2EFJA

The structure of 1,7 dimethylxanthine methyltransferase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
377
structure length
348
Chain Sequence
LQEVLHMNGTSYAKNSSYNLFLIRVKPVLEQCIQELLRANLPNINKCFKVGDLGCASGPNTFSTVRDIVQSIDKVPTIQIFLNDLFQNDFNSVFKLLPSFYRNLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLHWLSQVPSGISVNKGCIYSSKASRPPIQKAYLDQFTKDFTTFLRIHSEELISRGRMLLTFICKEDEFDHPNSMDLLEMSINDLVIEGHLEEEKLDSFNVPIYAPSTEEVKRIVEEEGSFEILYLETFNAPYDAGFSISPVSCDEHARAAHVASVVRSIYEPILASHFGEAILPDLSHRIAKNAAKVLRSGKGFYDSVIISLAKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of two N-methyltransferases from the caffeine biosynthetic pathway
pubmed doi rcsb
source organism Coffea canephora
molecule tags Transferase
molecule keywords 3,7-dimethylxanthine methyltransferase
total genus 129
structure length 348
sequence length 377
ec nomenclature ec 2.1.1.160: Caffeine synthase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.270 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2efjA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2efjA02
1JQ3A 3R6TA 4ER6A 3B3FA 3JWHA 5EHIA 4QDKA 3WSTA 2IP2A 1R18A 3O7WA 2NXNA 2VZ9A 3BZBA 3BWBA 1JSXA 1TW2A 3QOXA 5G02A 5LQNA 3LDGA 3LGAA 3C3PA 5EIWA 1FBNA 4OQEA 2IDKA 3DTNA 2EJUA 1G38A 2BM8A 1KP9A 5DLYA 1SVUA 4PYMA 5CCXA 1FPQA 2IPXA 3REOA 3GRZA 2CMHA 5E8JA 1G6Q1 2CL5A 1L3IA 5FUBA 5CUQA 4EMSA 2ZTHA 4CKBA 4EKGA 2G71A 4FT2A 5LQJA 1SUIA 3CGGA 3UA3A 4GC5A 3EVCA 3A4TA 4KWCA 3D2LA 1NV9A 3CKKA 3P2EA 4P58A 4RTRA 3EEOA 5EG5A 1X1CA 3THRA 5F2KA 4X63A 5HIKA 1BHJA 5HILA 4C07A 1G8AA 3DULA 3GXOA 1NW7A 2H1RA 2PY6A 5JR3A 3O31A 3P9IA 2VDUE 2VP3A 3OCJA 2CWWA 1NT2A 2ZBRA 5LQAA 2GH1A 4E32A 3HA3A 3LL7A 2FCAA 4RTSA 7MHTA 2QRVB 2Z6AA 3KQQA 2AN4A 2ERCA 2C7OA 1R00A 1XDZA 4BLVA 2PX8A 2FYTA 3P9NA 2GS9A 3BGIA 5CVJA 2N47A 5LQKA 4MHTA 3P97A 1XJ5A 4WXHA 1BC5A 3FTEA 4CKEA 2O05A 4RX1A 3TFWA 5HZMA 1HNNA 3GRVA 1L9KA 2AOTA 5E8RA 3DR5A 3DMFA 2P1DA 3EGVA 2P8JA 3ELUA 3P8ZA 3V97A 3SSMA 2ZIFA 3BUSA 2PLWA 4P7JA 4E70A 4RTJA 2ONZA 3KPVA 4HGYA 2Y1XA 1QAQA 4V0RA 4RVGA 1QZZA 4DQ0A 2UZ4A 5GOZA 1JG4A 3TPZA 3KR1A 1YZHA 5T64A 4C05A 3UJDA 4EKIA 4X60A 4MWZA 4DZRA 3NJRA 2B3TA 3OPNA 4OBXA 2IGTA 5DTMA 3A7EA 3I5UA 4C06A 2YXLA 2ZIGA 1EIZA 3UA4A 1L1EA 4CTKA 3ELWA 5EEHA 5E9QA 1O54A 2XYRA 1FP1D 3I53A 5EKUA 3E05A 1ORHA 1AF7A 2ZBPA 4LECA 4DM3A 3NVKI 2O06A 3EGEA 3G2QA 3RW9A 3KHKA 4PYLA 5D1HA 4RVHA 4CXMA 3NWBA 1HMYA 4GF5A 4XUDA 5FHRA 4GBED 5HIMA 5K09A 3I64A 4M37A 4PYNA 1V39A 5DPMA 5EOVA 3GRRA 1VIDA 5HFJA 1RI3A 3FUWA 2ONYA 3PX3A 3M6VA 5DTRA 3E8SA 2ZBQA 1T43A 1MJFA 1Y8CA 1EJ0A 4HSGA 1DL5A 3TRKA 3FPEA 3F4KA 3U81A 2IH4A 2PJDA 2PGXA 3DLIA 3QOWA 4EQZA 1AQJA 2HTEA 5CIYA 2OYRA 1YB2A 2PT9A 2Y1WA 3G88A 4RWZA 4QQNA 3KU1A 1B42A 5FWAA 3HTXA 3ERCA 2P40A 4IV8A 1VBFA 1TPYA 1JQDA 3ER9A 1H1DA 1ZQ9A 1P91A 2QE6A 3GU3A 2P7HA 1RJEA 4G56A 3HVHA 2B9EA 4E2YA 1NV8A 5MHTA 2P3LA 3SX0A 4PIPA 3A25A 3Q87B 4PWYA 2PXAA 3G2PA 2LD4A 4ER5A 1WY7A 2E5WA 1VE3A 2GA9A 2NXJA 1SQGA 1M0EA 3AWIA 3NVMB 5C0OE 3A27A 3GWZA 2AOUB 2VDWA 2OXTA 5EMMA 1XTPA 3MGGA 3BXOA 2G1PA 1G55A 4DMGA 1QAOA 1QANA 4RYLA 4M36A 5EMJA 4P7FA 3KKZA 3GDHA 1X1DA 4AX8A 4BLUA 4BP1A 2AN3A 3M4XA 4HH4A 1P1CA 4IKPA 5CM2Z 3A7DA 3G8BA 1IY9A 1BOOA 1I9GA 5LR6A 5GM1A 1R74A 5K0NA 2OB2A 1QYRA 3V8VA 2EJTA 5EEGA 3HCDA 5GWXA 2G8NA 3SSNA 1XDUA 1RJFA 2OB1A 3A26A 3FPGA 4KDRA 1N7IA 4F84A 2A14A 3FRHA 3G7UA 4QVKA 2WK1A 1XCLA 2XYQA 4X41A 2YX1A 2C7RA 4ER0A 4P7KA 3LSTA 2B25A 3DLCA 5DWQA 5DX0A 2P35A 3JWJA 3OFKA 3P71T 3OZTA 2YXEA 4M38A 1RI2A 3FPFA 5EKXA 5EMKA 4YUWA 3HCEA 2I9KA 3FTCA 3ME5A 1FJXA 1KYZA 2AS0A 4PIMA 5ICCA 4LWOA 3TKAA 3EVEA 5LQRA 3T7SA 3BWYA 3VC2A 2I6GA 1MHTA 3PS9A 4CWAA 5FA5A 4YUVA 5BP7A 5DM0A 1G8SA 2YR0A 3FUVA 3O4FA 3MB5A 5ICEA 1N7JA 3HEMA 2CMGA 1M6EX 1WS6A 2PXCA 3DOUA 2IFTA 3LCUA 5D1NA 3MCZA 3C3YA 3SGLA 3HA5A 3UFBA 2Z6QA 2BH2A 1ORIA 4RSRA 1VP3A 3IV6A 4XUEA 3UJCA 4ISCA 3DH0A 5FQOA 4HG2A 3G89A 2P7IA 1SG9A 3GO4A 2PX4A 3DXYA 3BGVA 3PX2A 4RTPA 3ER8A 3NWEA 1UIRA 3I9FA 4OBWA 3THSA 4MQ4A 2ZWAA 4RVDA 3HVIA 3KPUA 4R6XA 5FADA 5U4XA 3TR6A 2P41A 1RI4A 5CVVA 5BW5A 2PVCA 1VPTA 1EJ6A 3NTVA 3P9CA 3KQMA 5K01A 1VL5A 1VP9A 4JXJA 5DT2A 3DXXA 1XVAA 4PYOA 4V0QA 2P3QA 5DX1A 3MERA 3G2OA 2PWYA 3ANXA 2BR3A 3BT7A 2B2CA 2GAFA 5FA8A 4HTFA 5FTWA 4ER3A 4GOND 5T67A 1FP2A 4C04A 1NE2A 4IWNA 2ZZMA 4C08A 1WZNA 3FUTA 4FP9A 4A6DA 3BKWA 3AXTA 4QVGA 4BY9E 2PKWA 2BR5A 2I62A 3EMDA 2AN5A 3R24A 4PYJA 2FRXA 2IH5A 1RJGA 1SUSA 1XXLA 1QAMA 3I58A 4ER7A 3VSEA 4OX9Y 3OE5A 3B3GA 3Q7EA 3G2MA 2P3OA 3L8DA 5EC8A 5K0LA 5K0FA 5DSTA 5LQCA 3TKYA 5LQUA 3B89A 3FYDA 1KIAA 2PV0A 3PVCA 4HTFB 5K8VA 4AUKA 3OU2A 2I7CA 2OKCA 4WVLA 5E1MA 4RV9A 4MTLA 5HIJA 1G60A 3LCCA 4U7TB 2EFJA 3OU6A 4KW7A 4PYQA 2JHCA 3OFJA 2Z6UA 3DP7A 1NW5A 3AJDA 4PONA 4E2XA 1AV6A 4AZSA 5E9JA 4EVIA 1JR4A 3UJ9A 4PGGA 2EG5A 3SR4A 3MQ2A 2G70A 3DUWA 4P7GA 5DM2A 4YMGA 5CVUA 5EHGA 3P2KA 1KPIA 5HIIA 1YFJA 1D2HA 2YTZA 3B7PA 3LDUA 4NECA 4DF3A 1WG8A 4DCGA 4OA5A 5FHQA 3EGIA 3LKDA 4QPNA 3SVZA 1X19A 2ZSUA 1L3BA 3HM2A 3PB3A 5ERGB 4Y2HA 4RTLA 3T7RA 3M33A 3PTAA 2NYUA 3C6KA 4GQBA 4X61A 1KPHA 2H11A 2NP6A 4GC9A 3KR9A 5DRYA 3ID6C 3RIEA 1INLA 2AR0A 3BWMA 5BXYA 1O9HA 2EX4A 3PFGA 3PT9A 4EK9A 3JWIA 2AOVA 5BW4A 5DTQA 2DULA 3KQWA 1N2XA 3TLJA 3P2IA 3FTFA 2XYVA 3VC1A 1F38A 1P39A 1TW3A 2ZFUA 3OE4A 4OA8A 1JTFA 3KQOA 3ELDA 3TMAA 4RTOA 3R9XB 1P1BA 2K4MA 3AY0A 3FRIA 3FYCA 3GJYA 4GOOD 4QQKA 5EQJB 5EZQA 5K03A 2C7QA 4KIGA 1JG1A 1WXWA 3UJ8A 4ATNA 4Z2YA 2YUIA 1ZKDA 3B3JA 3KQTA 4E33A 2JG3A 2JJQA 3EVGA 8MHTA 2FPOA 3QV2A 1JG3A 2PWPA 3LDFA 5E1DA 2NXCA 3K6RA 5K0GA 4E31A 4YUXA 1NW8A 1KXZA 2IDJA 2GLUA 3LECA 4E2WA 4DA4A 2HV9A 1IXKA 3KQSA 1D2GA 3MTIA 5CVDA 5E2AA 3UJ7A 4DKJA 3SM3A 1L3CA 2FHPA 2FK8A 2QRVA 2ESRA 5E1OA 2C7PA 1DUSA 3KR2A 3LBFA 2YQZA 2KW5A 3FZGA 4H0NA 4DCMA 2ZZNA 3UJ6A 4B17A 3R3HA 5KS2A 3FUXA 4Y30A 2OBFA 3TM4A 3LX6A 1X1BA 3E23A 3UJAA 2XBMA 1EAMA 3KR0A 4FSDA 1ZG3A 3HVJA 4QTTB 2AOTB 3CJRA 4LWPA 5FWDA 3UWPA 2YXDA 5E1BA 3LBYA 1WXXA 2O0LA 1KR5A 2XVMA 4QDJA 3M70A 1I4WA 4YUYA 3LHDA 1SKMA 1PJZA 4FS8A 2F8LA 3JWGA 2ZW9A 5KQSA 4RTNA 2IBTA 2R6ZA 3KQVA 4KDCA 2VS1A 3EVBA 4BP3A 2CKDA 2B78A 3GRUA 2HNKA 4AZTA 2HMYB 4RTQA 1YUBA 1ZHFA 2DPMA 4PYKA 3BGDA 1EQAA 5T6BA 2WA2A 3M6WA 3MHTA 5KVAA 3EVDA 2BR4A 2WA1A 5F2OA 3HCBA 2AVNA 3HVKA 5JUWA 3K0BA 3C6MA 4QPPA 3TOSA 4GEKA 4CKCA 3OZRA 5C1IA 1DCTA 2AVDA 3PLAE 2ORED 3CJQA 4RVFA 3CJTA 4PYIA 3FPHA 3EVAA 1XCJA 1KPGA 3EEYA 5K0CA 2IBSA 3BKXA 4M7RA 3NMUF 5CD1A 4PCLA 3P9KA 2V7EA 5DM1A 5DSXA 4FT4A 2QM3A 3B5IA 2O07A 1U2ZA 2ZLBA 3DMGA 3DXZA 4HRAA 3UZUA 2H00A 1JG2A 4YUZA 5DM4A 3R0QA 3G5LA 4FSXA 4GOMD 2NNWB 4OQDA 4X1OA 1ZGAA 2BM9A 3CVOA 3HCFA 1I1NA 1JSZA 2PX5A 3VYWA 2R3SA 1R8XA 3EVZA 5IH3A 3CC8A 3EPPA 2PXXA 1OR8A 2JH9A 4RTKA 2QYOA 4GOLD 2NXEA 3NDJA 5K05A 3PFHA 3S68A 4R8SA 5DRTA 1BKYA 3HCCA 1M6YA 5GINE 4HGZA 5B1SA 2UYCA 1VLMA 1XDSA 2GPYA 2ZULA 4BLWA 3LKZA 2YVLA 3G5TA 1NKVA 3NDIA 4LG1A 3HA7A 4ZTBA 5FQNA 4F85A 3KPJA 4PNEA 4XCXA 1VQ1A 2AOUA 4FR0A 3KPWA 2JHPA 2Q41A 4KRGA 5EMLA 5H02A 4L7VA 3IEIA 1KHHA 2IIPA 3T7TA 5GIOE 5LSAA 1NBIA 2O57A 2ZIEA 3DMHA 4R8RA 3SXJA 2AZTA 4R05A 4FGZA 4MIKA 4POOA 1YF3A 5DXAA 1RI5A 1X1AA 2AOXA 5KYGA 2UYHA 9MHTA 2ZZKA 1Q0SA 3OU7A 1UFKA 2V74B 1Q0TA 5GIPE 4GUAA 5GM2A 2IH2A 3NW9A 2BZGA 4C03A 5HEKA 4XUCA 5ICGA 3ELYA 3OZSA 5E2BA 2HWKA 4YV1A 3HNRA 1NW6A 5FCDA 3X0DA 3H2BA 2OPBA 5GP1A 1RI1A 1JTEA 3KPYA 4AZWA 3HCAA 5HOQA 2OO3A 1KYWA 3UBTA 3SMQA 2PSSA 5DX8A 4IV0A 2AOWA 5EIFA 4YV2A 5P8WA 5C9ZA 5IKMA 3SSOA 2NP7A 1YZ3A 2G72A 1AQIA 3CBGA 4PINA 4AZVA 1F3LA 5DXJA 3M6UA 1R8YA 4R6WA 5M5BA 2HR1A 5F2NA 5FULA 4UOEA 2PX2A 4C4AA 1IM8A 3MAGA 3FUUA 2OY0A 1YFLA 1NBHA 2VDVE 1D2CA 4YV0A 1UWVA 3EVFA 3G8AA 10MHA 3BWCA 3IHTA 4FZVA 2ZWVA 3GGDA 3MCTA 1R6AA 1JQEA 5EZSA 2PBFA 3RODA 2JHAA 4A6EA 4KIFA 3EMBA 4CTJA 5EPEA 5KQRA 4E2ZA 2UYOA 3GCZA 3KQPA 2FK7A 4RTMA 1SQFA 1NW3A 2QY6A 3CCFA 5EGSA 5ICFA 2PT6A 3MTEA 3GNLA 4F86A 3GIWA 3AXSA 5E9WA 4KVZA 4K6MA 4E30A 2ZCJA 4O29A 3FTDA 3UJBA 4U7PB 1ZGJA 3GRYA 3LPMA 3E7PA 4HC4A 1Z3CA 3T0IA 5EVJA 1O9GA 3LCVB 3C0KA 1EG2A 3IYLW 5CVEA 3FPJA 1RJDA 3TQSA 2JH8A 5K0JA 4PCAA 2XVAA 3HP7A 5K0BA 5CCBA 3TM5A 3KQYA 2ZVJA 4PGHA 2OZVA 2UYQA 3M6XA 4YMHA 1PRYA 4QTUB 2ADMA 3ORHA 2GB4A 5K0EA
chains in the Genus database with same CATH superfamily
4XOUA 4R9UC 5DV9A 4KLZA 1L8LA 1RDFA 2PV7A 1ZH4A 4BUJA 3NKLA 1G8MA 2GO1A 1J06A 2G17A 1SC9A 1T1JA 3AKDA 3BD7A 3L0OA 2MSDB 1XWFA 4Y2GA 3U48A 1JDSA 2XB8A 1X7GA 2PM8A 4YCAA 1WTAA 1C1HA 2A1TR 1XI2A 3WLHA 2JLSA 1X42A 3DMDA 1SKQA 3HKEB 4GXNA 3BHNA 1S3SA 2H31A 2E37A 4I1YA 2RH5A 3R9KA 4D56A 2IPXA 1OKKD 3HEBA 2AX4A 1MEEA 2I65A 3D8HA 5AW3A 1TU3A 2QAGA 2EARA 4I9FA 3VNQA 4HLQB 4RV4A 3P2EA 1M6WA 3A0RB 4PRYA 5GQSA 5LXTB 5EIXA 3I9KA 1ONSA 2Y9MB 3D4LA 3V4ZA 3ZZ0A 4LRUA 4RF4A 4L08A 5CNMA 3CNNA 2GERA 2VP3A 3HDJA 2GRJA 3KD3A 3UWOA 2D13A 4DR5B 121PA 3N2NA 4RQTA 5K6RA 1QU3A 1L2TA 4PQYA 2HLHA 2O7RA 3W3AH 1PT5A 3DLPX 4BGVA 3OBIA 1YI0A 4AF6A 2XMQA 2GZMA 4QBKA 1O03A 1Z82A 3H1FA 4U7HA 1CUVA 1RHKA 3D7RA 4MAAA 2JI8A 3ZHZA 2VP6A 3N1UA 3SE7A 1WMAA 5JZSA 3F5FA 5KJ6A 1CQIA 3CNEA 3D2AA 3F3MA 3KTDA 4TN1A 4A27A 2QTVA 3JQGA 1Z45A 5K3FB 5JH7F 2IS6A 1L9KA 1WVGA 5A4FS 2A9JA 5CG1A 2X6TA 4CEJB 1WOMA 1KI2A 2HSJA 3LRPA 3VQTA 3BUSA 3C3XA 3KJQA 1E1QD 3OFSA 4KAFA 3GNQA 3V1KA 2Y1XA 1S4MA 2ZJ2A 4DQ0A 4P3OA 2UZ4A 3RVDA 4M8NE 4MKGA 2K2QB 3ZWXA 1CUJA 2B92A 4RXTA 3UJDA 1CUAA 3TX2A 3E03A 4DUPA 2P9TA 3BMQB 4U6QA 1UBJS 2E4UA 1AQ6A 1U7OA 3AW8A 1NLYA 3AHFA 2CJWA 3MCWA 1K27A 1RCUA 2H4HA 4TSKA 4DPLA 1E7QA 4DDWA 3H9GA 3UPTA 2ILVA 2VEOA 3NVAA 1YVPA 1TIPA 2R79A 5C3MA 1OBOA 2GZDA 3FCCA 3PEUA 2XEDA 4BLSA 4W9MC 4QBTA 2ZTUA 2GAIA 5TVGA 4OSPA 3EOAI 3ZVRA 4Z7QB 2J41A 1RI3A 1SBHA 2D3WA 3ZHTA 5E7QA 3E8SA 1QG2A 2OC4A 3FSJX 5CA0F 1J9ZA 4ZYXA 5FOQA 3G1WA 2LUOA 2DWCA 2Q2QA 4C1NA 3F4KA 3LT2A 2WB2A 5HGNA 4IXTA 1EOQA 1I4DD 3H5OA 3PG5A 5BPHA 2SHKA 2ZRCA 1XROA 3K4QA 3KU1A 1H0HA 4YHBA 3WNCA 1CNEA 4DSOA 1QU2A 5CHEA 5JXGA 3GCGA 2IHYA 4DYVA 5ITWA 5GV7A 3TVYA 5CBPB 3NAZA 1U2GA 1P75A 1E2MA 3MJTA 3BRCA 3GLIA 2BMFA 3AFOA 2RIRA 4QT4A 4G09A 3WL3A 2OO7A 5LLDA 1VFNA 2J31A 1H5UA 5IUKC 3LBAA 1M1KQ 1C7IA 1P45A 2PRSA 2DETA 1U0TA 2JJ8A 4TSFD 3H75A 2CMDA 5DDIP 3WLEA 1G16A 1RKBA 1AUXA 2P6NA 1V4NA 2BUAA 3HO8A 2PRYA 4JUAA 4PFSA 4JH0A 3H0EA 4QTXA 4ZYZA 2ID8A 5A5GA 1OI4A 3E27A 1P1FA 2AZMA 3E9QA 3QUBA 3IA2A 3H3JA 2VPYA 2REXB 3GLSA 4TQGA 2V7BA 4MB2A 5KYNA 2WWVD 1Q0UA 4RPGA 1OIVA 5CM2Z 1O9BA 1VRWA 2WZCA 2GKSA 5HJ5A 4PE5B 3ROKA 4N48A 1GPKA 2QLLA 3IQXA 3NTOA 4WSOA 4D1YA 1EFTA 1PEYA 2GJKA 5EP2A 2ZB7A 3R7AA 3VR1A 2ZRNA 3I2IA 5FR1A 4BB5A 2C31A 3FPGA 2W2LD 3GD7A 4MVCA 3OJCA 3IJRA 4BVKA 3ANLA 1GUDA 2WM3A 1RO0A 4KGXA 1P8AA 2W11A 1AZWA 1OOEA 3NBQA 4HUQA 1NPDA 1WMBA 4LHZA 4RACA 5EWMB 2JAQA 1SD5A 2FWNA 4QOIA 2WLSA 3LE8A 1D6NA 4YRKA 1JQLB 5I8ZA 4FMCB 2WE8A 4MJ3A 2UVPB 5LYJB 3KC2A 1KMIY 2J87A 2XWJI 4XKJA 3DE1X 4QOSA 3EXIA 4IUDS 5HFNA 1KGSA 4WZAB 1YBMA 1GT91 1LNQA 2G4VA 3BH0A 3EVEA 4JGGA 3GLGB 2LIWA 2JKZA 1V25A 3UFXB 1XRLA 1GRVA 1Z83A 2WF7A 1B76A 1M10A 2GESA 1XLWA 3EWNA 3MLEA 4ZQCB 5EXXA 3HEMA 2FUCA 1I3LA 3KB8A 2WQZA 1VCIA 4FXOA 4XD2A 3C3YA 4PC3A 3L6BA 2X2FA 1JWLA 3KG2A 1TQ6A 2Z8XA 1V9CA 3I5AA 1G1MA 1YIOA 3GJXC 3EPLA 1XHFA 3MFYA 3ZG6A 4D0RA 4UOQA 2R8OA 3G89A 2ZT6A 4Q0MA 3QXXA 4I6EA 1KZGB 3EB9A 4WZAE 5AH0A 1Y4SA 3NGLA 5KOIA 1H2AS 1RWBA 2WVHA 3GOHA 1XVVA 4N40A 2RKOA 1AUPA 3HRHA 1E9RA 2ZANA 2P41A 3H2KA 1ZMRA 2QW0X 4G84A 3UWDA 1VQ5P 2JGDA 3TLCA 1CFZA 4HYTA 3IP1A 1R9MA 2Q28A 1C3VA 4BJ5A 4P0PB 3A0UA 4ESEA 1XX6A 3A3NA 2QQGA 5LB4A 1NM5C 1C81A 3L0PA 1RAAA 2XOEA 3SKYA 1V3TA 3ITNA 2I7XA 2ADOA 2PWYA 1Z75A 4WASA 3HWSA 2QUBA 4KL8S 4PANA 1V6SA 2VRWA 4UKDA 4Z9BA 4KITB 4WXPA 1SCUB 1P81A 4UHKA 4AQDA 3LJKA 3KFLA 4FC6A 4LMBA 2AIRA 2B36A 5HRAA 1N6LA 2GEFA 1Z7WA 4DPMA 4W1PA 2VRCA 1C7ZA 2FAEA 3H87A 1YULA 4HF7A 2DGDA 4D3SA 4Q82A 3N0WA 1QMGA 2CBZA 2XITA 2E0IA 3R6GA 4ZOCA 5JW6A 3LUPA 1YCGA 4H2XC 1V26A 1Y9JA 3H6KA 3Q7EA 3ZDXB 4A8JA 4FLEA 3Q5GA 4CQNA 2D0DA 1M1YB 4Q12A 3DQZA 1DAIA 2NT3A 1P2GA 4ID3A 3Q7TA 5ERYA 2IIQA 2JI4A 3VHRA 4LXHA 1CVRA 1I80A 1RTKA 3AY3A 4TMKA 4B2PA 4ENVA 1GL6A 4RV9A 1QB8A 1W5EA 1SU6A 1NF3A 1BH2A 2CLDX 5AM0A 5CLJA 2WUGA 4ZQEA 1MORA 4PYQA 5AOAA 3F67A 1SZDA 4PLWA 1RQXA 1WBBA 3TEFA 3GQBB 4J0IA 1XUOA 4GXRA 4ZZ0A 3IQZA 4X00A 1KZ7B 5NULA 1A7KA 5HZKA 5MN4A 4TLDA 3UJ9A 4IIBA 4YX9A 2QZ4A 3LHKA 3F2VA 4UTVA 2XA9A 2F8TA 5ALYA 3K31A 4C4XA 3IL2A 3ZVNA 2I3DA 4CLDA 3AHIA 2RIPA 1P80A 5F4BA 3WL8A 4BEVA 5JADA 2FX3A 2WIKA 2YBEA 1UZMA 1ECPA 3H4VA 4BVJA 5KNLA 3ZLJA 3ZS8A 1DJPA 3HI6A 3KQKA 3T9BA 1I2CA 4R51A 1HY3A 1OCEA 4H1HA 2GA8A 2HA6A 2F3PA 2GJAA 2Z0MA 1QWSA 3EF3A 4EHKA 1AMNA 4IV5A 1E7RA 3IAM6 4O4HA 2HCJB 2OMKA 3F9CA 5LL6P 1XZAA 1M5UA 3V4RA 1LDEA 1HT1E 2JAUA 1RCFA 1RJWA 2WIJA 3OW2O 1RYMA 1LY1A 2O5VA 2R84A 4S24A 2V7TA 1RYFA 2ZR8A 5K51A 1DWUA 4AIIA 1HDEA 4J03A 1ECCA 3DR3A 4LRQA 3DDZX 4F9TA 4FM9A 4G6ZA 3SEZA 3AWDA 1SUDA 3KJXA 4PR3A 4MIYA 3E5MA 1M2OA 1USWA 4RTOA 3GRPA 6GPBA 2K4MA 1FXWF 1IZYA 4HVAA 1II8B 1R0WA 4GOXA 4O2BA 4QPZA 2HHAA 2R25B 2F3RA 4D0LB 3OZDA 3EVGA 3SNHA 5BSTA 2J8ZA 2Z3WA 4F4HA 2SNIE 1G21E 2UZ3A 3O3OB 1UBKS 2WBLC 3LRYA 4G63A 4DIFA 2W98A 4YUXA 1DG9A 1OQAA 2IYAA 4MUGA 3JSXA 4RVUA 4BU1A 5FL7D 1IXKA 3PK0A 1RC8A 4NTZA 4FN4A 3EY4A 3DSRA 3KAQA 1B6SA 1QQ7A 4GLOA 4KQWA 5JROA 3KR2A 4QRIA 4YT4A 5HZHA 4MUHA 2NO8A 1NPYA 2XRZA 3UIEA 5B2EA 3P20A 4ZQGA 2W70A 3NT5A 4EG8A 4HNHA 5ESXA 3ZWPA 3SEAA 4LDJA 3KELA 2O3QA 4MPPA 1QGUA 1SPXA 1HZJA 2GXUA 4LWPA 3DOJA 2X86A 1E1RA 2FG6C 3LKBA 1YQTA 2ZUCA 4BNMA 4X1KA 4IAOA 1Z4MA 4MV9A 5JARA 2Z95A 1ESNA 1IC6A 3G9TA 1NMZA 2IYXA 2X76A 3EFOA 3OLWA 2P9FA 3DOIA 3BX1A 3P9SA 3K2IA 4KVFA 1SRRA 4NENB 2BKUA 4IVRA 1Z36A 4YAJA 1N9GA 3T7KA 2VTEA 3FNGA 5I7FA 4IPYA 3BB1A 5TNXA 1UT8A 2WSIA 3OZIA 3SICE 1ZHFA 2WSSD 3WNQA 3BGDA 3MHTA 4LGVA 3SQMA 3LWZA 4PC7A 4OHZA 3U7EB 1HO3A 3GAFA 3THWA 4HDQB 5D85A 3K8QA 1FDOA 2XDQB 2OYCA 5LIRA 2P1ZA 3C16C 5EJ5A 2REQB 5HPYB 1XCJA 3WKEA 4PZCA 1U6JA 4PCLA 2IYFA 2XY4A 4E5NA 1Z5VA 3KLOA 4B4DA 4KPYA 1BVUA 2ZLBA 3RJZA 3F46A 4IQ0A 4P6VF 4E15A 2H00A 2IOFA 4CL3A 4E5MA 4EW2A 4KQMA 3DFKA 2EP8A 2R47A 4CV2A 1B1AA 5IEBA 4MZDA 5ELLA 4ENWA 4PS0A 1Z68A 1D5WA 1UM9B 2I6UA 4PEVA 2NO0A 1M7BA 1OTYA 2B2XA 1I2BA 2BFEB 1GA1A 2ODNA 3QUAA 3AHDA 4WK4B 1P74A 5DB4A 4PZZA 5C37A 4BO5A 1UP4A 2C97A 4UBIA 4MW2A 3RTAA 1Y9AA 1U2SA 3UTCA 1NKSA 1YVRA 1UBLS 1TQ8A 1ZJJA 1G8FA 3AUAA 4XQ9A 4QHYA 1UXJA 4OSEA 2IYPA 3HR7A 3SJCA 5KTRA 5J1SB 3RADC 4A6XA 4G0YA 4QHTA 3WL4A 4DQUA 3U09A 1I5OA 3TB6A 2O2CA 3QF4B 3QBJA 4K9DA 3NOOA 4N7BA 4RPIA 5IBPA 4BKQA 2V7QD 3AVUA 2PGLA 2L69A 3AETA 4BKRA 5KNBH 1LV8A 3L6EA 4U4AA 4Q7KA 3DHEA 4Z9AA 8OHMA 5GIOE 3U5ZB 2YHSA 3TR0A 3JQ9C 2B9VA 3NB0A 5DK4A 4ZOLA 1E94E 1VMIA 2AFHA 2Q5HA 3I1YA 4PN3A 4FGJA 1Q57A 4EQ6B 1QIGA 4LRYA 4FPXA 4P3PA 3PYXA 2QVCA 5A3QA 2YW2A 2FVEA 1PEDA 1YQ9A 2V74B 3K9NA 1CEQA 3K15A 2CWDA 3DDSA 3RU3A 2YJ6A 5A4DA 2BFCA 3NW9A 5DGDA 3NX4A 4GOJA 4QU9A 2JFGA 4YFVA 1SVSA 5FYDA 5K1ZA 2PEMA 1C41A 3TW8B 5TQ2A 3W5BA 4AWBA 2D62A 4BLQA 3I34X 4UM5A 1JDVA 3RFVA 3G8YA 3GRFA 4EDFA 2A7QA 1QO9A 4ZEWA 1E2NA 1QCCA 1T0JB 1XMXA 4YV2A 2Z2IA 5KC9A 5KOYA 5KHAA 4N0PA 4X5OA 3ZZMA 3JSAA 4CMHA 2OHOA 3M6UA 4LXQA 1LJUA 4BN4A 1WMEA 3KVYA 2PX2A 1I7SB 4OM7A 4XCVA 4DABA 1NLMA 3RF7A 4BUZA 2QNRA 2C5LA 2BLLA 1XB2A 1YK1A 1T8UA 3MCTA 2HSZA 4WMLA 1SD2A 2I2FA 2KYRA 4N6GA 3SDBA 3HUFA 1K86A 4TPKA 4BQIA 3PWZA 4I5DA 4LVNA 1BW9A 4BEJA 4HUTA 5KQRA 1HSZA 1KJQA 1R4MA 4FYIA 3WMFA 3MRXA 3WDSA 4DGSA 3VAYA 5CEJA 3UMCA 5JPDA 1WF6A 4KZPA 4RK1A 3A9SA 4CV1A 4FXPA 3HBMA 2ZIUB 1RXVA 2V45A 1E6LA 1WF3A 2QENA 1JQBA 5J1TB 3HGQA 3NYRA 4I6JA 1P0PA 2FPLA 3PNBA 1YR6A 4JD5A 3K2EA 4U1RA 1QKIA 3BMXA 4H7EA 3W79A 4MO2A 1G4AE 3HP7A 2EKZA 3L8MA 4EVRA 5ALMA 5C5DA 3L1KA 3KQYA 1JJIA 2OILA 2VLPA 1EGQA 3KT0A 3H2JA 5K0EA 2FMIA 1NRXA 4PSUA 4I7EA 2WTNA 3SQNA 5CB4F 1L9XA 4L5CA 1T34A 3BWBA 5IJ9B 2EHTA 4P35A 1H85A 1OJ7A 3MOIA 4FK8A 1CD5A 3HRIA 4YCMA 2IXAA 3OQMA 1DOAA 1ZC4A 3K32A 3FOZA 1Y1QA 5BW6B 4PRZA 4R69A 4PXSA 4KFRA 1T2DA 3QG1A 4AUMA 2EKQA 3KKQA 5FUBA 1H4VB 2XODA 3H99A 2J1LA 3CWQA 5B1IA 3AO0B 5C5IA 4L76A 3ZIAA 5IJAA 3RC9A 1UJ4A 4KWCA 3KLNA 1ENOA 2MMGA 1DBSA 3CKKA 3EIOA 3LUAA 4BNHA 1X14A 5EG5A 4YALA 2TSYB 4EHFA 1EHIA 1N3BA 3E81A 5F64A 4EGCB 2BGWA 2AG5A 3M4NA 2L0QA 2FUEA 3ZHUA 4ZI2A 1SCNE 2W7TA 1KTVA 2VDUE 3GFVA 2VNIA 1O95A 2AXNA 4LZPA 4G0MA 1QVAA 1B26A 4E32A 1U98A 4KH1A 1E8NA 4Q93A 4LV8B 2QRVB 3VTAA 2R1UA 5ITVA 2XJ9A 4NLLA 3B1JA 3MRVA 2JBHA 4EB6A 1DFHA 2ERCA 1RLMA 1E92A 3U3XA 3Q1KA 4UFNA 4MW0A 2N47A 4MA5A 2YJTD 1BX0A 3FVWA 3QXCA 3UJHA 2H4XA 3QBVA 2JAPA 3RRMA 1CUSA 3QI2A 4BNXA 2EW8A 3GRKA 1AMUA 1UKBA 5HZMA 1CBUA 3PFWO 3QVJA 3QYFA 4I1UA 4N8SA 3E9MA 2LMLA 2ORWA 3WLOA 3Q2OA 4IH9A 4GPTA 4M9RA 1PFQA 4WGGA 3UHOA 1JKXA 1NUHA 2WUVA 4PZPA 2ENWA 3K8OE 3GB9A 1QH9A 1JG4A 4HZGA 2K87A 4C05A 2WNHA 2WU0A 3BG5A 4JLWA 4YECA 1JALA 3Q88A 1KQOA 3PR2B 1GFSA 2OTJP 4CM6A 2VVTA 3SWWA 3SQDA 3H3FA 5JYEA 4NRDA 4PLHA 3EDOA 2V0CA 3I6BA 4RD2A 3G6KA 5G1OA 1LVGA 3KOUA 3HKDB 2OBNA 5BV0A 3EA4A 4MJXA 1T8YA 2LKIA 4KYIB 1Z33A 2ONTA 2PD3A 5KVQA 2PZFA 2JFPA 3PD1A 4EO7A 1TVCA 3KWFA 4HWKA 1KQPA 1Y5IA 3U4AA 4CXMA 4WGFA 2WJWA 4R81A 3W78A 5L3SB 1A2KC 1GR1A 4G37A 1FQJA 4HV4A 3MOSA 4FWBA 1PS8A 1N0VC 5KNDA 3HWX1 2B4AA 3NPAA 4FFOA 1KI8A 4JB8A 2V7XA 1SC6A 1QK5A 1XZPA 4D4JA 4ZFNA 1EJ0A 3E5RA 3SBDA 3WZMA 2QVXX 1JHOA 1N9ZA 1T9ZA 3TRKA 2PU7A 4J2OA 1UJNA 3Q3IA 1YZFA 4G1BA 1E6WA 1L7RA 1TMYA 2OYRA 4QUDA 1ECLA 1K6EA 2F7SA 1HURA 1XVTA 3F6BX 4KJZA 1P9RA 3PE6A 3RWOA 4DIMA 3OOWA 3FAZA 2XJ4A 2GPSA 1JE0A 2F90A 3TZKA 3IUJA 1C0IA 3WRXC 5LMCA 5JTTA 2VQEB 5H80A 4F38A 2WJ4A 4KNWA 2CV1A 1CDDA 5CNJA 3G5MA 4DWWA 5KKNB 2CSXA 3K7EA 3IOCA 4V2UA 2BHNA 4BNTA 1E62A 3K9HA 4XJSA 3G3EA 3NRCA 4OHPA 5EPOA 4QDTA 1GCIA 3BE8A 3HN7A 4J3JA 2ZAMA 3CSSA 4DA0A 4KREA 1G8GA 2FPIA 3BM5A 1SWWA 1T1EA 3A2MA 3H9UA 1F06A 4HQLA 5JFOA 3EC1A 4LDZA 2QG6A 4O4JF 2GKOA 3QKTA 1EEHA 5EHNA 3SX2A 1G59A 3FETA 1W85B 1XAGA 4LISA 2JFHA 4OQQA 3RVOA 1G55A 4CM8A 3BHIA 4HB4A 5EINA 1O6ZA 3LY5A 3D5EA 3NOQA 1W4BA 1BJKA 1PFGA 1J07A 2VJLA 3HYTA 4J49A 5K8IA 2EL9A 3IVMA 4I5EA 2IDMA 4YJFB 1N92A 1Y5NA 4BZXA 1K8ZB 4HS4A 2P68A 3M5PA 3VDRA 2JATA 3C6XA 4ZPXA 2HW8A 3IBSA 4QTZA 2IVZA 4BFZA 4I14A 1P0FA 1YR2A 4BL5A 3Q8XB 2M8LA 1CXZA 2VJBA 1NJGA 3MILA 4QVKA 5G3ZA 4A15A 1MQSA 1A9PA 1PJTA 3EJEA 2KW2A 3H6HA 4QXRA 2XYQA 5BOSB 2C2WA 2G4LA 2VSFA 4KWEA 1KJJA 4MPTA 1TUBA 2EF1A 1XQYA 5E4FA 2ZPTX 3R5JA 4IILA 1ZM4A 1PLLA 4XW2A 2IUSA 3P71T 1RADA 3W4KA 3TUZC 3QKSA 4D5GA 3RU7A 3HCEA 3ICVA 4IL5A 1OILA 4I08A 5HCIA 1OAAA 1CRWG 1UK7A 1EFVB 1WB5A 3OCUA 4LOJA 5GZ3A 3GP8A 4KOEC 1EFDN 1ESCA 1N7GA 2V3WA 4C21A 3IDOA 1H6CA 4EL0A 3C2QA 3ENWA 1ZJYA 5BQXA 1QYWA 2EGUA 1RQRA 2IYRA 2RMKA 1CEIA 2CHEA 2DR3A 3TCXB 3W5CA 3L0ZA 4IIJA 2N3ZA 4AJNA 5D1NA 3V33A 3LDHA 3MUNA 4JR2A 2RGCA 1T9GR 1E2GA 3HLTA 1PR3A 1Q92A 3OOJA 2VHJA 4RVCA 1CE8A 1T5SA 1WPRA 3NOVA 5CH3A 2V1UA 3ENKA 4LX8A 1Q20A 3WX0A 4C2TA 4NMMA 4IO1A 4P4UA 5BSMA 2Z8YM 3F3SA 1JG6A 2VLNA 2JCVA 3O1HB 3EUAA 4W7SA 3WGNA 3X1DA 3KVVA 4DRYA 2QMHA 3QLEA 3LQ4A 1N78A 4IUYA 2TMGA 1TTQB 1VHWA 3G9XA 1RI4A 5ARDA 1VPTA 2CLCX 1MD9A 1U02A 3OWXA 1PFYA 2AA3A 2CDCA 2P5YA 2FPXA 4IJVA 3RREA 1NIJA 2XAUA 5LC1A 3USES 4K1LA 3GZMA 5TB5A 4KYUA 2XR1A 4Q9LA 3ZZUA 4DA8A 4PGAA 3IUEA 3NCTA 4RDIA 5K4GA 3IAUA 3OT1B 5DBFA 4ENUA 1WKBA 3TIFA 2EYQA 4YCCA 3DJYA 1K2VN 1NL3A 1BFKA 2O7SA 4F3TA 4QDOA 4J7UA 1TMGE 3BWXA 4ZYWA 4IHJA 1D2NA 3QJ5A 4Q1EA 2O4UX 5LBIA 1W6UA 5LP6F 1GQQA 4P86A 1JVNA 1TUEA 4BBPA 2FXVA 3ZV7A 4G4SO 1CRPA 3PKJA 4A6DA 4HLUA 1KI9A 4QVGA 2WU4A 3A10A 2W37A 3K8ZA 4ECEA 2QX8A 3QE9Y 4JLMA 4N82A 2WP8J 1RJGA 1V11B 2YXBA 4OB7A 1SMKA 3WBKA 2HGZA 1O1YA 4H6VA 3H2YA 3KHSA 4ZOQI 1D8AA 2WWRA 4FQ8A 5HCNA 3B38A 2MINA 1M2NA 4H7DA 5AFSA 5LQCA 1C9JA 1EFKA 3FSEA 3IMFA 4BFLA 2AXEA 2KG8A 1HI9A 3LS2A 2QT1A 4ES6A 4MTLA 1X70A 2RGDA 1DUVG 4ZYYA 1WCWA 3PNSA 1R3UA 4B80A 4R5HA 2QAJA 2OGSA 2ETXA 3GDWA 3KOXA 4O4HB 4P84A 4TTPA 3HXTA 3LPAA 4RESA 2Y1FA 3EWAA 5K9ZA 4BXOA 1RHQA 2FADA 1EDDA 1BAPA 3SR4A 3CT6A 3L7MA 2C5GA 4MWGA 5D3KA 2QD4A 2W42A 2FOLA 4OHBA 3M4YA 2GXAA 4IX9A 4QIHA 1RVDA 2OFXA 3EIQA 3ZWQA 4BQRA 2YTZA 4B7AA 5T8KA 3AQ4A 2CE7A 1I01A 1ZICA 2B69A 1Q6ZA 3VSDA 5FHQA 3LOPA 4UATA 4CM7A 2OYSA 3WLMA 1WTCA 3SYNA 3TO5A 2ZSUA 3GDGA 4EUSA 2NUPA 1BS1A 1XBTA 4LF9B 1XRMA 2FFAA 1K7FB 3FTPA 5AVRA 1OPXA 1WHTB 2ZPAA 2CSUA 4CFSA 3M33A 1Z8NA 5HGXA 3DBOB 1FX0B 1JHDA 3O95A 2Q5EA 1XEWX 1N6RA 2C59A 1SK8A 1X1RA 3R8XA 3ZIDA 5J2UB 4HWTA 2D8AA 2OUIA 2EKPA 2MDTA 5E4YA 3EH1A 5DN6D 2QXYA 2NUTA 2OXIA 4IXNA 4MO9A 3NEPX 1BU8A 1GUFA 1G9XA 1ZNZA 1WLYA 3RV3A 1UM9A 4DDVA 4JXXA 3Q3EA 4DJTA 1HLPA 3CUKA 4F92B 4BMSA 1R8SA 1M5TA 3N74A 3HKCA 2WD8A 5F21A 5JVDA 1PKXA 2AXQA 4KLAA 3H83A 3I3SR 2G7MC 4H2DA 5F3DA 1XFAA 1X13A 2LP4Y 1RPJA 1VE1A 2ZK7A 3IEPA 2IGBA 2NWQA 2XGSA 5DT9A 3F5QA 3OX1A 4G07A 3DCYA 4L0CA 3T3HA 4EG7A 2JLWA 1JX6A 1J8QA 1DTEA 2H6EA 2Z4TA 3RDPA 3KT6A 2NZWA 2KORA 3NHPA 4BX0A 1K2WA 1ISRA 3F5SA 3I2FA 4OU4A 2G06A 3KJIA 3SDZA 2X6RA 3FSRA 3C14C 3I2HA 4HNUA 2O5EA 3R3HA 1QWOA 1U8ZA 2KPOA 3A6HA 1BMQA 3T5GA 4II7A 1HXHA 2P9BA 2YWJA 3PHGA 1HE3A 2B8NA 4FSDA 1E6CA 1U2PA 2EP5A 4QTTB 5GONA 1A72A 4ZU3A 1DWQA 2R2GA 3CJRA 1K5DA 3OQIA 1NI3A 4QGBA 4GR4A 4TS1A 2HBYA 2II6A 1U0LA 4JQZA 1T91A 2XVMA 1YIJP 3CCVP 4BC0A 1YR1A 4YCNA 2G80A 1U8CB 5E6RB 2VH1A 1V8DA 3C6BA 3UMBA 2QB5A 5JCJD 4A36A 4RPHA 2C5EA 3MCUA 3QENA 2HRBA 1EVEA 3LUKA 4MTCA 1SK9A 1YQUA 3I5MA 5LDDC 2BTEA 3IRVA 4HQNA 1BE6A 1JDUA 2FHSA 2O2EA 1NOIA 2P5TB 2VJYA 1N8RQ 2Y6UA 3B1FA 3IMEA 4L8VA 2QD1A 3F4LA 2J3JA 2NSDA 1TDJA 1CKEA 2DF8A 1OH6A 1YGYA 3B9PA 4J90A 5CDTA 1Q81Q 2C7BA 3K0SA 3L4JA 4CM9D 3ZNNA 1O6CA 3DP9A 1JJ2O 1Q22A 4ARVA 1A8UA 2E85A 2PA3A 3L7DA 1BAJA 1CUBA 3OEYA 5ADUS 1PVOA 3AF2A 5C35A 2JASA 1XN1A 4WERA 4UPDA 4D79A 1E77A 1K08A 2ZRMA 4TWBA 3DBLB 3OAAA 1J2TA 1E8DA 1LLDA 1X0XA 2HF8A 1U6KA 1HDZA 4EG0A 3N2EA 2CFIA 4MJLA 2JH3A 1IN8A 1CTQA 4MUEA 4DRXA 4W6ZA 4QXQA 2CWOA 4UEKA 1RZ3A 5BN1A 1BO6A 1DQRA 1U2EA 3QF7A 3NAMA 3AHCA 2R1TB 4M89A 4ZANA 5L3RA 3K70B 4CDMA 4UQPA 4F4IA 4QOFA 4MW7A 3WGQA 1PL6A 3C1TA 3GUCA 3CVOA 4B3DA 2MD9A 2HDHA 2WIGA 3HADA 3G29A 1BA2A 1G8KA 5BYKA 2R3SA 5JFTA 1AO3A 3W6OA 3KE8A 1BN7A 2D5IA 5KSPA 4FDMA 2QL6A 4ZICA 1UEXC 4OYHA 2DKNA 5K05A 3GGCA 5JSYA 3ET5A 1ZINA 4UU8A 2ZR0A 1LW6E 4HDKB 3E5HA 3TINA 3E18A 3OZXA 1Z39A 4LPKA 1F17A 3RUCA 4HDSB 1MENA 5HUQA 2J3EA 1BE0A 3Q0EA 4TVBA 4HKGA 1X80B 2QRNA 2B4TO 2AZDA 3FVTA 4RKQA 4R98A 1R7RA 4BC1A 5CAEA 1AT1A 4XRRA 1TYZA 1HFWA 1U0GA 1YNOA 2P69A 3VHXB 4BO3A 1NURA 2MSLA 4E13A 4EUEA 5KP6B 2DPGA 3UG6A 1A9RA 3IEIA 4D26A 1IOVA 2GEUA 1KHHA 2D8MA 1T0HB 4BGDA 3T7TA 1GNPA 1QKKA 3PSHA 1W5AA 3OESA 4PNPA 4WCFC 3ZYCA 2AFVA 1KAMA 4QU5A 1JEYB 4UMDA 4LY9A 3NQ41 4P3NA 1WJGA 4RIGA 4EY7A 5D2CA 1LPBB 1THGA 3MJSA 4MKRA 2QRLA 3FY4A 4RFSB 4W9RA 5K99A 2JGKA 3KKMA 4OI0A 2MF4A 1C1DA 2ZT5A 1JR6A 4PNZA 5GM2A 1EBFA 3O2QB 4BO6A 5HEKA 1CY0A 4FFSA 4XUCA 2Y1DA 3WTBA 2HBRA 3T3OA 1Y33E 2NADA 3AYZB 4YRJA 1UMCB 4LGCA 4YV1A 1GUBA 1KJ8A 1NU8A 1TECE 5ALWA 4CNQA 4F5EA 4U6NA 1YJBA 3K53A 3ZXUB 4LKOA 1H8HA 1ZK0A 3S8EA 1FW8A 4U7FA 4JC8A 3O90A 2ZRFA 3AEQA 3UMMA 4GYYA 5K0SA 1AA6A 5CLFA 1E2LA 1R6VA 2P9CA 2GT1A 2UVPA 2HJVA 1XTBA 3EFOB 4RL4A 4CCWA 1G6OA 1TCVA 1Z29A 2O8EB 3FUUA 3WRXA 3RG8A 2EIAA 5JE8A 3H5AA 1M1YA 5BRNA 4HKTA 5EESA 1XQ1A 4ZO8A 3DLAA 4OQLA 3TI9A 3UFXA 4WADA 3VJLA 4DADA 1JZTA 5UKDA 1QE5A 3AM4A 4CTJA 3F71A 4X92A 3DXFA 5CX1A 5HCUA 4N5MA 3G1GA 1K97A 4LQ4A 2QTZA 4Q9IA 4EJ6A 1HFEL 5SZIA 3CCFA 5EGSA 4E6EA 2FU5C 4MICA 3UKJA 3ANMA 3GEHA 2BONA 2XEXA 3TRJA 4UMVA 5CLLA 4ZARA 3DFZA 1E3SA 1FFBA 4HZUA 1YB1A 1V8FA 2GYVA 4B82A 3LDAA 3NM5A 4F3KA 3C0KA 3GEIA 3B3AA 2Q4DA 1DMRA 4B8YA 1M34E 4YMIA 5I9TA 1Y1KE 4XI9A 3PTLA 4RAQA 4COOA 2JH8A 3BH7A 4CDRA 3QVXA 3DMPA 3RFTA 4YMVA 4CVNA 1OGJA 3ML1A 2ZVJA 1M6VB 2OZVA 4HAUA 3C5CA 4IDBA 4EENA 3GGJA 3NALA 4RKWA 2AWOA 2H4FA 1WSDA 4PFJA 4YXWD 2AF3C 2X7JA 2XKKA 3D2CA 5KPDA 1BX3A 1VL2A 2CDRA 3H9JA 4FYVA 5LQDA 4UVIA 2JIBA 4ZV4A 4MRMA 1E4VA 2NXNA 3BZBA 4JGBA 2HQRA 1KI6B 1EEXB 1TZJA 1N5KA 2J3DA 3S6JA 2IDKA 2EJUA 1SOWA 3WKDA 1ICIA 4IVQA 1YOVB 5DLYA 4EHIA 3CCEP 2OV8A 4L7QA 3KAPA 2G08A 2VF5X 1GEGA 3OIDA 3QVGB 4ZT3A 4DCVA 3CLSD 2XTZA 4BKMA 4LHXA 1U1IA 5MDHA 3KB6A 5IMBA 4WKPA 1CU1A 4URWR 4U39A 3GGSA 3NRBA 2H2FA 3URKA 2XQVA 3OX2A 1C4WA 4KDEA 1OXTA 3EXFA 3S3TA 4W1SA 1XMOB 4K46A 1R0RE 2VPWA 5A7HA 4MXDA 3GJ0A 5C4GB 3TCNA 3PNOA 1DIHA 3JU3A 1IXZA 1T1IA 4GPZA 4DM4A 4NYIR 1OSNA 3BE6A 4KN8A 2JC3A 1CJMA 2JHGA 5TE9A 4RTSA 1H8ED 5JDCC 3CINA 1RXEA 3H8WA 2H18A 3VVLA 3IPAA 1N34B 2JZOA 2OCBA 4HK4A 1RQGA 3U17A 1K98A 3ZYZA 3VO8A 4DCTA 5IHPA 4RCZA 5IFKA 5JZMA 2HSGA 1BXRA 4AICA 4MHTA 1NF9A 2JYGA 1WU7A 4HMPA 4OJNA 5JRDS 1E0JA 4DE5A 1ZBDA 1G7CA 2GDYA 3KDSE 2BTQB 1IQUA 4BQFA 3DFMA 4ZVVA 1QTQA 4CU2A 1PE0A 5FI3A 3VNVA 4L2IB 4B3RB 3PITA 1OT5A 2BKEA 2P8JA 2C8JA 3SSMA 4P7JA 4OF4A 4DLSA 3D7LA 3RT7A 5D5PA 5EAIA 1KP3A 1WNFA 3IUQA 5GOZA 2Q6OA 2WJZB 3KP1A 3LX5A 1HT2E 3QU5A 3D9QX 4NG5A 4XYMA 2W2QA 4BZPA 2I8CA 4FEYA 3I52A 3BRWD 1IULA 5EJIA 1E79A 3OIGA 2Q4EA 3LK7A 3D6VA 1MAUA 3CVJA 4O1HA 3W6NA 2BKAA 1WOYA 1XA0A 4ZODA 1FP1D 3I53A 3C74A 3CPWO 1JEQB 2O06A 3CXCO 2G40A 3NUGA 1FXWA 1BROA 4GF5A 3WAGA 2A6PA 2O6HA 3EE6A 2FZ5A 1TM4E 3A4YA 4X45A 5JAUA 1K8XB 5KO2A 4J8PA 3EGXA 4CMIB 1DBWA 3LYUA 4Z0HO 3AFNA 3FNIA 3OCWA 5T7BA 4BCDA 2EFCB 4TWIA 5CDSA 1PGJA 2FUG1 4WKNA 1CRLA 4OB6A 3U81A 2IH4A 3DLBA 2CLMB 1QFXA 1R5JA 2IYZA 5CIYA 2ATCA 4PPFA 3H84A 4QBHA 2WT9A 2DQKA 4OAPA 4X44A 2VKQA 3PFBA 5LA6F 3H6GA 5JSZB 1KC8Q 3GJNA 2H29A 1A8OA 2ZVDA 3DONA 5B37A 1RRMA 2C9CA 2QVLA 1OXXK 2Q9BA 3P2OA 1M73E 3MBKA 1XQVA 4H0CA 5T8KC 4PIPA 4A1FA 1BH6A 3K5IA 2QTLA 2BMWA 3OICA 3OO0A 1D7AA 1W96A 4LZZA 1E0AA 1WUKS 1YE5A 4PAGA 2QBYA 1DBPA 1J0XO 1E66A 3NU1A 1V5EA 3IB6A 5L9AA 1AHHA 3D4PA 1VBNA 3X43A 1QJ4A 1A4IA 1XTPA 1E9CA 3OE7A 2PMKA 2W6MA 2ECOA 1T5BA 4JOBA 4JEUA 1UR5A 1P9OA 3WY9A 3ZGNA 3ZHVA 4GVPA 4BFVA 1FNBA 1V8PA 3G8BA 5AKGA 4XIIA 3UJNA 4DRZA 1JHRA 2ZUSA 3PXAA 3D2BA 2OB2A 2P0EA 4DLUA 5BSVA 1U3WA 2VHCA 4A2QA 3P1JA 3I28A 1RJFA 4YDQA 2RG7A 4O5AA 1AGPA 4UTZA 2A9KA 3BSWA 1QDLB 1SJ9A 2L0XA 1UPTA 5LZ4A 1E4EA 1HTBA 1R5OA 1JB1A 1ZLYA 2B1GA 1OUMA 1HE4A 1SCQA 1NJ2A 2E4WA 3NASA 3TRIA 1B73A 4CGYA 1MZVA 2G1AA 2QUIA 2J48A 5FV7A 4D9HA 3MB8A 4OFBA 1KDZA 3GGGA 3VVMA 3ZKAA 2Y67A 1T3LA 4CI9A 4ZI7B 1KYZA 4R2WA 1LI5A 1SBNE 3X2FA 5B3KA 4LOIA 2VA8A 5ALDA 4G2NA 1MHTA 1U1DA 2XKAA 3DM5A 5DVZA 1HC7A 4EFNA 2PYIA 4KXNA 1G8SA 5KU7A 3ZWDA 5KQGA 3MB5A 3EYAA 1R64A 1EXVA 2QNBA 1IYZA 3C5VA 2HXSA 1YCFA 5A05A 2E6UX 3D4NA 2I6SA 4NCNA 1U3DA 2FPGB 3JVDA 4X64B 1ODSA 4RSRA 3HGTA 4WPGA 4D9KA 4E4YA 1XL0A 3MFQA 4NR0A 1FTNA 4NV1A 5JXWA 2HPVA 1HSOA 5AVOA 2RD2A 3MGAA 4WW0A 4FKMA 1ZCFA 1CR4A 1E9VA 2PX4A 2ZB3A 3FCEA 3O0DA 5ECYA 3P4XA 3T7DA 3W4JA 4C0QC 5C1PA 3UC9A 3DS1A 5LDHA 3OEED 1V3UA 1PG2A 1F5NA 5U4XA 2PEJA 2X8JB 2QPAA 5CEFA 3FLEA 2EERA 3EIEA 1H9CA 1XN4A 1H3FA 1IQRA 2ECQA 1VQOP 2EW1A 1OBVA 3AEUB 1T5IA 3CHYA 3JALB 1JQJC 3GWGA 3R7FA 3CCJP 3FOAA 5AI0A 4MS3A 3TZHA 4IH1A 3WGMA 3AMVA 2ZIXA 5IC4A 2ID7A 3ADPA 3ANXA 4G0ZA 2X5KO 1PX2A 1V2HE 6REQB 5LD2B 3E3AA 2COKA 2RARA 4ND3A 1POWA 4ZOEA 5K8TA 4WKCA 3O4RA 4MEAA 3EN0A 2VJNA 2QQ5A 1PTKA 1JFSA 4JI3B 2BP7B 3VRLC 4KXLA 4J2TA 3TE7A 4BY9E 1PJQA 1CIJA 4K9QA 5FAKA 4RYDA 2OQ2A 3EJBA 2VLQA 3NR2A 1PSZA 4ND8A 1SUSA 1KF0A 3V4PB 3VKGA 1OIWA 2GK3A 3EXG2 1IBKB 1J2UA 4DV7B 1U31A 5EJDA 1VL0A 1HETA 1S4QA 4RD0A 2V03A 3S2SA 1U11A 3KSDO 5DSTA 4S04A 1QRUA 3B89A 2PV0A 3FIJA 3SS9X 4Z8YA 3KSAC 1NRIA 1K4MA 2CNDA 2Q21A 1I30A 1XEXB 4EI7A 2WVAA 4DSUA 2IZOA 1G20E 3WQQA 4ON9A 4HLCA 3I2JA 3OFJA 4G25A 4M7OA 4B3HA 2GTIA 2N6ZA 4BV8A 1GUYA 2BMEA 4IXMA 4R84A 2DM6A 4H59A 2CV0A 2RCNA 4Q34A 4JFRA 1K3TA 4R71A 2ZYRA 1RBYA 2YN0A 3LG2A 1JDTA 3VR4A 4UNPA 2C4KA 1Q16A 3P05A 3NS7A 3GFPA 3MYYA 3CEPB 5CYOA 3UMVA 1EVJA 2Y2UA 1KDRA 2MJLA 3AERB 4BAUA 3PF9A 3AI3A 1X19A 4XSVA 1FYFA 2I4TA 1T35A 2JVKA 2L17A 5REQA 1RRGA 3A4MA 5IT0A 5B6IA 2ZDGA 5BQOA 2JEYA 3Q98A 3A3PA 2NYUA 1Q83A 1OLUB 3FI0A 4J76A 4KE9A 5AESA 3WL5A 2NP6A 2Z5GA 4BE4A 1QFJA 1WZUA 4HXFB 4BNUA 4QRDA 1UM8A 3Q15C 3Q8LA 5H3LA 2CJWB 5BNWA 1EZZA 1QZXA 2E7ZA 1MTOA 3WGYA 4ETIA 5EXPA 5HR5A 1N2BA 3PPVA 1N2IA 4DV4B 3BYZA 4DMFA 4G0XA 5DTQA 1M76A 3QUSA 4JP2A 3GELA 3REFA 3LGXA 4WK6A 3G4SP 4V3BA 5EWJB 4PLVA 3H97A 3IESA 4HNGA 3WYGA 2C7QA 1QHYA 2IOYA 3RC3A 3UK6A 1DQPA 1OC4A 1V7QA 2QXUA 1WXWA 3KKKA 4C88A 2N5IA 3LVRE 5DBEX 2GCNA 3HUEA 2R62A 1F12A 1YRBA 3E1KA 5EA2A 3LDFA 3NANA 4RY0A 3SIXA 3U7JA 5MGBA 2GLUA 3JALA 4JU8A 4LYJA 1RWXA 3P9RA 4ZEOA 3BTUA 4Y1EA 3DF7A 5ALLA 2ZI5A 1ZX1A 3G2KA 3PQ7A 3H1BA 2QRVA 5FBVB 3W90A 4CMEC 2XCTB 1YJAA 3WOVA 1J5EB 2F1KA 2KOPA 4XD7D 5L4LA 1B41A 2ZZNA 4S1VA 4HDNB 3UJ6A 1QZUA 2XNCA 3VPFA 3WLAA 4A8PA 1MPXA 4R8MA 3V55A 1TQ4A 2H54A 4HFRA 4L02A 3U7HB 1R6UA 1J09A 1P9WA 2GRUA 4X94A 1EAMA 2K7ZA 1C9KA 4OKIA 4D4LA 1XQXA 2EXXA 1ZIOA 2RAVA 4HNSA 4OMCA 2AI1A 1QCDA 4B6PA 3LBYA 3VZBA 4ZDIA 3R5SA 1AKNA 4UBJA 3T41A 5AW6A 3CEMA 5KCZA 1DEHA 1P7PA 1ML3A 4U0EA 1RS0A 1U28C 5TQ2B 3PLAE 5CM9C 3Q2IA 3RSGA 4CKZA 4FS8A 2C4WA 2AE2A 1GZ3A 3IAAA 3C3KA 2I6XA 3M8KA 2F3SA 1PDVA 3KQVA 4KMSA 4EW1A 2ASVA 4RE5A 4WTOA 4TM8A 3VZPA 4CKXA 3G2LA 2XF2A 3WO0A 1SU8A 3AV0B 1ZI9A 4UAGA 4A91A 2JGMA 2C2XA 3F3KA 4PYKA 1PEKE 3DYBA 3A8TA 1KOLA 3AZOA 4R9VA 3SK0A 4MW1A 4UARA 2WA1A 1I14A 2F9MA 3INGA 3RKRA 3WYEA 1JLSA 3T0FA 5CRIA 3WR5A 2WJ6A 4JELA 3U7IA 2AUNA 2YXPX 3C5HA 2HIAA 3SYMA 3DBHB 3HS3A 1AURA 2XDAA 3A11A 1BW9B 3CCBA 1S1MA 2HA2A 2P65A 3PXXA 1DO0A 4JOCA 4M7RA 1TM7E 4P1ZA 1J6UA 4A5SA 1VSVA 2J9YB 4ZYTA 1XAIA 2V7WA 3PXGA 3IS3A 5B7GA 4HRAA 2AH5A 4OJQA 1XJWA 5JDCA 1ODJA 2H1LA 1Z38A 4YUZA 1G7TA 2NVUB 2OM2A 3HYLA 4OQPA 1U63A 4Z7JA 3UT5A 5FBRB 2P2LA 1MIHA 1L5YA 4Y6PA 3OPVA 3VKHA 1NVWQ 1UT6A 3DTYA 5IH3A 1FUIA 5LN1A 4U2EA 2GDZA 3EAGA 2VSYA 1JHXA 4MRVA 2DFLA 2Y0PA 3N7AA 2JFFA 1L4UA 4YAFA 3C1OA 3LFUA 4IEFB 3N5CA 4DNFA 3LT0A 4CLOB 1L4NA 4LG1A 1GZ5A 2JGFA 4Q6BA 5IVPA 4JX9A 4IMRA 4R1TA 4AJ1A 1YS9A 3FNFA 2DFTA 3RVLA 1KI3A 1RYBA 1GHTA 2AF8A 2IIPA 1APBA 4IIDA 1DGQA 2QF7A 1UADA 5LSAA 3QPUA 3QLUC 1A9OA 4N5IX 3DHNA 5JSQA 3CIFA 5DK6A 3G1UA 1AGXA 2R8YA 3GA0A 3VGJA 3VSCA 4DMRA 4WOPA 1W4AA 4HH3C 2YBDA 4GI3A 1Y1RA 4YJDA 3U4QA 4F7DA 4BWVA 4DR6B 1JMKC 1A5TA 4FSHA 4KQ2A 3TJMA 4TL6A 4Z3OA 3DFUA 4GGPA 1WRBA 4XGKA 4JC0A 3BEDA 2JGPA 2Z8YA 4IHAA 1Z6YA 3DMRA 4MI6A 1JLLA 3FYUC 1GKIA 3ZVKA 3OIVA 4JODA 2X15A 2G82A 1JN0A 4LRWA 5D3MA 2IPMA 3NFRA 2Z09A 4DBLE 1Y3CE 1DRUA 5KIAA 5C51B 4QUHA 2IZ0A 1XD2B 1RI1A 2I3AA 4QULA 4Y6GB 4D9EA 2W90A 2BE7A 5DX8A 4RAOA 3ZU3A 4G67A 2NP7A 2FZEA 2ZDQA 3FVRA 3R3JA 4P36A 1W0CA 1XZCA 1F3LA 3E7FA 5EKSA 2W6PA 4DDTA 4PC2A 3ASVA 4UOEA 5KTTA 2G88A 4JUBA 3NIFB 1YFLA 4ICIA 1EP3B 4LXYA 5BYBA 2IXDA 2B7CA 5CTJA 5DW0A 2VJQA 2NZXA 4BE9A 4WZ6A 4MEJA 1XU9A 2V97A 4MYDA 5H3HA 2FK7A 1DKMA 2WIAA 4P5PA 3WGUA 1SQ0A 4M0IA 5IYZA 4WOCA 3AIMA 1CUCA 4OKNA 5BS2A 3KSZO 1D4AA 1CDEA 3KSMA 3AXSA 4Z9YA 3THXA 2JLQA 1J8MF 4I4NA 1LQUA 4TTIA 3EDQA 1ZGJA 3QTLA 3ENZA 3FYHA 4XM2A 1PFKA 1Q0LA 4K87A 1N4DA 1D6JA 3NPMA 4GLLA 1Z8FA 1Y4DE 5AVKA 4PCAA 2BYTA 1T8KA 4HX9A 6ADHA 2O9JA 1QP4A 4LQDA 4LFAB 1ZM9A 3UJ8A 4WQMA 4MKHA 1ZU5A 2VAXA 3MTDA 5FAXA 3PUVA 3BWMA 5I9BA 3MRSA 4MLCA 5I4TG 2FFBA 2MTBA 5CA1B 5HHTA 1KQNA 3CNBA 4OP2A 3H9CA 5FP0A 4MDFA 1N8NA 2ZYSA 5ECGC 5F5LA 3EJ6A 5F9FA 1E1NA 1YIDA 2C2GA 4IR7A 2ZSKA 4KV7A 4UUBA 2PQ6A 1GA6A 3EIWA 4JT2A 1U0JA 3MS7A 5JS1A 3K6SB 2C4MA 3MGEA 3KO8A 2CNRA 1TKRA 1SVUA 4JLVA 1JFVA 4UDYX 4G9BA 1KOJA 1MXFA 2H1CA 1GCAA 4A82A 4RE6A 4EKGA 4FT2A 4AZ0B 5LQJA 3ABSB 2AZ4A 3ILSA 1NBOA 1QHIA 1E9DA 1E6MA 4ND5A 1SCDA 4HVCA 5BWLA 4RTRA 3RQSA 5KNCD 3M2PA 3THRA 3GUUA 3H5IA 2H52A 2XADA 5HILA 2XB9A 4PO9A 3L4KA 4JIGA 5ECWA 3CZRA 5BWOA 3X2EA 1DHTA 3ZHQA 1ZD3A 4WE3A 1ECBA 2BMVA 2K2WA 3N87A 1GLGA 4I3FA 1G5IA 1YC2A 4XE5A 3AJRA 2VT7A 2O14A 4KMOA 3SXUB 3WB1A 1OFTA 5AVUA 1T0IA 3G0HA 1TJ4A 3TLEA 3F6YA 1QQBA 3OP4A 4BLVA 4LDPA 3U4MA 1I4EB 2Z58A 4B0OA 2JCSA 5CVJA 1Y81A 4RF3A 1PGPA 1JHPA 2HWXA 1LW7A 2WJIA 2YY6A 3E3NA 4IIEA 4TLCA 4XQCA 5EJFA 5FA6A 5HYVA 1YKGA 3U16A 1NJIQ 1M1ZA 2G76A 4OXIA 3FTEA 4PSAA 5D3QA 4FE3A 1I0ZA 4P54A 2WI8A 4LOLA 4Q3OA 3WLRA 5FBWB 1DCFA 1KY5A 3ZXIA 2N50A 1I7LA 3HM9A 5CDYA 1WCIB 2W9XA 3SQWA 2XMZA 5CA1F 1U7PA 4JVOA 1Z6XA 3QMWA 4OMDA 1P9LA 1KL7A 3P0RA 3RBZA 1Q50A 1CNMA 1WPGA 3U1TA 3U9SA 3ZWCA 5T64A 1PT6A 1WULS 1CY7A 4X60A 3A9VA 1Z0FA 4TLMB 4DHEA 4YT2A 1RE1A 2BV3A 4UCQA 2J32A 2IV2X 4KNVA 1M7HA 3OM9A 2ORYA 3GLGA 1E3JA 5SZKB 4KFSA 3MWJA 2J5QA 3DF9A 3BILA 5DGCA 1KSGA 2I6QA 4TXMA 3KE9A 1W0JA 3MWLA 4LE1A 3RIYA 1CERA 1USGA 3O1LA 3F2IA 2W00A 3KHKA 3RW9A 3O8QA 3WL6A 1N6OA 4JEIA 2PEOA 1ZRSA 2GASA 2QUZA 1SU7A 4RHFA 2HAEA 5LXTF 1U0HC 4L9AA 5I51A 4K5QA 4C4SA 3DBLA 1QIDA 1JGTA 4M9QA 3M6VA 4XPIB 2QAGC 2J07A 4Y1RA 1ZBQA 2X9VA 3NTRA 1UJMA 4R1MA 1WB6A 3OJWA 3GLHE 1N5OX 1UQUA 3HWWA 3NBYC 4PPYA 3GVXA 3JZMA 2NTVA 1XA3A 4KKXB 3RRJA 3E9EA 2CCJA 1DAGA 4GWLA 4I1SA 2JA2A 4I0WB 1Z5PA 2EAUA 3FPLA 4OHCA 3NP9A 1WZ2A 4UVEA 1P91A 2VA9A 2ZITA 1AOXA 2QE6A 2XKJE 2IZZA 2OQIA 2OXRA 1NMYA 3FWPA 1IQ0A 2C4HA 2AQ8A 1T10A 2JB0A 1U90A 1VI2A 4HDSA 3SOZA 1N0UA 2W6NA 2ZJ1A 4EFLA 5T57A 3F7NA 3TNFA 2ZI6A 2E5WA 2WWHA 2CLHB 3F73A 3AWIA 4NH4A 2XUGA 1FJ2A 1PJAA 1Y3HA 2VDWA 5B1EA 4QDZA 3LUHA 4DB2A 1W5SA 2GD1O 5EMMA 5CT9A 2HIMA 1NX9A 2B7BA 4LF7B 1OFIA 5IAJA 4MS4B 4UE2A 1RU3A 3JZDA 3L1VA 5BOSA 1QANA 3JZIA 5KNBD 5J23A 1VYTA 1NW4A 1RNLA 2BD0A 2J9FA 1T2UA 1S5PA 4N0EA 4MVJE 5ENZA 3DAGA 4AX8A 2AN3A 3A4IA 2VL7A 1BQ4A 2ZVQX 2BUBA 3PT5A 3BMNB 2MYNA 3TXXA 4G5OA 2LDXA 2GCIA 1G41A 2BZ1A 3PYLA 2ONCA 4CMCA 2CF5A 2QTBA 1IN7A 3F8TA 5GWXA 5B53A 4B83A 4MQEB 4Z54A 2ZSEA 4AKEA 3AG5A 1RRPA 1KFEB 2XNDA 4N18A 3FRHA 4WI1A 1UMCA 4YYEA 3PQ3A 1OI7A 2NV2B 1PV1A 4FD2A 5E38A 1BHQ1 4JBXA 3TUIC 3OI7A 2Z2XA 1FFCA 3N0XA 3IMCA 4J1TC 3IVCA 3I30X 2V58A 2AX3A 3QPAA 4M0UA 3ND5A 5TMEA 4F06A 5I4KA 1FCJA 4FDTA 1U1EA 1Z2PX 2DUWA 3FPFA 2Y8EA 3BF7A 1OFGA 1YS1X 2I34A 5C5EA 2R4UA 4B6QA 1E79D 1TF7A 3AB3A 4JBHA 4LBZA 3GDFA 1QM5A 1Z4NA 2CVOA 3ZN2A 1D03A 1L7QA 3OMWA 1FU7A 3SBOA 1GD1O 1KNXA 1DAHA 2ZTVA 3QWFA 2DJ5A 2O7QA 3IQDB 1NE7A 4EHJA 5KJFA 1LS6A 1PHRA 1N7JA 1YUMA 4RHCA 1JI0A 3E3OA 1H0RA 3W2EA 1IAQA 1A8QA 2GZEA 4LVUA 1UBFA 4R31A 2R66A 3TDNA 4Z4EA 3UFBA 2Q1TA 2C84A 2XCQA 3C3WA 4WY5A 2N98A 2UXDB 1I7PA 2IEZA 4LDQA 4RK7A 5KREA 1UWLA 5B3JA 3D59A 1WY5A 1SHJA 2D5AA 1XTTA 4FBMA 1CUUA 3DXYA 2IW1A 2OCYC 4NAVA 4EEKA 2XWSA 3B2QA 5TARA 3NWEA 3KJGA 3UXHA 5DHAA 4TTVA 3SJAA 4R2KA 4OL0A 5B3LA 3AUUA 4BKUA 2VNJA 3KXIA 5BVGB 2PK3A 1VQPP 3CCMP 5AUNB 2ZIWB 1WP4A 1YT5A 4IIJB 5LZ9A 4OFWA 3D7MA 1IN6A 3NTVA 3A6FA 5F77A 1PZNA 2JJYA 2COEA 3Q12A 4Z4QA 2O8EA 2BBTA 3AR7A 4TXLA 2DUNA 4F72A 4KR2A 2C2HA 5TPZD 4EHLA 3KU4A 4GHWA 3W8EA 1UKCA 4F9FA 1GTZA 3FYTA 2O8CA 3CO5A 2W2XA 3BT7A 2QPLA 3L04A 5FRDA 1P1JA 2A88A 3DE6X 4HMQA 4XX0B 5T67A 2VAVA 5B1HA 4BO1A 4G0WA 1C29B 3G0OA 4UAJA 4JU9A 4H1TA 5H9VA 3BKWA 5IJZA 2ZKIA 3NIDB 4IPTA 4U00A 3BQMB 1R5NA 4BRUA 2YWCA 3MWYW 4RPCA 4JI2B 1PNVA 2OXFA 2AQKA 5BN5B 2ZBVA 2Y1OA 1JU4A 4ER7A 3O3NB 1IVNA 3ODPA 3F6EX 4OHOA 3L4BC 3R9IA 4OOFA 5K0LA 4D45A 3NT4A 5JAPA 4ZDWA 4WKOA 3UPUA 1Q91A 4YAIA 4A2CA 3DPSA 2I7CA 2CLEB 4X91A 1HYHA 2XCLA 2YYSA 1O8CA 5DYGA 5HVCA 2SKDA 1FSZA 5DTJA 3CB2A 1MU0A 3HB1A 2X2OA 4XR9A 3VO2A 4AX4A 4DBVO 1DAMA 4P5EA 5FWXB 2D7DA 1MUUA 2ZJYA 1Y34E 1KJZA 2VCHA 4XTRA 3VR6D 4B81A 2Z30A 3FJOA 1XTUA 3IAEA 2PRIA 2X40A 3HFRA 4XIGS 4KQ9A 4TYWA 4H0FA 5H4HA 4REQB 3MAAC 4ZAVA 4BAGA 3VYVA 5C7IO 1HNWB 3VKFA 1YQGA 1IUKA 1D2HA 2YY7A 3ETEA 5HGOA 3EZLA 4YXWA 3K9GA 1U0NA 2VJCA 1MC8A 3M89A 2CNNA 4MRPA 1EUCA 4DCGA 5DEIA 4DWVA 4YH1A 1GQYA 2A8YA 4GGOA 4BTLA 1WEKA 4QO7A 1IBSA 1KIFA 4CKCB 1I3KA 4Y2HA 4HWPA 1GYPA 1P2TA 5BSFA 1P2UA 4TQUS 1AB6A 3VVCA 2D74A 1ZEMA 4WLFA 4A6PA 4QDUA 1WQ1R 4L57A 3ZJ5A 1UXGA 1W9MA 4DC0A 4E5PA 3Q3HA 4EPWA 4HT3B 2DY0A 2Z3VA 5DRYA 4MCIA 3IR6A 3VZQA 3HHEA 3DYIA 3CSUA 1FMCA 4Y2PA 2EX4A 2E1PA 2GBCA 3C4QA 3E8XA 3WNDA 4D2IA 2C8KA 3T15A 1N2XA 2AMLA 3P2IA 4NARA 3SSAA 3K1JA 2OD9A 4MW9A 3DE3X 1ANKA 3JQ6A 2J09A 2WMOB 1P1BA 3FRIA 1EK2A 4GOOD 5HSGA 3PXBA 4ZDKA 3TD6A 3DV0B 2VUUA 4KZKA 4UFOA 1QB7A 1CIVA 2IXGA 5JLAA 8MHTA 1N8KA 1E8MA 2PWPA 1EESA 1JEDA 2VQ6A 4O4JB 2VDLB 1SIOA 1JAHA 1WETA 2XBUA 3O3MB 4MV5A 2AV6A 4A8JC 4EP1A 5CK4A 1XDGA 2R7KA 1GZ4A 1G6HA 2EX0A 4H3SA 3O1JC 4TV9A 5FPSA 4GUDA 2ESRA 3R3YA 2BN4A 1H42A 1S8AA 1X39A 4HQ0A 1UDWA 1YXMA 1V8BA 1C7FA 2ZWMA 5AP9A 2ST1A 3WWEA 2IYOA 4KODA 1LK0A 2BFCB 1C5KA 1W88B 4FX5A 4Z0TA 2NUBA 3ROTA 3S7ZA 2W2LA 2BMAA 3HA2A 1EFHA 4F1WA 4F1KA 1DJLA 4JGIA 3FMPB 1KS2A 4YMLA 1M9NA 4JJEA 3TOVA 1EIAA 3SR0A 1MZPA 1V43A 1CT9A 3BJRA 4GMHA 4OXXA 4QNNA 1BFUA 2RHTA 1A4UA 2R4TA 1C9YA 2D1RA 2HY7A 2AR7A 3FNRA 3LVBA 4B84A 1ZH8A 3Q5DA 1IUOA 1U3UA 2QJOA 1BDBA 3EC7A 1Y8RA 3AZQA 4X8HA 3D0KA 3EMKA 3UBMA 4EJFA 5B4VA 1I6LA 1H2FA 1PJZA 3CVXA 3P9XA 1UQRA 4MUJA 4H08A 5L95A 2XE6A 2DTEA 3CUTA 1JIXA 3BTSA 4DM7A 1Q1BA 1HRKA 3NH9A 4A0SA 3NIGB 5B7NA 3NY7B 2CKDA 3SOPA 1C30B 2VSNA 1LDYA 1G7SA 3LFTA 3ZDDA 2JHFA 2QUKA 3IUPA 3ZWWA 1JEQA 4LMPA 3Q8KA 3GVCA 1EE9A 2TS1A 4LRXA 2C2YA 3TZQA 3AVYA 2F3TA 3BXFA 2NZVG 4I5GA 5K8LA 5K0TA 3ETHA 1GPJA 3QEMA 3AOGA 4GEKA 3O8NA 1MT3A 3OZRA 2M8NA 4M6WB 4U63A 5IF3A 3OP1A 4GL2A 1ODIA 3AW9A 3HJGA 2YFHA 3HV2A 4FGSA 4BJ6A 2EZUA 4DNOA 3NMUF 1D04A 1E1LA 4DHWA 4NDAA 2ZI3A 1HQKA 3EG9A 2EJWA 1S8FA 3MWFA 5DNVA 3VR6A 3RH0A 3S5UA 3ZV6A 3N3AC 1X7WB 1U7ZA 2A4KA 4GP7A 4GNRA 3TKLA 2P6RA 3Q40A 3R76A 5CCEA 5A2QA 1ZNQO 1NXSA 1RQPA 2VT3A 1U2RA 5B57C 2XVXA 2FPSA 3PFCA 4GOLD 4C3OB 3L7YA 1AU9A 1VHQA 3U3ZA 1ZI8A 2EQBA 2ZJ7A 4JSRA 4CQLB 3U4IA 5C8ZA 1KNQA 2EV9A 2WJGA 2J0UB 2ZULA 4L28A 2O1WA 3FHTA 4I55B 4IDEA 4FZRA 5DOVA 4KDFA 1GIAA 3CLKA 4I4CA 3U80A 3H2IA 1ZMOA 1J00A 5LP6B 4CF3A 2O0HA 5CFZA 4JLBA 3DAYA 4URFA 1W4ZA 4H6XA 4TS9A 4DWOA 1MB4A 3CN9A 4EI9A 1BGWA 4IJ5A 4R05A 5AICA 2XGJA 2OTCA 3IPLA 4ERNA 1X1AA 1QGUB 9MHTA 1TM3E 3RYTC 1OB5A 2ZZKA 1J8VA 3MSXA 1KRXA 3KWMA 2H4ZA 3KRTA 4WNCA 4D25A 4FUTA 4D9FA 2KE5A 2W2KA 4K8OA 3NHAA 4NG4A 3U1BA 1FP6A 1SBTA 1GNVA 4C5AA 2QL9A 1PBNA 4KUHA 1DWPA 3ZI4A 5K8JB 2CXQA 4ZC1A 4JCCA 5HKLA 4AJKA 4AZWA 1H9AA 1GUZA 5IAGA 1QH8A 5JNVA 2OAGA 3FZYA 5BMVB 4PINA 2HWYA 3BWEA 5JCJA 2R7AA 3QFFA 1KYXA 4RY9A 4NE9A 5U1PA 2GJ8A 1SVNA 3OJ0A 4GBMA 2MVVA 1GKKA 4TRNA 5TR9A 4C4AA 2J4FA 5E6SB 2PNJA 3ABZA 1NXTA 2GNOA 5BN3A 1M2KA 3QVWA 3LLMA 4UUQA 1S02A 1J70A 1C30A 4LHYA 5GAJA 4BP8A 4NWIA 1XPOA 3IQIX 1XTZA 2POCA 1M1NA 2GM3A 3T3DA 2WZQA 2ZWIA 5IX8A 1NPTO 2P30A 5IJWA 1AXRA 1K06A 4QWWA 3KQPA 4R4JA 4GLJA 5AOCA 2AMJA 4NBRA 4YP6A 4FWTA 5A1JA 3ICQB 3SLKA 3CF0A 2H7XA 5JJ5A 2BBSA 2HYDA 3MTEA 1LSSA 5LD2C 2X8AA 3TXAA 2XWBF 1VQ8P 1AN9A 1TEXA 2GZHA 3TJZA 4ARAA 1Z3CA 2RB5A 3T0IA 4MR9A 1LKZA 5IZCC 4IDQA 4IDHA 1IB6A 1A95A 1WHSA 4J9VA 5U4QA 2HLNA 5EP3A 2XDWA 1PYGA 3I8SA 4WY8A 2L22A 5G3YA 1ZD4A 1A69A 2YZ7A 5L8VA 3ADKA 2D6FA 7MHTA 4GYJA 1WMFA 4CQJA 1ZC3A 1II9A 2DHDA 3ONFA 5BSRA 1ZRHA 4QQKA 1O94C 2W6ID 5EQJB 3UK2A 2BKXA 3WV4A 4RTJA 1EX1A 3THYB 2R1ZA 1JDZA 2AGVA 2ZGVA 3DV9A 3MEQA 1HDIA 3FGNA 3PC8A 4W4TA 5DI9A 5COBA 5HKBA 3IA7A 4M9ZA 4ZTUB 3IH5A 2TMKA 1U0RA 3DGEC 1B2LA 1TAHA 3DQPA 1MJGM 3FRJA 3LGAA 3OZVA 4G01B 4OTZA 3CZPA 3OZUA 3GJ3A 5BT9A 1RZRA 2VUSA 1AX9A 3JQDA 4X7MA 2BM8A 1H2EA 1ZD8A 3CKLA 3DHVA 1LZKA 1SA0B 3K9CA 1FPQA 2K94A 1HRDA 1OZAA 1VPLA 2DJIA 1Y48E 1R8JA 2G83A 2WUFA 3CGWA 3BB3A 1M2GA 3FOBA 5F1KA 2Q6IA 3SXUA 5BQFA 2Q5OA 3G0DA 2H06A 5KSOA 5L4NA 4XGQA 3GN2A 1ZQ1A 3TLGA 1SUIA 1TCBA 1UUFA 1ZM2A 2OAEA 3L46A 4P58A 1Q0TA 1E2HA 1XZHA 4BASA 4PG4A 2G9QA 2MU1A 1X87A 1GNQA 9LDBA 3FZQA 4EGQA 4PCVA 3ZW9A 3EDYA 1MRSA 3RFFA 1YVDA 3EF1A 3GXOA 3K2QA 4QQFA 1TZKA 3O91A 3DMYA 4NYMQ 5JR3A 1E60A 3HYRA 2E4XA 2Y0EA 2ISCA 1DG3A 1JIUA 1XHLA 3R5FA 3H9BA 3UCFA 2AQIA 5K6AA 2PUDA 1SQSA 3L02A 2PEQA 5T4BA 3AP3A 4NBWA 1QIFA 4NICA 3UAVA 4C01A 4E08A 3DDOA 5KYYB 3SP1A 1XQ9A 1VJ0A 5HKAA 2LCFA 4O59O 5FTNA 4TTTS 3P0HA 3P9NA 3ZV5A 4E5KA 2BFWA 1UWKA 1X1QA 4CIBA 3ZD9A 2L82A 2ZYVX 3RVSA 5JAQA 3GPIA 1PV2A 4FHGA 4TQ9A 2Z45A 1T1RA 5FJIA 5BN4B 4E5SA 4V1CI 3BMNA 3KFVA 3T6KA 3ZLBA 1NWHA 3IULA 3PPYA 2QMQA 4M9SA 5LDGA 3AEKB 3ESYA 1TU4A 2PLWA 4JXKA 4UUOA 5L3QB 4C3UA 3PC3A 2PUCA 1JG7A 2DR2A 1V3VA 4RVGA 2JLXA 4WCDA 2CNWD 4HN9A 4DV1B 4UU7A 2GBLC 3BN3A 4DBLC 4IWYA 4AQYB 1P77A 4PU0A 5F7OA 3F1LA 4EKYA 3RJTA 3TRDA 1U8UA 2E9SA 4UCXA 4CTKA 5HJ2A 4GI2A 4D8WA 1CUIA 3LQYA 3ZE6A 1XZEA 3FR7A 1AKYA 4LECA 4MROA 3VPXA 4HAXA 1QHSA 3DEYX 5D1HA 1XCGB 1THMA 3ZCVA 4N7RA 1JSCA 2HF2A 1R9GA 4CQMA 2P4SA 2ZP1A 1Q3TA 4M37A 4BPGA 4L0MA 3MINB 4NIMA 4TMTA 2OORC 5JDIC 1YV9A 3ZWYA 2O59A 3JYLA 3OCYA 1GLVA 4KJXA 5FYQA 5T4FA 1VMAA 3M6FA 3OQ6A 1CUGA 5A9RA 4EJ2A 2DBRA 1RYZA 2Q99A 2WHQA 3ZOKA 2UU9B 2VWQA 4UOZA 1Y8CA 2FZGA 1DL5A 4RF5A 4H7JA 5AKIA 2NYAA 5IVIA 1J2JA 2AEFA 1B42A 2GDWA 3ZC3A 1OA1A 1ST2A 4MGZR 2KGEA 3KUKA 1M3SA 4B6RA 1WKCA 1J90A 1K8QA 3F6SA 4WKBA 1UKYA 4YNBA 1DELA 3W9SA 1YCHA 1RJEA 1NN5A 4B3CA 3BZUA 2B9EA 2PZAA 4RKEA 3EXFB 4E2YA 5CJJA 4EF5A 4M1QA 5CYGA 4QZVA 1E0DA 5ULLA 4RY8A 2BPOA 5L6LB 5B30A 1M66A 4FINA 2HJGA 3P0EA 4WXEA 2HRZA 3GZ4A 3E9NA 4XAQA 4WJKB 2ZAIA 2MY5A 1DB3A 2AC7A 1OYYA 3SHVA 2F55A 2AOUB 1C8LA 1YS7A 2OA0A 4PF1A 2E4YA 1R37A 3RFUA 4FB4A 2CJYA 4YB8A 2FUG6 1L5RA 3MGGA 3BXOA 3MS2A 2HN9A 4AZ3B 4HWOA 2B4QA 1YQEA 2AG8A 2YRXA 3R6DA 3A3YA 4C6HA 1WWKA 2RJOA 2O19A 4LE2A 2XE8A 4HH4A 3P2JA 5J59A 5HMMA 2EW2A 3GFOA 4M87A 1XE3A 2VKTA 5DMXA 3TB4A 2D4HA 1TLTA 5ILGA 5EE0A 2BKVA 3BJMA 4GDMA 5HQJA 3HCDA 3TEJA