA 4V0LA 4YK7A 1H69A 2AFHA 2YHUA 2YWRA 4FFMA 3TQQA 4QHSA 4B6OA 4C03A 3ERCA 1VLZA 3LIIA 3E15A 2IX3A 1QH1A 5G4LA 1UPFA 4RV9A 3VR5A 5JXJA 4WNAB 1H4SA 4D8WA 2VTKA 3MT9A 2ZTVA 4TQUS 1VDZA 2K5UA 4ZCQA 1D09A 1T9GS 4YI5A 1IHXA 2QQEA 3O7WA 4RZQA 1UEJA 5JTUA 5A0FA 3H9EO 2OCPA 2PCJA 1HNXB 3IOYA 1J1IA 2O1XA 4P32A 4PZ9A 4MB2A 2QKYA 5FBRB 3GGSA 3SZLA 4BMCA 3E7PA 4EHLA 4UPEA 2ZSHA 3COSA 3KYBA 1A71A 3CVOA 3I0ZA 5E4TA 5GV8A 5SY4A 4BLSA 4Z7NB 1QQBA 2B1JA 2XV6A 2ZRFA 3AJ9A 2BLNA 4UMDA 3ZHCA 4C87A 2UVPA 4IG9A 3KJEA 4M1QA 4HNUA 4R2IA 4B7CA 3C70A 4P4NA 3E4CA 4F2HA 5JYEA 3ODPA 1Y3FE 2EDAA 4DAEA 2BCGY 1FFBA 2PUGA 4IJ5A 5HGMA 1H65A 3O74A 1RC0A 4DCUA 5AM3A 2J6IA 3FDZB 3MGCA 5CG1A 3FFTA 3UN1A 3ZHQA 3TG2A 1FLNA 3HCAA 2BLLA 2ZB4A 2ZS8A 4JP8A 5HJ2A 5SY6A 4AUEA 4OI0A 1X77A 3PXCX 1NATA 2ZYTX 1P75A 1GCOA 2RH5A 1GXSA 2WC1A 3OCXA 5LUAA 1Q77A 1C29B 2QPOA 3DBLB 1N6IA 3PPYA 4ZVUA 3NVAA 5HRAA 4AYTA 3NC1C 2A4KA 5A3SA 1GGMA 2AFDA 1DS6A 1RAAA 4XB2A 1NASA 3N6XA 1UFOA 1JVNA 3TZBA 4Q3CA 4BU1A 2HI0A 4IQGA 4DMLA 5JANA 2XE4A 1MH9A 5CT6A 2H1OA 2H5EA 2OHJA 2PYIA 4IPTA 3GQBB 2NTVA 3ZWQA 3LKVA 4IVNA 4UUNA 1SQGA 1X7ZA 1Z35A 3MC1A 1ODLA 3TTSA 4RSGA 2ZI7A 3T6KA 4NZNA 4XEUA 1DBQA 4PIPA 2WHPB 2P2LA 2ZT7A 4KUEA 5K45A 1UZMA 4EJ6A 4NNJA 4D6XA 4F92B 3S2UA 4X8LA 3HP7A 1US8A 1W5EA 4GMXA 5JSHA 1RM0A 5DYYA 5BWOA 1N9GA 5IYZB 2J9RA 5IXJA 3M4ZA 1XEWX 2ZJ6A 2MHCA 1ZH0A 3MBKA 1NQ5A 3BTVA 3MJVA 3NNNA 2FEXA 1OI2A 3AGQA 4LZWA 4M49A 5H83A 4RA6A 3UMMA 4NQZA 2FRDC 5AJUA 1EESA 1KGDA 4LDAA 1IRIA 1N5MA 2V8OA 2VJOA 2PZKA 3HVRA 4XRQA 2FFHA 1YDWA 3LM8A 3DBRB 2PGNA 3L6CA 2PJDA 1M2FA 1GWNA 1O7JA 3HPQA 4F85A 3CEAA 1UNKA 1KYZA 1Q6ZA 5D6NA 5A62A 3I8SA 1Z63A 5K3CA 4C2TA 1CF4A 3SJBA 4E1BA 4IWNA 3SHOA 4DS3A 2QR5A 2AZMA 1VOTA 4YAIA 3V4OA 1NC3A 3FRHA 3RU9A 4NMWA 3TWOA 1NLYA 1UKZA 2A8YA 2DKOA 4ZOEA 1GN8A 3WDSA 5DCWA 4FMDB 2A84A 3EUWA 2AOWA 3EIWA 4DSTA 3BMXA 2OGSA 1Z4JA 2D1FA 4MUIA 1HRKA 1HYGA 4X1IB 1ZUHA 3T3IA 2HQBA 2Y0BA 2KG6A 2CHUA 3O2QB 4HLUA 2A57A 3QVMA 1L7AA 4N8DA 5TPZA 3SPXA 1ILWA 4RTNA 1BAPA 4EX7A 3SIWA 3KVYA 3CBQA 2CY0A 2YR0A 1Q21A 4BLWA 1G6HA 4BP8A 1FA9A 4DKJA 5EQDA 1DV1A 3ESZA 1F2UB 4JAVC 1B73A 5F5NA 5BNFA 1WCV1 1DG1G 3LL4A 1P0CA 2P0YA 3WYCA 1JVBA 2BFFA 2ZWMA 3NEPX 4B79A 3AK4A 1ZNXA 2K5XA 3NATA 3O8QA 4YLYA 3OQIB 1V1MB 2OQ2A 5AVTA 5AW0A 4IV8A 1M74A 2V7BA 3KOUA 1YMQA 1JQBA 1UMDB 3RYTC 3DOHA 2D4AA 1DL5A 2PPLA 4LE2A 4KC0A 4URZR 4WEOA 5HIIA 3RU3A 4B35A 3RTBA 1IWOA 2C03A 2W6NA 3DW3X 3EH1A 3FYUA 4JVOA 3O9VA 2AUNA 1H0RA 3V8NA 1TCAA 3OLCX 4UHDA 4C4TA 3UEOA 4KAXA 1BMQA 2PEOA 2BBSA 3F6RA 4HB4A 4BZPA 4D02A 4DT1B 4ZGWA 2QTVA 6PFKA 3OCCA 3Q9NA 4AZTA 2AJBA 3ABZA 4PH0A 4HK4A 5SYMA 1ID1A 5EXDA 2BC9A 1Q15A 2RJNA 4KQCA 4U3JB 3BGIA 5ER6A 2I9PA 4ZC1A 4US0R 4WGFA 4QSHA 3WLPA 2OG1A 1W9HA 2ORWA 3LGSA 5HDBB 1Y6JA 1ZIYA 2XDQB 3EPHA 4M7OA 2W22A 4K0KB 3ROZA 4D56A 4AN4A 5KPDA 4FNAA 3QU9A 1SWVA 3R9IA 4FYIA 1U8UA 1WMDA 4ZI3A 3OD1A 2BI4A 2VWPA 3L1UA 4H1UA 2JASA 3GFQA 4LRWA 1XDSA 3F5MA 2W2VA 4C7OB 4IO0A 1C5KA 1P1IA 2MYTA 5IBPA 2P40A 3F8WA 2ARKA 3OT4A 4EG0A 4C20A 1I5EA 4TYYA 4BPFA 4AO8A 5IVPA 2GZ1A 2PTHA 4FYJA 5DFAA 2Q4RA 1ZL0A 3FZEA 4N9QA 1KSGA 4KW7A 1NRWA 1J8VA 1QG6A 1N2CE 3CX8A 3ND9A 3AQ4A 4LZLA 2R6FA 2NNLD 2XUFA 4Q3LA 1XMIA 2C78A 2IEAA 1LEHA 1W4LA 3I1IA 3DOCA 3L82B 3Q6NA 4GIBA 3HR8A 1OREA 1RWQA 2P79A 4H7FA 4JOCA 4GVPA 3LUJA 3IEVA 2YJGA 2IUEA 2HBYA 3HBJA 5D84A 2GF2A 1XKTA 4DZTA 1N5RA 2VSNA 4LRQA 1SXJC 4IEEA 3ZD8A 1YZVA 2K0YA 3G68A 1KEVA 1KOJA 4HJXA 2LCQA 1ZSNA 3JD2A 2ZS7A 1E1QA 2XH8A 5E1MA 2ZOSA 5TSDA 3AR4A 4JI5B 3V1UA 3X1YA 1NI5A 3AR2A 4NAHA 4AYWA 3KNZA 4L2IA 4WECA 4PO1A 1RO2A 4GPD1 4X1YA 4HQ0A 3RTCA 4HAWA 1P5HA 4F3CA 7MHTA 1ZMBA 3VVLA 3OSUA 1NOIA 1QIDA 2AFVA 5DKFA 4RK1A 3X1WA 5IG2A 1L7QA 2VT7A 2J7PD 2DR0A 4XGRA 3O8DA 5EKDA 3IOBA 1K98A 3M83A 2D8AA 3BBLA 4YPVA 4J4BA 3TIVA 5F3WB 1AUXA 3EFHA 2YASA 2WAYA 4RO0A 4LJRA 1ZWLA 4FHZA 2WWGA 2X40A 3B3AA 1XRNA 3R7WA 3VR6D 3NBXX 1XPOA 1TF7A 3MJSA 5EUBA 1ZRNA 5JS1A 4IDDA 4F9TA 4ZQBA 1JXMA 2BWJA 3P0RA 4C07A 5HGXA 5IDXA 1Y5MA 5K51A 4LX8A 1QMGA 3NHLA 3W90A 3AXTA 2XF2A 3BBPA 1KJYA 3B36A 5FYQA 3W1EA 4JMPA 4PTZA 1THTA 3HZHA 5DNYB 1XP8A 4Y9SA 4YAFA 3R7DA 3VVCA 4KR0A 2X8LA 1ST3A 1P7YA 3AV0B 1ISHA 3MYYA 3QYFA 4Q3KA 1FNSA 3WKEA 4UFPA 4XDGA 1WD5A 4IQ8A 5TR9A 2X3UA 1KRWA 2P27A 2XHEA 3QFTA 3N2KB 5CM9C 4KBYA 4MWBA 3WHPA 4B7AA 4ECAA 3LT0A 4BWYA 4HPWA 3DMTA 1DBRA 1KTVA 2VLPA 3ZZUA 1RLMA 2JJ1D 5JROA 1KXJA 3UTCA 4DARA 1H3FA 1QFYA 1DQNA 3FYDA 2HDNB 3GRFA 3RYIA 1CW2B 1OXVA 1QVWA 1R4MB 4A8JB 5IRCD 2YVKA 3NU1A 1SD1A 4CM5A 5BWLA 3R0ZA 3J80A 4DDMA 3N2GB 3M6IA 3MWDB 1RXUA 1EJBA 2J07A 2G9ZA 4HAVA 4BNLA 1G59A 3HA3A 3KCQA 5BUZA 3L41A 1ZH2A 4P7KA 1DRVA 1RCFA 1EX6A 3VSCA 1AMOA 5DNVA 5HKAA 1DBVO 1JKMA 1K8XB 1T1EA 4LUCA 3F78A 5LOVB 4N01A 2Z9CA 3VVBA 1ECPA 3FSEA 3CRRA 5BWBA 3R3WA 2JGIA 5FFFA 1ZJYA 4CM8A 2KGCA 3FY4A 4EYEA 3O6VA 3RANA 3LPDA 2BE9A 1CEXA 3HUUA 2C5SA 3MD0A 3LQKA 1XLTA 3VDQA 2YY7A 3NUQA 1U2DA 2F1HA 3A9WA 2ZUSA 3FMOB 3HWSA 5BW4A 3SJUA 3TH5A 2WT9A 3SLRA 4ENUA 1QIFA 3IULA 2GSDA 4LY6A 3GW8A 5HUHA 2WT8A 3DO5A 4Q9NA 5CXUA 1LZLA 4JV5B 2AYXA 3C14C 1RPZA 3HM2A 2BKAA 5LD2C 3HZQA 2WHYA 2FW6A 3K20A 2X2BA 1DIOB 4HNAB 1CNEA 2PUVA 3TVYA 5EZ6B 3G4SP 2E5FA 5KMGB 3PQ5A 4B7UA 4F4IA 5DEIA 3RUEA 2CLEB 3DF9A 2WJHA 4I6EA 2B92A 2OV4A 3A0RB 3I2FA 4MUAA 4FNOA 5FWXA 1QHXA 2B35A 2B99A 3I30X 2VVTA 2P3SA 5BYBA 1CR2A 3QKSA 3TNYA 3SX2A 3VOAA 1R6AA 1OLSA 1YC5A 3KB8A 4L50A 3NANA 2OBBA 3CYFA 3SYNA 3D2CA 5DCUA 3TTXA 3HUTA 2KWLA 3FD8A 4G97A 3QVLA 1V45E 4WLVA 2NXJA 2EQ5A 1P0MA 2FK7A 3LT5A 3AU8A 5BNWA 5B1IA 4FYPA 1GUDA 2DPXA 4NBSA 4JLSA 5AR1A 1Y3DE 3K53A 1L5WA 3GLKA 4C6HA 4WBNA 5M29A 3PJRA 2V1XA 4QM6A 1OKKA 4WI1A 3JRWA 3CT4A 3K9HA 2OCIA 4DABA 1JDUA 1EK6A 3BRSA 1NUQA 4UHBA 3ZBPA 2A9VA 3C6MA 2X14A 5HBRA 1JA9A 2FFQA 3QE4A 4GSKA 2VNJA 3VJKA 1JYEA 4A23A 5IXYA 5JASA 3B2EA 2O2IA 5DGDA 3IPXA 3WLOA 4FC7A 3V34A 1BFKA 5BXQC 2ZAIA 1DAHA 3ESDA 5TPWA 3R0JA 3NVDA 1K5GA 2CZQA 2NLOA 1BVRA 4MPTA 5ESWA 1TNDA 4GMGA 1KOLA 4HQKA 4HRVA 2OB2A 4F56A 3SQXA 2QTMA 2ESRA 2AK2A 3DEJA 2AXPA 1QDUA 2JRLA 2WF5A 3AUAA 4PHHA 4TV9A 3VPDA 3ZU5A 2EFJA 5K0SA 2DETA 4EPWA 2Z30A 4QU5A 4RQAA 3D8TA 2AG0A 4PH1A 4AU1A 3ESBA 1HM5A 2IHTA 4LHWA 2CL6X 4BFYA 5C5DA 2GN6A 3FPLA 3NEYA 4Q7MB 4YP5A 1C7RA 4B3DA 4MWEA 2REQB 5JZMA 4IUCS 2KX7A 3H75A 5K4HA 1QRTA 4BPRA 3Q40A 3WKCA 4QYTA 2P9EA 2IOFK 2CNWD 3LGAA 3ORFA 5HJEA 4JI2B 2C9MA 4GDFA 3DVAA 4QNBA 1YVEI 2BFPA 1DE0A 1OYOA 5K6AA 4I99A 1T5HX 1J1UA 5JVDB 1RQXA 4NCXA 4HKTA 4KUHA 1G18A 1AA9A 2QEQA 4C08A 4A36A 1L4YA 2KM1A 4KQFA 4HYTA 2JGDB 2Q3DA 2YZNA 2ZUCA 4CLRA 2PEQA 4QTTB 1B2LA 1W36B 2C3OA 4MW4A 2IY7A 3HN6A 4YO7A 4PF1A 3UAOA 1I3OA 3R7WB 3A1FA 2JJ2A 1V1JA 3ZWXA 3UK2A 2JW5A 4BVEA 1BXIA 2WPNA 4IPYA 4JROA 5CEJA 2QNRA 4DLKA 1ZIDA 3VNSA 3AUUA 1XNHA 2WNSA 4QTXA 4QYSA 5KTRA 1NJSA 1QTRA 3TTTA 1PJQA 1GQFA 1KJWA 3DG9A 3KT8A 1FYDA 4MVJP 3VC2A 3X1DA 2BMDA 3KXKA 1KRHA 3BIFA 1JSLA 3KELA 3I34X 2JAPA 4NEGA 1FTNA 2BI8A 4RWZA 3DT9A 1SBQA 2GBFA 2W58A 4LTDA 3GD5A 3EEYA 2RHJA 4MPJA 1WXEA 4QQFA 1IOWA 3B6JA 2BFEB 4FZ3A 1GOTA 2Y3IA 5BN4A 1RR6A 3SGLA 3UYKA 4RKFA 2VJPA 1PTKA 5KYYB 4RIFA 5DHQA 1P7VA 1LQTA 1AKNA 4UJ3A 4IHJF 2FPMA 1MKYA 4V0OA 1NT4A 1ZH4A 2JH3A 2Q2OA 1E9CA 2Q5IA 3DBHB 1ZISA 3PFFA 4G9EA 5JDIA 3R5FA 3GDFA 1ZPDA 1Z36A 1UR5A 5FWYB 3TYXA 2PXHA 4PXHB 1JFTA 1DWQA 2QGFA 4YJGB 4LKOA 1EDBA 4IJ6A 2RBGA 3AKDA 3FTEA 3M9XA 2OWDA 4ETWA 3PUVA 3SWWA 2AZTA 2M8LA 2BEUA 3CUWA 3ITKA 3N8HA 4TUYB 2VP6A 2W83A 3LG2A 1AUVA 5E4FA 4UCWA 1P2TA 2JLVA 2KR5A 4RSRA 4KXUA 4C6RA 1TU3A 1TYZA 1I2CA 2LZ0A 4LJYA 2OO5C 2ZG6A 3LX4A 3H6GA 3ACCA 3P2KA 2GAAA 1E6UA 1G3UA 3AL2A 3F5SA 4KSBA 2KYRA 4OL9A 3WIDA 5LWQA 5D00A 1W1UA 1YB4A 5K0ZA 1F4VA 1I3MA 5HF8A 1C0KA 3USCS 4L22A 4EGSA 4AYXA 1JQ3A 3DOEA 4G89A 5D86A 2C77A 3VR0A 1Y34E 1W87A 1Y5IA 3CNQS 1JE0A 2ZTUA 3O4JA 3IUNA 2ZGVA 2V6MA 3BCUA 4IIVA 4AP6A 3DMYA 2XMSA 1QWSA 3A1DA 4MUYA 1V8FA 1HNNA 4KLAA 3R5HA 3RVLA 1JJ7A 4OEHA 3W5IA 1ESZA 1GSAA 3DFZA 4YJ3B 4P54A 3T3PB 4AS1A 3HL4A 2HO5A 1VDMA 5EIAA 3RRMA 2DWQA 3WX0A 2ZYWX 4JC4A 2ZWVA 3E82A 3VU8A 1EK5A 3PT5A 3PUZA 4PCAA 5DNDA 2E9SA 1VLQA 3CF0A 5SZJA 2Q41A 1PJ3A 3LJKA 3R3ZA 1C30A 1ZN9A 2BP7B 2IU6A 3DTVA 4ARAA 5IHXA 2NO8A 5FBVB 5LB4A 4TTPA 4IRUB 4RTMA 3OE7D 3G6WA 3RB8A 1VHJA 4MYHA 1KNQA 1RADA 2IPLA 1R27A 1E79A 1OSNA 2VSXA 4O4JB 4ZEVA 3IFSA 4LCBA 2RGWA 1DWUA 4MDYA 3UXEA 1G20A 3W6NA 4PQYA 4D97A 4UHCA 3WLRA 3L4JA 3E23A 4X84A 2WABA 4XI9A 1G6Q1 1G8HA 3SICE 1AUOA 2N47A 4R31A 2P77A 4E33A 5AUPB 2AB0A 5LIPA 3PR2B 4WDRA 1IY0A 1J23A 1UBKS 3FNEA 1E3WA 4IYJA 2R25B 4QJ4A 1LBTA 2QROA 3IP5A 1YZUA 2GTHA 5KNCD 3UUFA 1CUDA 3UT5A 2WUDA 3OESA 2OR3A 2O2JA 1TK3A 2ZK7A 3C15C 2EW1A 2K2QB 4KN8A 2X2FA 3A1SA 4BUZA 4CMKA 5HQ3A 3JWPA 1T9ZA 1KPIA 1G64A 2DUMA 5DPMA 1W2GA 1V6SA 2J5RA 2ZJ1A 2IK8A 3IOMA 4INPA 5ENVA 3H0DA 3GJSA 4ZOLB 1CBUA 1X7GA 3KFVA 3UMJA 1XMOB 2EYUA 4FCWA 1MW9X 5KYXA 3ROMA 3D4PA 3G9ZA 2PSHA 3P9PA 1EWKA 4PFKA 3QPUA 3NAMA 3WV5A 4XUEA 3PDIA 2O2DA 3IPCA 2C2ZA 2PX8A 4HEA1 1A5AB 4JEHA 1JTFA 5L95A 3GFPA 1M2OB 1KZHA 5EIBC 3H9UA 3JQDA 2I29A 1DDOA 3DZIA 4OM8A 5EJ5A 3ZDRA 1D4ZA 4ATNA 1LKZA 2X6RA 4EOGA 3BG5A 4H7EA 1F7UA 2EF1A 1MQ9A 4BX3A 4F5YA 5F33A 1PSWA 3AESB 2IL1A 1CF9A 4ZU1X 4BOYA 1YZHA 2O1EA 1QZXA 2CLMB 4NBVA 4RD3A 2MU1A 3U26A 4TXMA 4HB0A 2HHCA 1AMNA 2YW2A 1ARZA 4MQLA 1DHRA 5CR9A 2D1SA 5KDLA 2ODWA 4EF4A 3NRCA 2AR0A 5TEVA 1Q16A 4N1AA 1QYRA 3H4TA 2FK8A 2B3DA 4LYJA 3C8MA 4GRAA 3CS3A 1TZKA 3INGA 4PFJA 2F1KA 3PBKA 1X15A 2CYCA 4L8VA 4N41A 2C2MA 2H2FA 4P80A 3NXKA 3GBVA 4E11A 2QLJA 3K0FB 2WPDA 3F9CA 4WIAA 4QARA 4Q7QA 1COWA 3DVQX 3OZFA 1EFVA 1H1DA 1SUEA 3C41J 1Z82A 3GFBA 2PFKA 5G3ZA 4QPPA 3FLAA 1OWNA 3H2HA 1QWOA 5KOJA 2HCFA 3D4LA 1A5BB 1GTJ1 1PSZA 1IAVA 3ND8A 1D04A 2NU8A 3MQFA 5HCIA 3USZA 3CGWA 3H2GA 1UBEA 2OCDA 4NFHA 1ISMA 5IJAA 4H27A 5K9ZA 3IB6A 4A8JC 3Q3GE 4MQ5A 4PR0A 4YCMA 1WW2A 2NZUG 3A6HA 5I45A 1F12A 4CTKA 5K7SA 1FRVA 1Z0SA 1E2QA 1ADCA 2HU7A 3TSCA 2Y1LA 1N8SA 3PITA 1CERA 4M8NE 4BNUA 4IIJB 1XNQB 3L9XA 3ONNA 2Q8NA 3CCJP 3N87A 1TQ6A 4ZI7B 3RADC 4FK8A 1UM9A 3BXPA 2RAFA 3K09C 2I1VB 5JS7A 1C50A 1TU0A 3CVXA 4J0EA 4EYGA 3RE1A 5AVSA 1O77A 4ZRDA 4LXGA 5J4KA 1DADA 4H77A 3W06A 3O8OA 2F4VB 5H8WA 4GQAA 1IB6A 3FSGA 2IOHA 3CUVA 3HYCA 2UXDB 4GICA 3CLUC 2PT6A 1L5MA 3HDJA 1NVMB 1QGED 2I8CA 3I9OA 1IC6A 4RD0A 2CV1A 2P6UA 4LPSA 3FKSA 5KWVA 4MPRA 2VQFB 4O4IF 5EWJA 3O26A 1C3OA 1IWPB 1P8AA 4B8YA 5J2TF 1MB9A 2APJA 4NDZA 3VKFA 1D03A 2V3VA 5I7VA 4M36A 1OROA 3PE4A 1J24A 1WDMA 2Q6OA 3FROA 5KQPA 1J7JA 2I87A 1JLHA 1IXRC 2PLNA 1YFLA 3DMFA 5EQTA 3WJAA 2FSIA 3ESXA 3GA7A 3P97A 4FT4A 1W44A 4W63A 2XB8A 3VU0A 5F23A 2CL0X 1JIIA 2BGWA 4LSMA 1CJTC 2DR2A 4L3VA 4WADA 3ZWDA 3WMWA 4A0HA 3NIWA 3QVUA 4JHXA 4CMBA 1IYZA 2NACA 2H2AA 3HXLA 1X6VA 2R5NA 3H3JA 3AHDA 3JQ9A 4ITRC 4CQLB 2R8EA 5C2JB 3VR3D 1O03A 3U4HA 5D5QA 3D5EA 2QNBA 4FN5A 3Q0TA 4YJHA 5CX1A 4CCAA 4IJMA 3OHSX 4GVLA 3PFBA 4GKJB 1W75A 5T4HA 1EUQA 3TQSA 1UMBA 4YASA 4LMBA 4ND5A 3C4QA 4Y67A 1SXPA 3G1GA 1EP9A 2PRYA 1U1IA 4Q4HB 5FI5A 1G3RA 4MW7A 5ICSA 4KQ6A 3CCBA 2XYHA 3QX8A 3LFUA 3N70A 3UK0A 4A10A 2EKZA 5B5SA 5K0BA 2AFEA 3L4BC 1DQYA 3H5WA 2FSVC 3QEKA 1XTSA 3QQPA 4IIDA 1HEUA 2A9OA 3ZHZA 1SQ6A 4WA8A 4CNBA 1WZEA 4ER5A 3H1BA 3TXXA 3PI6A 1NF8A 2P2DA 1E2NA 1TRHA 3G8DA 4WNCA 2FEMA 4FGUA 5LKAA 1J0DA 2RAPA 5JBIA 4RE5A 1ZCZA 3P2IA 3AV3A 3QXJA 1CLEA 2OE2A 3RYFA 1KY5A 1UXIA 5IVDA 1JDZA 4AY4A 3MAAC 3PR3A 1TVKB 1NF2A 5EIOA 2K0DX 5JS8A 1YDEA 4KPGA 5FUYA 5AVZA 3CZQA 2C31A 5KNDH 2KGAA 5MFZA 2OUKA 1N33B 3GUHA 3DOFA 1N7GA 5ALEA 2X42A 4N03A 2PRSA 3WFIA 3O8RA 1J0BA 1I2AA 3ILXA 4J0DA 3WGHA 2JZNA 3WSVA 3ZE2B 2QP3A 5DM1A 2NXNA 3RS8A 1ISJA 2JAOA 4KXQA 2R9VA 5JWRA 4OUKX 4H1VA 1ONBA 4JIGA 1JR3E 1PR3A 3R4CA 2X41A 4URUR 1Z38A 3RT9A 1H3NA 1P17A 3EAFA 3NI2A 5D5HA 3RVMA 4AQYB 3DZJA 3T06B 1HQKA 1VIYA 1XAJA 5TE9A 3JZMA 2JLWA 1BHSA 2WSLA 3BC1A 3EY4A 4ZGGA 2EU8A 1P39A 3AIMA 5FO1A 3MIZA 1NA5A 3B5EA 4WV3A 2Z2IA 2C94A 1GYRA 4AF7A 4KR6A 2QYHA 6LDHA 1M5RA 4MV6A 4LF6B 4A82A 1VQLP 4KO3S 4OHFA 2FUG1 2I7CA 2NZVG 3GUCA 4J16A 5GPBA 3CLHA 2QLNA 3C6YA 1KK3A 3LHDA 3AINA 4HGRA 1PT8A 1SVOA 1UOQA 1W36C 4O6VA 4NAVA 1SR8A 4FZ5A 4ZU3A 5IU6A 2MSDB 2E1RA 2XEXA 4G4IA 5TMDA 4BEJA 1RYEA 3KHSA 5AKKA 2PX5A 2BZ0A 1OI7A 1L7XA 2XUPA 2PUDA 2ZXEA 1MD9A 1E2IA 5KOHA 1XFAA 3E3OA 4JDPA 1PJAA 1T4CA 2OBNA 2VA8A 1U0FA 4OV6B 1QIEA 3PPVA 3WLIA 1BJTA 1LBEA 4KR9A 1MRNA 4H7HA 4FP9A 3FBTA 2J4FA 4DV4B 5E9WA 3ISVA 2XRYA 4PG8A 3Q41A 3DONA 1NRXA 5KWJA 1IIBA 1K0FA 4JJ4A 2Y4OA 3JQBC 4HGZA 1LLCA 1VQOP 1CUBA 1FDUA 2A30A 2YJNA 4LV8B 3ZNOA 5AESA 4AMBA 3RS4A 3R3UA 4FSXA 4L15A 1TM1E 4L0DA 5FTJA 3JWHA 3SZMA 3ND6A 2AE1A 4C5AA 3HADA 3HYRA 5ARCA 5ULLA 1VE5A 4IXTA 2FSGA 2NSLA 4U7TB 4QT0A 4NJOA 4D5GA 1NUPA 4MEJA 1XU7A 1XCMA 2G82A 4FKBA 4FE7A 5G0SA 4GNKA 2B4QA 1PFWA 1GUAA 3EPJA 3BF8A 1CLUA 3ZDAA 5JQGA 2AMLA 1R9GA 1QHNA 1E64A 2OMEA 3I37X 5J23A 4R9UC 4IVQA 4OK3A 3MGEA 4DLLA 2WMYA 2VYFA 3R76A 3ZZMA 2M8PA 3AERB 3AP3A 5ELMA 3QU7A 1KE2A 2XRZA 4Z4FA 3T1VA 4DBLC 4HMQA 3CC7P 3DR5A 1OPXA 3VJRA 2H4JA 4F38A 1W0KD 4CEIA 2ZIXB 3TPCA 2JLCA 4JMLA 1Z0IA 3PRHA 1L7BA 3TTVA 5JBNA 2D0OB 4OHZA 1W1IA 1T0PA 3IUYA 2EHDA 5ALJA 2NT4A 1I01A 5SZKB 3WYBA 5GTDA 1GA6A 2J7KA 4OXXA 4RA9B 3WL5A 2DGDA 5EHGA 3V1KA 2AWNA 3KQSA 4PSAA 2NO9A 3LUDA 1PR5A 1GL7A 2UVDA 4CYMA 1GZHB 1A8PA 3T7SA 4PO3X 4EX6A 1J0CA 1VIAA 1WHSB 4HXFB 3R44A 3T4PA 4BCBA 3RC8A 1OWOA 3QJ5A 5CRIA 5HBGA 2Z09A 1M0WA 2RGNC 4PZDA 1N8TA 5G40A 3BORA 3LC1O 3QMWA 5PGMA 4DTCA 1XQ1A 3QF4A 4ENPA 2V65A 3L40A 1QP0A 1IN1A 4MWCA 1NVKA 3MAGA 1U04A 4B85A 4GOND 1YA6A 1IBRA 1W8DA 4BGVA 4RVFA 2EAUA 4TYMA 4MUBA 2DSNA 2JFGA 3FOBA 2O3SA 4HDSA 1VZ3A 2VF5X 3V3KA 1WMAA 2ZYDA 1JG6A 4B45A 5IANA 4J0HA 4I66A 3BS4A 3AXSA 3OWOA 3QKWA 1NJFA 3NY7B 4RE6A 5JR3A 1LJUA 4JJKA 5ECYA 1Z28A 3CIFA 2FQWA 1SKYB 4ER7A 1F1BA 2ISQA 4K28A 4KIJA 4O29A 3UJ9A 2IX9A 4FFBA 3D7RA 1CQPA 3I9MA 1RIFA 1SBTA 3TSAA 4L9WA 4ZFNA 4OAOA 4CQMA 4QTUB 3Q3VA 2Z6UA 1SY7A 3C8UA 2R8RA 2VTDA 3MVEA 3DM5A 4OFZA 1UPUA 3KVOA 1DCKA 2IS2A 1M1NB 2TMYA 1C3XA 4QELA 8GPBA 4DC9A 5CA1F 3WY9A 4DA0A 1UWLA 2VHXA 2XKAA 4ZOAA 2G9UA 2CDCA 3V1TC 4HS4A 1NYRA 3MRSA 5T4FA 2QV7A 4F91B 1E5XA 4P4SA 4JUAA 3BIJA 1MBZA 5D8DA 1DQSA 3I5MA 3R8XA 3OW2O 5B36A 2YNMA 1CUCA 3ROXA 4FUTA 2FAEA 2FDXA 4K88A 1XZDA 1CQIA 2C3MA 4M0IA 1OLOA 3AF4A 1L5SA 3OFVA 3K1YA 1NW7A 1F0PA 1RQLA 4YYZA 4HRAA 1Q0RA 1HDCA 2P6OA 1UFKA 2PWPA 2RC6A 2PD6A 3B3JA 4JLKA 4YI3A 2F62A 3B3GA 3ZV7A 4DRXA 3ZU3A 6NULA 4LI0A 2ZYAA 2OGTA 4CEHB 1AHHA 3DKIA 3DT6A 2AZXA 2OA0A 4DUGD 4AY3A 2IKSA 1WDLA 2WA1A 1R6XA 3QSGA 4I1IA 4JVSB 1FSFA 4M1MA 3CVYA 4W5OA 1H9AA 2DB3A 2W2PA 4TTQA 1KVTA 2P90A 1L5FA 3A6KA 1I7QB 3U3KA 2BIFA 2O4CA 4UTOA 1EDZA 5B6JA 1QVVA 3E35A 3HG7A 4M0FA 3PEWA 1SH7A 3R0IA 4J3FA 2WQ7A 2GLUA 2BFWA 1W93A 2FSFA 1FYVA 4TMKA 4U7DA 1Y1KE 3A9TA 2FDCA 1B8PA 3DSRA 5KVVA 3S8MA 5EJEA 3FPEA 1E7MA 2B4YA 3L8EA 3T3GA 2M98A 2EHTA 1ML3A 1VLVA 1WXGA 3CCSP 3TPFA 1ZH6A 2CXNA 2ZB3A 3S7TA 3HU5A 3H9GA 1W5SA 3KSMA 5G4KB 4QE3A 1U1DA 3VFDA 1XMQB 3ZK8A 2Z1DA 4BMSA 3LY5A 3CC4P 4PINA 3LKZA 3ER6A 1PX2A 1QAOA 2B8WA 2W2LD 1MAHA 2QL6A 5GADl 3RUCA 1GVHA 5TQ0A 3FTFA 3NBAA 3C3DA 3PQEA 3BF7A 3PHBE 1JLLB 3M9LA 4S2EA 4DIMA 4JBNA 1MFPA 3MUNA 1E58A 2XF8A 2WAAA 2BGGA 4AWAA 1FR2A 1RJDA 3GEBA 3PHIA 3VTZA 1F2DA 1CYEA 1B1AA 1YCFA 3FIUA 3KZOA 4ZO4A 5D51S 1UODA 3RJZA 2FRXA 4C7KA 1RJGA 3IX7A 1BX1A 3UOWA 4EJ2A 2KI5A 4DGSA 3FZYA 3TIFA 3CEMA 1D1QA 3SZRA 1WUIS 1W6RA 2ZVPX 1V11A 3PUJA 4NYIQ 1HWYA 2QP4A 3H47A 2ZBQA 2GO1A 3S2SA 2COKA 3T94A 2M6RA 2ZE5A 4TS9A 2YH2A 4F37A 1MO4A 3NDPA 1CUZA 2PUTA 1TKRA 3AOEA 4M9SA 2LKIA 4PX3A 4QQ8A 3SYMA 1NVVQ 4YRLA 3Q9SA 3COPA 1FNMA 1HQYE 3AEQA 3FUTA 2VWQA 2ZJZA 2CNOA 1YR3A 3PD1A 4UTNA 5IN5A 1QG2A 4R7TA 2JGKA 1Z7WA 3Q7EA 4PIVA 1W4BA 2Z8ZA 1NUAA 1IJKA 1ZQ1A 3CEHA 1B0UA 2G7MC 2X58A 1E98A 3AVPA 3G7NA 2OG2A 3LK6A 4M88A 3REOA 5CVTA 2NO7A 1JEOA 3MINB 5G1OA 2C1ZA 1BRMA 4QSMA 1ISRA 2Q9BA 2XUGA 2FLWA 1TVMA 1W4CA 2FU5C 4X5OA 3G8BA 4YCSA 4HCJA 1HNWB 3TTYA 5KYWB 3OICA 5FLEX 2VEOA 1BMTA 1IEXA 1RHJA 3D8RA 1FRNA 3ZWCA 4ZHQF 3DE0X 4HH1A 1R16A 3VZCA 3W8RA 2XJ9A 4A8HA 5KKAA 1NBME 2PUHA 3IGFA 4P0TA 4S1WA 1SURA 1XELA 5MN5A 1YTUA 1GPBA 2AC2A 3EYWA 2NAPA 3GZTB 5EVJA 1ONSA 4E5KA 2E7ZA 3G02A 4IDOA 1D8AA 4EG4A 4CIBA 3RABA 3A7DA 1Z18A 4Q4AB 3AL0C 1CQWA 2QXTA 4IF6A 4HMOA 1YAHA 1Y5LA 1FDSA 3GOHA 3HV0A 5F7JA 4KFSA 4X6UA 1ORVA 2EL9A 3IELA 1JV2B 4QASA 1YGYA 1OXTA 1Q6YA 3FTQA 4FEEA 4WOCA 3VYRB 2D5LA 4CF6A 1YDMA 1A04A 1R6VA 2FFJA 2VQ6A 3LKBA 3P5SA 3P0JA 3QE3A 5F9MA 3I52A 3CRMA 3UUEA 1A96A 4LW8A 4MKRA 2FADA 5CT9A 2FR8C 3DEYX 3WHKA 4QAQA 1K2WA 1RRGA 2E4XA 2RK3A 4HNSA 5BSRA 4QG3A 4BN0A 2D7JA 2BFBB 5KJ6A 1EQ2A 4D44A 3DR3A 2LRHA 2WYHA 5DWQA 2GFQA 4ZVVA 3SXUA 2XGGA 1CWUA 1W0CA 2WIBA 5AVWA 3CEPB 1T5OA 1CE8A 4FX5A 4DJEC 5KKNB 1K4MA 3B9BA 4WBNF 4R1OA 1QIKA 2W6MA 4FZJA 3ZVMA 1E63A 3I1FA 2JA1A 3ORRA 3ZWBA 2VHTA 4GKAA 2P9ZA 5ICMA 2WYVA 1U6IA 2QMUA 3W2HA 1QPZA 1PW7A 2OLEA 2R7AA 3OG9A 4A0GA 3ZW7A 2H0QA 5EIHA 5IC4A 4F06A 3CQ9A 4Y2VA 4BLQA 2JFXA 3VMMA 4RD6A 3LCRA 4RNDB 1A4RA 1A43A 3U49A 2H85A 1NJIQ 3IVGA 2H5LA 3UKOA 1OB5A 1EWQA 2CUTA 4RQTA 1N2HA 1YB6A 4F21A 1AS2A 4OQMA 3QUCA 1QJ4A 2CLIB 2QI9F 3FYTA 4J29A 2QRJA 4BO7A 4CV0A 4IDHA 5JWHA 4IDEA 2WE8A 1LBQA 1Z26A 4TV9F 3TEFA 4KQ9A 3D6JA 4DY6A 1ML4A 2CFCA 3VR4D 5ITZA 3VPGA 1Q2UA 4KQ2A 2CXOA 3NDBB 3NAZA 1NWCA 1I2DA 1QUEA 2V7QD 3L0DA 1PGJA 2ZANA 2Q49A 3NIFB 1HBJA 1NVAA 3NTOA 4GGPA 1I36A 4C4SA 2ETVA 2Z6VA 4U0JA 10MHA 1ZN2A 2O54A 3NIGB 2LF4A 2VUIB 4HYQA 1V39A 1MIOB 5TF4A 1S9DA 3SF8A 5BUQA 4QNNA 2AMVA 3U0VA 5I6DA 5DNUA 2CXTA 2UYGA 1JSCA 1O96A 2FNAA 3TMYA 3UF0A 2CL5A 1IB0A 2QXYA 3OEWA 3ROGA 3IQXA 4P22A 3G21A 1NTRA 1P1BA 2C0QA 2JFWA 2R6ZA 2RH8A 4UFOA 5CLLA 4QUBA 3SI7A 4K8OA 3SIRA 4I1VA 2MYUA 2CMHA 2FJPA 4NP6A 4KIWA 2OENG 3Q3EA 3S70A 4HEHA 2Q6LA 4TSFA 4I1OA 2B5OA 4EVRA 3NYIA 4JBWA 3MPOA 3MWEA 5DEOA 1DWOA 1WXDA 1HT2E 4TWBA 1G5FA 2HXGA 7AT1A 2M6KA 2GZMA 3QEBZ 4EKEA 4MRAA 1XVAA 1GU0A 3MZ0A 1XA0A 2EQBA 2JAWA 1XAHA 3LU1A 4Q3DA 2ZYHA 3SQLA 2QPLA 1UT6A 2DQKA 3KOMA 4Y2YA 1E3MA 1TO1E 4GM4A 1OILA 3IVRA 5G0VA 4BO8A 4O4LA 4D26A 1DXOA 1ZJ5A 5BSWA 2WG0A 1AKVA 3GN1A 4EO4A 4GL4A 1DUIA 3WBKA 4YT8A 3N0WA 2UXCB 1WXHA 5FB3A 1AS0A 3JAWA 2P5SA 3LDFA 2GDYA 4HN9A 1ZVKA 1O9GA 1YS1X 1NIJA 1KDVA 4HWRA 1A9XA 1MIHA 4EW1A 3WGTA 4C14A 3NAQA 3WA6A 1XZNA 1SBHA 5ICCA 2EGUA 5IZ4A 2Q1TA 1LC3A 1XNGA 1FZTA 5DWVA 4H3KB 3TW4A 2W6OA 4HC4A 4MYDA 4ZT5A 5BRAA 5C52B 4Y6LA 3GLFE 2IUSA 2C4MA 4DG9A 2PBRA 4YMSA 3UJ7A 3DS5A 3WL4A 1ACMA 1DBPA 1Y42X 2I2CA 5LNK6 2J48A 2EIAA 4UNRA 1YZTA 5AUNB 3OLWA 5C8ZA 1U11A 1T5DX 4LY9A 3W2IA 3PUWA 1Z7GA 5A04A 1CEQA 1JEJA 1WUTA 3L43A 4HDKA 4K03A 4N5IX 1WF6A 5DN9A 4Z4CA 3KYIB 1N2IA 4GMDA 3ZXXA 1CZHA 1VKZA 2O0HA 2Q1YA 3E5NA 1DAMA 3PT9A 5DB4A 4J9VA 1Q20A 2QLMA 2X8AA 2XQVA 4LCEA 4Q4DA 4RTLA 2Z2ZA 1XXHA 3AW9A 4BKOA 1E1KA 3PI7A 1PLJA 3GFOA 4KRXA 4CCSA 1BCRA 1ZJ6A 4CM7A 1FS6A 1V2HE 2AMFA 4EW3A 2R8ZA 4GAEA 2XECA 5TGTA 5EXTA 5L7WA 1OLUA 1IG3A 4IDPA 1PL0A 1UBNA 2XJ4A 1CY0A 5L3QB 2FN4A 2AX4A 4UEJA 3L3BA 5GGYA 4ER0A 2ZJ7A 4MIEA 4FFLA 1YS4A 2DG2A 1PW5A 2QT9A 3FZGA 5CLGA 5FUXA 4D4IA 3RRXA 5ILOA 3Q0EA 3HYNA 4GD3Q 3L6BA 2G80A 2PMKA 3BHIA 3K0KA 1JJFA 3JQFC 4OU4A 2LTAA 5IASA 4Z0NA 2WUFA 1E0JA 5T4EA 1OFIA 3LVBA 1PFUA 1F17A 2CYBA 2YWEA 3EDQA 3NFRA 1LBHA 3UJPA 4EDFA 5TGDA 2F1OA 3WWDA 3SVLA 3QLVA 4WXYB 3NHZA 4IVPA 2WUGA 1XL1A 4B47A 3V4FA 3ZWPA 3G0HA 2EFGA 2WZQA 3BDVA 1O95A 5G1PA 1GV0A 1TAUA 2A5FA 4GYWA 3Q1LA 3VV2A 5TLSA 3L49A 1TJ4A 2Z95A 1II8B 3DVSX 3OF3A 3IL2A 4AJOA 4RZ2A 1MX5A 1Y3HA 2SKDA 4WK6A 4FGLA 5E6UA 4GMKA 1U9ZA 1LLUA 2DOKA 5CZDB 2XHZA 4FKMA 4HD8A 5ECWA 2NXCA 2V4MA 1G8YA 3C43A 3RODA 1AVTA 4E5SA 3KUKA 1KAMA 1V1RA 2QMZA 2G5CA 3LYHA 5FPKA 2EJCA 3HVIA 2PUCA 3CUEF 3OZSA 4GYYA 4IICA 5LXTF 2P75A 2OXIA 3G9TA 2FHSC 2RGEA 1R5JA 3IDAA 4U2BA 4ANFA 1BDMA 1BO6A 2P2YA 1GYPA 2PH7A 3V5NA 2HZ7A 3BK2A 2JBAA 4HJRA 3EQZA 1RHUA 1E3DA 3F2VA 4II2A 4P7GA 1UK7A 5DK4A 3HJAA 4C21A 2QRHA 3NUGA 4QEZA 2R8PA 5C9ZA 1O54A 1M8JA 2V9ZA 1XJWA 2VTVA 1MC5A 3CCFA 3PNVA 4PHTA 3S2IA 4H7IA 1LBIA 1PR6A 4BB6A 1N34B 5A9SA 1BX0A 2QX9A 4TPKA 5F2EA 1SUDA 1D2EA 1G8MA 1G8JA 1VQPP 2JEOA 4MDHA 4Y9DA 4DNOA 1E6LA 4MR9A 3S2FA 1YE5A 3VI4B 3CD6P 5ALUA 3GRZA 4B3RB 3CZRA 3UJ8A 1S02A 1U80A 3VNQA 2VSYA 1S2DA 3ZH2A 2XYRA 1A7KA 3GVIA 3INYA 3MJEA 4X71A 1HE4A 3M5DA 5CDFE 1JBQA 1M6VB 1G60A 1N6NA 1VYHA 1YE3A 2IIVA 4O2BA 3VO9A 3WB0A 1R0SA 1G2OA 4G67A 1H4VB 1SAYA 1DC4A 4QFBA 2WM2A 3STVA 4D9NA 1SOUA 3LSTA 3WGYA 2GAOA 1O2DA 2J6BA 1VQNP 1GPUA 1WU8A 2AN4A 2VCYA 2A5GA 2ZTMA 3PUHA 3WFJA 3W3AH 3HFGA 1JHQA 4AURA 5ES4B 2HSDA 2N46A 4H6WA 2ZATA 4ZMRA 5DM70 1EGHA 4R83A 1C1XA 2H57A 4FOSA 4LVOA 3HB9A 5F35A 4BIMA 3FMGA 3TNFA 3UYLA 2V7XA 3H84A 2P2GA 2VBCA 2YHIB 4IJQA 2A33A 3SSNA 5FBWB 3QIAA 3EW9A 4F12A 1TYAE 5IT5A 4U0AA 1Z0JA 4NBLA 3F9RA 1ZW6A 1DJMA 1S1MA 2E4YA 3QEOA 4QJIA 3HO8A 1KAOA 3G26A 1TKCA 3H2JA 2XX3A 1C9MA 2YFHA 3O4GA 1X8KA 5G3YA 4ZDIA 1TPYA 2A0FA 4MS4B 1FS5A 2QTBA 3KV1A 1U4NA 3B78A 3CX4A 1KJIA 2ACWA 4G5YA 1DKUA 1Q1EA 2H2HA 3KT3A 5DX1A 1OXSC 3CXRA 5JATA 1QC5B 5HRUA 2Q3JA 2BISA 1MABA 1KS2A 3JPWA 3TIGA 4DDWA 4JI8B 1DBWA 1S2OA 3R5JA 4GS5A 4YMVA 1FLVA 4XSVA 3GCZA 3RRFA 3V32A 4CMJA 1F2VA 1B8OA 1U28C 5EKUA 2WD7B 1W0JA 1WOMA 1UADA 2DCUA 2C59A 1N2SA 1SN7A 2Q5EA 4Z3DA 3CZAA 3IE1A 2H2GA 2HHHB 1RC1A 5THKA 4X90A 2BFAA 4G5QA 1KI9A 4XQ9A 4CKCA 5EE1A 4EQ6B 3P9ZA 3MJRA 2RHDA 2PD3A 3F3MA 4W7IA 1S8OA 2X5XA 5HYVA 4N0PA 4EJFA 1XRPA 4X20A 2JLRA 5KREA 1A88A 1VSTA 5D3ZA 2CZGA 4DA9A 1CZOA 2Y9PB 3X0DA 1KTIA 3HCWA 2QZJA 2WDZA 5G0TA 5GIPE 1DAGA 2XMCA 1FCJA 2WDPA 3KJIA 5B53A 1PZHA 4IRMA 3WO0A 5K0FA 2W00A 3I39X 4YS6A 1RVV1 4MRSA 1UMCB 2O0LA 1XP5A 1BC5A 1I4TD 4IDQA 4DM3A 4B82A 3SKXA 1RHKA 1GO2A 4W5JA 4X24A 1KYYA 4QJBA 4X62B 2VYNA 2VDPB 1V5GA 2X77A 3I2GA 3O4FA 3Q72A 3NOOA 4HRYA 5E2BA 2VIIA 1JR6A 3GUZA 4ZAFA 3C45A 1EP3B 1AQ6A 1N6LA 3BMOA 2PQ6A 3QU5A 2X19A 1O4VA 3H8WA 3OIUA 4WL0A 4QDJA 2XBUA 1TQ2A 2FQ1A 3PPWA 1LXCA 1TQHA 1TW2A 2WMDA 1VBMA 1K66A 4WNAA 1KJ9A 1KSFX 1LDMA 3B6MA 4Q12A 4LDPA 3CXCO 3LC0A 2XOXA 4F5EA 5LLSA 5C5CA 1B0ZA 1PVDA 4LYEA 3EPRA 4TVKA 4R1UA 4KGDA 3GWGA 4GR2A 1E3LA 3GMIA 1SKBA 2L42A 3HP1A 5EJFA 3GJ6A 3HB1A 4D80A 3PA8A 2FEPA 3UWMA 5M2QA 1UC9A 2GVDC 3LLUA 2J08A 4O1HA 4BE9A 4BZXA 4TKLA 2DFTA 4CL8A 5L45A 2BMEA 2X8WA 2QRVB 1EEHA 3VV3A 3U81A 1QCDA 3KTAB 4PQRA 3S2EA 2HUPA 4WWHA 4B3IA 5LMUB 4LE1A 2JEZA 4IIEA 3CH6A 5CVDA 2H51A 3BWYA 4J7CA 4WK4B 5JZOA 1VKNA 4BBJA 4RUKA 3LVFO 5BMVB 5IUKC 2A67A 3Q7SA 2MYNA 3U4QB 4CA3A 1DPFA 1XI2A 4F5WA 1Y6QA 1MNAA 5JU6A 1NN1A 3FDZA 4YIHA 1ZKDA 2ODTX 4ZOCA 1TZCA 5FL3A 3U44B 3PNKA 4WASA 2TRSB 1N75A 2EKPA 3H5VA 5CT8A 2BGMA 5ALYA 3LDUA 2K94A 1JLRA 2A92A 1BVUA 1X13A 4N3BA 5BPHA 1POWA 3TNLA 3DBLA 3SYTA 4RGQA 5FX2A 2CJPA 3AILA 3KSDO 4A5SA 2QM3A 2ISSD 4W1QA 1SKUA 3GZJA 1WSBA 3K9BA 3M1LA 4RHYA 3UCFA 1A9QA 2LCIA 4LBVA 5KQGA 4RK5A 3GQBA 2H1FA 2QUJA 4CR8A 3PF8A 4NYIR 3G2QA 5EZYB 2HGSA 1NGSA 1P61B 2FMXA 1EVZA 2GBGA 5HKKD 3QJYA 4BFSA 2V96A 4OHRA 1PK8A 4L72A 5CW2A 2H1IA 2JLBA 2WHPA 4G09A 3UXHA 3TW0A 2ZI9A 3GNQA 1DXHA 1NVVR 2V55B 2UZAA 2PZFA 1Y1PA 1D2GA 4TVOA 1SEVA 3B38A 4OHBA 1YGPA 5KYGA 3KR9A 1DC7A 2DUUA 3TMKA 2QN8A 1M1UA 3G9XA 4QU8A 4CKBB 5IYZA 1JIQA 2WAMA 1N0HA 1J6UA 2IF0A 2WQZA 2PMWB 3AYXB 4IH4A 4MVJE 5JAMA 1JWLA 3ZXYA 2VTEA 4AAYA 4K9SA 4MSUA 1I30A 2OL4A 2ZSJA 1N1GA 1ZZGA 2B83A 2FG6C 2OFOA 2WM8A 1Q50A 3A4LA 3DBRA 2GN1A 3R75A 3OE4A 4BNXA 3K6KA 5BORA 3OKFA 1QKIA 1SQ0A 1TM2A 5BS2A 4EGQA 2AFHE 4F9EA 1IK4A 1N1MA 1XRMA 5BY2A 1E1LA 1P0PA 1ZM7A 2J9XB 4J1TC 4QBFA 1G66A 1B1CA 1TFUA 2FPUA 4D0LB 1NV8A 1ZVMA 1YVPA 4GZ6A 3R41A 2IY8A 3BCSA 1ABEA 1WG8A 4RMJA 3ZOZA 4A9AA 2QW1A 1AMUA 4BZWA 2XD4A 2A9KA 5K3SA 3GFSA 3NCTA 4Q1CA 4XWGA 3VH3A 4QM7A 1TZJA 3ZGOA 1TFRA 1IVSA 3TINA 4KNWA 4YXWD 1RAFA 2YCBA 4X1IA 4E6EA 2DWOA 4J94A 2XVMA 2R1ZA 4O3MA 1JIUA 4DKXA 2A3NA 2GZSA 1R3DA 1U2SA 3QPDA 3RWMB 5BS1A 4NBRA 5F5XA 1YKFA 1J8FA 2WA2A 3MAJA 2OCKA 3TFWA 4HWGA 4YO8A 4GR4A 5JZVA 1ZMTA 4EFNA 2CF5A 3PHHA 3D81A 4X7RA 5YASA 2XI4A 3O1LA 3LP8A 1GT91 1II9A 2ZRQA 1XZHA 4EF5A 1JEAA 5F1YA 1F2UA 1OH6A 1GGEA 3KKKA 4IIUA 1T2DA 1EKXA 4P35A 4ZKDA 4DNQA 2GAJA 1IVYA 2BUAA 2NQ2C 2AWOA 3IP8A 3VR2D 4PHGA 2XA1A 1JKFA 3FOFC 4Q05A 2X3YA 2QW8A 3OQIA 5BT9A 1V1MA 3MM4A 1DINA 2BMAA 1E6MA 1KYXA 1DX9A 3ZI4A 1TUEA 4GBJA 1T8TA 5AKXA 5ALKA 2MJLA 1UMDA 3K1ZA 2C5EA 1H2AS 3NKVA 1RPTA 2UZ3A 3D6TB 3L1IA 4N18A 5JQGF 5LLDA 4JVNA 2GCGA 1ZP6A 3QVOA 1OC4A 4JUBA 5AKJA 1OX4B 2JJMA 3JQQA 4G0YA 5JCJD 3L8MA 2TMDA 4PC6A 5FOXA 4MCHA 5DTQA 1ISFA 2YRFA 2NWQA 4HLDA 2GHRA 4OUDB 2ZRCA 4G5FA 4KEAA 5HIJA 4TRNA 1HQCA 3IUQA 1CRZA 1Q1QA 3OEYA 1VPVA 2Y92A 3NHKA 4RVHA 3UK6A 2QZSA 4DT1A 4PXYA 1ZD2P 2GYKA 1SB9A 2R6JA 4UVDA 2YMQA 3FUUA 3H9BA 2PGDA 4UHEA 4CKYA 5JNWA 2G9RA 4ZJUA 3QNWA 3QKTA 4YRAA 1Q0UA 1R6TA 4EQZA 3CZMA 4Y7DA 1XROA 4NS4A 5FBKA 3FUVA 4U3JA 4AZ0B 3OTHA 3WYEA 2HMTA 1ZMOA 3ME5A 4LJKA 5ALPA 2Y27A 3ORYA 2XDQA 3C8HA 3EWAA 4AG5A 2GZ3A 3OMLA 2HLDD 2LDXA 1U0GA 4OHOA 4AXXA 5K0GA 2BVNA 3L4SO 4KJXA 5CH5A 2LDBA 3SQMA 3HM9A 4BJ1A 1VXRA 1G42A 2G77B 4I46A 4ON9A 4C7OA 4ZO6A 4EHJA 4EITA 4DJTA 1U8ZA 2GETA 1ZJJA 1F8YA 3GELA 3NM6B 3OZ7A 1RYDA 4AN0A 1VHQA 2XDAA 3G2LA 2GCPA 4P58A 1FMCA 5TDHA 4B0PA 2WTAA 4XX1A 4OF4A 4XOUA 3MT7A 4GWKA 1QO0D 1LQ2A 4U4AA 5E3HA 4C22A 3EA4A 5JWOA 3RUAA 1RAIA 3UB4A 3GDOA 3GOQA 4TSRA 3WYFA 2OO7A 4TS3A 3QGMA 1U4OA 4OO3A 5TMBA 1N7HA 2O3RA 3DV9A 2GLXA 4FILA 3DB1A 2Z8YM 2QU8A 3SLGA 1T4MA 3B1KA 5KTSA 1M73E 2FWRA 1JBEA 1T6ZA 1IBMB 3EK2A 3OE5A 2J0VA 4GX0A 4KV7A 1Q83A 3L46A 3C3KA 5FFNA 3TMAA 1XDGA 2F3RA 3F1LA 3LY7A 1PS0A 4ZYZA 3IAXA 4L16A 3NUZA 4QQRA 2ZYVX 4HVCA 1PL6A 1M9NA 2X0IA 4M9RA 5FBLB 4W5HA 2HIMA 1YR6A 4MQBA 1QFMA 3ZEAA 4OHYA 3R3SA 1CVRA 4C3ZA 4OXKA 4OQEA 1NN3A 1SKQA 2LXNA 2XZPA 3RKSA 3DXYA 1XL0A 1UK9A 4AP9A 2FMIA 3PDUA 4YFVA 1YU9A 2X13A 5DT2A 1Z2NX 3N86A 1AKWA 1OFGA 1J0EA 2ZIVB 5F12A 4Z7QB 5H02A 5CVCA 1JR2A 4TYPA 3FPFA 4DN6A 2GCIA 4LK2A 5K6RA 1WTCA 1L0BA 2G8LA 3ZE6A 5JCOC 4NEOA 2WVHA 4QA9A 5DYTA 2EJTA 2QTHA 4NPAA 3HQ4O 2J9GA 3L7AA 3PPIA 3R7BA 4B6QA 4U0BA 2ZIFA 4GGMX 4EB3A 1UKVY 2ZSAA 3NAGA 2QD5A 3FVTA 4V3BA 2FMTA 4NV3A 3PGJA 1S89A 2WW8A 1ACJA 1KC8Q 5K4AA 2PENA 1YZFA 5JZSA 4D8YA 4ETIA 4JSYA 1NBEA 1PR0A 4LDRA 5DCYA 3PNOA 1U7HA 3BERA 1TCCA 2O1SA 4J8PA 4EAAA 2HFKA 4OYLA 1QP8A 5IK2D 3N2KA 1XDZA 1LRJA 4Z6KA 2ZWIA 1UT8A 2P2CA 5EE0A 1EJ0A 3BHNA 3OA0A 2HU5A 1VP9A 4R2XA 3CX7A 3I05A 2FSUA 1K6MA 4KK3A 4YDSA 4N0DA 2FQ0A 1FDVA 2PGJA 4C9BA 4DVGA 3OOSA 1GNSA 3SNKA 5IKMA 5JYDA 2DH6A 2QN1A 2QUBA 2YZ7A 4LYHA 5CM2Z 2IE0A 1R4MA 3SC6A 1V43A 1VCHA 4A8JA 1N78A 3A3KA 5HK8A 5K5EA 3GN2A 1R0RE 5ELXA 3A1UA 2AUTA 1UJZA 1UBSB 2C9CA 1DKLA 3N2GA 1NYLA 4BUCA 3MWDA 2HH9A 3DDSA 3OP4A 3LQ1A 4CW7A 2B8JA 1X8XA 1T8YA 3PRYA 3USES 4L02A 4WD3A 2XZOA 4LSZA 4K1LA 3GP8A 4AP5A 1CTQA 1YIDA 3IOEA 4Y6QA 2JBWA 2PDAA 2JA2A 4QPZA 1IBLB 1FMTA 2UYQA 4KE6A 5FKJA 5LOVA 3B9PA 4H7KA 4PRLA 3W4IA 2GCNA 1PFKA 2HRZA 2Y05A 4GO1A 1Z6YA 4MH0R 5J5AA 5JCXA 1KJNA 3RW9A 1IWBB 3IT2A 4DCNA 3E84A 2P8SA 3G0GA 3H19A 4MEAA 4RENA 5ESDA 1NURA 4ZCPA 3BQNB 3IEIA 3IBCA 4IO1A 7YASA 5AI4A 1T1RA 4H9GA 3SF0A 4DIKA 2BBWA 1FXSA 3ZCRA 4RJLA 4N6OA 2B36A 2G1KA 2O3UA 4N7JA 4RZIA 3TOSA 3F7OA 1WV1A 4GPBA 2WBLC 3SQDA 4FWTA 1S96A 4HNQA 1WVIA 4N6NA 3FVQA 1YSCA 3QVXA 3OPXA 4LOJA 3PGXA 5CXSA 1JUDA 1QQTA 1BS2A 3OX1A 1M33A 4A5OA 4YUWA 1BQ3A 1XB2A 2Q3HA 5AQ1A 2PAAA 2ZKIA 4IOKA 3GDWA 5AM1A 4HNAA 1ESMA 4Q3BA 1NBIA 1BZYA 3TOVA 1K7CA 4PHCA 4EA8A 5KMGA 3DEIA 4WACA 1H2YA 4G0ZA 3WGNA 4NH0A 1YZKA 4QGFA 2ZJ5A 3E0QA 3I4FA 5ALZA 4RTKA 2OARA 3FHJA 1NL3A 3HWWA 2GVNA 3WWOA 2I0FA 5JAIA 1N2GA 1SOVA 2EFHB 3KHTA 4L85A 3WJ2A 2JAZA 1YRLA 1GZDA 4ZYTA 5J47A 3TTUA 4Z8YA 3VM6A 2JGNA 2P1RA 1ADFA 1GTRA 5DCKA 1XOIA 2WJGA 2YC4C 4H6VA 1Z88A 4ZXFA 1HDEA 2IHVA 2QN9A 1HETA 1ZD9A 3CF6R 4RVNA 1ZSYA 3CWZA 3KUUA 3BFXA 4CKWB 1Y33E 2KJQA 1E0DA 3VR6A 3OQHA 3X1MA 1YQDA 4F3TA 2PS0A 4ZJPA 2FSVA 4Q5IA 4DREA 2VCEA 2ZIWB 3ZW9A 3OF2A 3IT0A 1W76A 1L8XA 3K30A 1PRYA 1ST2A 4LXHA 1JQKA 5A9RA 3IJPA 1EFHA 3EIQA 4DV2B 1B0PA 5BSTA 1U31A 4YRTA 1EZZA 4LRSB 2GJKA 3SEFA 3GZLA 3C2QA 3ZDFA 2X2PA 2JB0A 1VFPA 2GVZC 3M5WA 1ODJA 3D6UA 5F7OA 1R74A 3UWDA 1G3MA 1PWZA 3M6LA 4FXPA 4JBLA 3AIIA 4O1IA 2CVHA 4Q4LA 1OU0A 1QF9A 1J90A 4MVJD 4NDAA 4WVFA 4DV0B 3VR5H 4LGYA 2Z45A 3OO1A 3FWPA 3IV7A 4E70A 4CIDA 3FPBA 1HE5A 1HEYA 4J7AA 5G2OA 3WK5A 1GA1A 1L5RA 2JJ1A 1YRQA 1TO2E 1T3GA 2C20A 2WUWE 3D5TA 3NHUA 3W6PA 3OLVA 1GZ5A 4GW3A 1AURA 1I7NA 2ONJA 2NYRA 3C6BA 3K9FC 2AR7A 2O14A 5K2OA 3AB7A 5IP5A 4X9XA 2PCLA 5KJCA 2FB9A 3JZFA 2REQA 1F6WA 1KI2A 1T15A 1IBSA 2WNHA 4QLAA 1FTYA 4QXRA 3TKLA 4DLRA 4ARCA 2GM5A 3G13A 2Z0MA 1GXHA 2YICA 2ZQ5A 4FQ8A 2I7TA 2ZT5A 4CV2A 3W5BA 3ETCA 1U98A 3I6MA 3K5IA 3D4IA 4OP1A 2IXDA 2VHEA 2UKDA 4RSMA 3BGWA 3RVOA 5JVDA 4BFWA 3RG2A 1RS0A 4FINA 1IN6A 4P5DA 5THXA 2H00A 3LPLA 121PA 3GJNA 3FCXA 1ZOSA 3L7KA 2JGDA 5LLTA 3DPSA 3IUSA 1U3DA 2J3LA 4PAMA 3TO5A 2BELA 4H0CA 4F4UA 3C4VA 2PJZA 2J87A 1U90A 1C14A 2C82A 1EJ6A 1KBOA 3PC4A 4NFYA 2G67A 3KVRA 3QZUA 5DGHA 5H3HA 4EUEA 3DAHA 4U0FA 5EA2A 3ET5A 2IU4A 2ZDGA 1J2YA 1XZIA 1BXRB 1ORRA 1JE1A 1ZMRA 3KJGA 3LRYA 1OGIA 2EBUA 1PX0A 4Y2HA 5HILA 1XXLA 1FVOA 1Z5PA 2HBRA 2W48A 3IIJA 2QRZA 2YZGA 3RTAA 3PSHA 3K96A 2DE0X 2IYXA 3E9RA 5DTRA 5FTNA 4EHAA 1MB0A 5DYNA 3BXHA 4A2WA 5KTMA 1Y98A 2BFEA 1UIRA 2YFQA 3U7QB 4DQDA 2XAAA 4DDKA 3QXXA 5KYYA 2INGX 4J7UA 4Q0MA 2W4MA 5ADHA 4M7PA 1YRYE 5KSZA 3V97A 2LBPA 3DBHA 4O4LF 2WWFA 3Q3JB 2DY0A 3ZCPA 4BNDB 4TL6A 1L7DA 5FWYA 3WNZA 1OYWA 4X94A 3O82A 1GD1O 4YJGA 1QHSA 3WWPA 4X60A 3ZGXA 2F6RA 1UOEA 4WZBB 4LYYA 3EIUA 1M8GA 2P9TA 3R7FA 3INTA 1C2YA 3T1OA 1DOHA 5J43A 4TUYA 1YCHA 2NAFA 1X19A 2VYQA 4L08A 2K7FA 2CUZA 1D2HA 4MW9A 3T5BA 1ABBA 4J0QA 3ZDCA 1RZUA 2QM7A 3FBWA 4OFXA 4HUTA 4FMCF 2XYQA 2G83A 4NOLA 3S29A 5KHOC 1CZRA 3H7IA 4ZT4A 3E9MA 2JQ4A 4JL8A 3T41A 1FFCA 5IVHA 4DQXA 1S3GA 2PY6A 2WKPA 3CISA 3OZCA 2YZ2A 5FI1B 4YP6A 1EFCA 3WOVA 4K5QA 2XVYA 5H70A 2HW8A 3OA2A 1Q11A 3SHVA 2BMWA 4EYQA 3E58A 4C0SA 1YZLA 3AYZB 5CEFA 2QE7D 1H85A 3G89A 5IMSA 3G2MA 4YJ3A 3DLTA 3SJAA 4A03A 1AX9A 1F6DA 4D92A 3H13A 1TT7A 5EMMA 4E88A 2HZBA 4ZYWA 3IVXA 2N3ZA 2C07A 5AKIA 1RP1A 3N05A 3AY7A 3L7NA 4P8RA 4XWWA 1QTIA 3L1JA 1QFJA 3NV9A 3KQOA 1UQRA 3EIHA 5HGLA 1DC3A 1RKXA 2BP7A 2WVGA 2ZU0C 4REOA 5AOCA 4A92A 2VRCD 4DYVA 1K9MQ 1ECBA 2N5HA 1QAQA 4EZIA 2O59A 2KG9A 3OAAD 4C5BA 3GGCA 2FGKA 2NO1A 4UNSA 1XD8A 3CKMA 2F3PA 3DUFB 4IW3B 4N40A 3DOJA 4X8HA 5EERA 2PBZA 4O4JA 2V6GA 4C0KA 5BN3B 3A37A 2C4KA 3GG2A 4JUFA 4G07A 4S05A 4Q93A 1RHRA 2X0KA 3PDHA 4DTIA 1BEEA 1ZD4A 2Y9MB 3E9EA 4ABTA 2OXRA 4ZN6A 4CETA 1XCGB 4UCXA 5KSYA 1P19A 2KOQA 1NP7A 2OXTA 1P0QA 2DQZA 2O9JA 3B1JA 5FOSA 4EI7A 1UKCA 1EQAA 3S68A 1T29A 3K7EA 1QXSA 3TJMA 4DM4A 1RFGE 1RXIA 1IUOA 1P1JA 1SQFA 3IP7A 4MV7A 4PSKA 2IV2X 4CMGA 2X7HA 4F93B 1Z75A 1VL8A 3DULA 2PGLA 1ZNZA 3IVCA 2H4FA 4M0PA 4DLWA 4Q21A 3V8QA 2QSJA 3T7EA 2Q5CA 3C3AA 4WHMA 3M3HA 3MBOA 5EJ9A 1EGQA 4K2HA 4BMDA 2HK6A 1V96A 4E2YA 1AHPA 1GXSB 1E5DA 2RB5A 2GHIA 5AJVB 1WW8A 2W5UA 5CVVA 1M5TA 5EMKA 5I8ZA 2MSKA 2I8LA 1NAHA 4MJ3A 3ZLVA 4P3YA 1T8KA 1LTQA 5CTAA 4B6SA 4CMCA 1IZ8A 5U9CA 1Z25A 3AVUA 1M2OA 4UNIA 3C5EA 1SCJA 3OZGA 2FPKA 4AFNA 4ND8B 5C51B 2FW9A 1J2UA 1E92A 3AESA 3WLQA 3VZPA 3AFMA 5HS4A 2YKGA 4NOMA 7CEIA 1JXOA 4KDRA 3WXBA 1N1EA 1K6XA 2I65A 2TYSB 2B4AA 4GPIB 3KQWA 2QQ0A 4GUAA 4FUQA 4O2BF 3OQOA 1HYEA 1UEIA 5AJTA 3G1UA 3ZHXA 3R7LA 4C3OB 5J2UB 1N5LA 3ZJ5A 4TMVA 2R48A 3EZ7A 1Y7PA 4P38A 1JEDA 4YRMA 4IKOA 2C9BA 1XZFA 3MT0A 4B73A 3PVSA 3WIOA 2R7MA 3KKQA 4FVTA 1H1LB 5INTA 5GJBA 1XWWA 4NVRA 1N2XA 1I1OA 3C5VA 3DLBA 2GNOA 4O8CA 1UINA 4HAIA 5EJ6A 4W9RA 3K0FA 2YUTA 5ALFA 5T8KC 1DEAA 4HQLA 1QHGA 3OZAA 4RPCA 1J2TA 5DXAA 5DX8A 4ZEOA 4NL4H 3WIBA 3U19A 2VOJA 4MULA 5I9SA 3RASA 4EPYA 1DOZA 2IYTA 3ZNPA 3PC3A 5AW2A 5JI3E 3A3NA 1MPTA 1U8XX 5DTMA 2VG8A 4MUEA 4NBUA 2OCLA 2QZZA 2W70A 5HV8A 1EM8B 4ALMA 1T0JB 2OLKA 4NICA 1BEZA 2WG1A 1G20E 3MWYW 5FQNA 2O48X 3WGMA 3OIGA 1Q7RA 2QJOA 3D0RA 1DMSA 1TOAA 4F4FA 3VMFA 2EBWA 1FDRA 4ZDWA 4FCTA 5LQJA 2C98A 4BMYA 2AE2A 3OMXA 1OHHD 1V47A 1U7UA 1PBTA 2Y67A 4JD5A 4HLCA 4Q6BA 5CFRA 4DV3B 5KIAA 1JKXA 1L9XA 2B1GA 3N8NA 5CLJA 4IIJA 2QA5A 3OE7A 4G9BA 1W5AA 1ENPA 4UM8B 1RM4A 3MXTA 4ZI7A 4JY7A 3KJHA 4MMYB 1NY6A 1VECA 4NU6A 4HUQA 5DHTA 2R11A 3K16A 3K1AB 1CR0A 1WR8A 1Z4LA 3FPGA 1O3YA 1MFZA 1W581 3H1FA 4RTJA 5KTYA 1O87A 4RF2A 3VH1A 1PEDA 1OFUA 4H4CA 2QX4A 5BOVA 2BKEA 3SK0A 5TXGA 1R8XA 2DPLA 3CWQA 3L7YA 4NZOA 3CMAP 2I6TA 3OFSA 4I6GA 3T1QA 3ML1A 4WCFB 1GAEO 4QOEA 3UHPA 3ZXSA 5KNCA 3KZCA 3EXG1 3STWA 3DKVA 4RTSA 1M75A 2P65A 2H59A 3I9JA 5KP6B 2QEXP 2ZPTX 4HRXA 5LZ8A 3RU2A 3TL3A 3U62A 5EJMA 4EMBA 5DI9A 2RGRA 3WA7A 2GZHA 5F64A 3BIWA 4P3PA 3IB3A 3W8EA 4UQLA 1OBCA 1T2EA 3ZE1B 5C8YB 1P4AA 4WESB 2W8BB 3WNQA 4KGZA 3NM5A 3HY4A 2IDMA 1RRVA 2QAGB 3OTIA 4GXQA 4ML3A 3W9YA 4HVAA 3ADCA 3TCNA 3RS7A 4ZANA 3WVNA 4CQLA 3DWEX 4OFWA 2G1PA 2Q0XA 3G71P 2OHGA 3BYZA 4NCBA 4B7XA 1JAYA 4FNGA 4QXMA 2OZLB 3D1LA 4BAUA 1HDIA 2EATA 2Z43A 3VO1A 1QU3A 3LHFA 4XYEA 3A6EA 3LUPA 1HE8B 4JS0A 1HKUA 2EJBA 2ZTSA