The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
129
|
sequence length |
377
|
structure length |
348
|
Chain Sequence |
LQEVLHMNGTSYAKNSSYNLFLIRVKPVLEQCIQELLRANLPNINKCFKVGDLGCASGPNTFSTVRDIVQSIDKVPTIQIFLNDLFQNDFNSVFKLLPSFYRNLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLHWLSQVPSGISVNKGCIYSSKASRPPIQKAYLDQFTKDFTTFLRIHSEELISRGRMLLTFICKEDEFDHPNSMDLLEMSINDLVIEGHLEEEKLDSFNVPIYAPSTEEVKRIVEEEGSFEILYLETFNAPYDAGFSISPVSCDEHARAAHVASVVRSIYEPILASHFGEAILPDLSHRIAKNAAKVLRSGKGFYDSVIISLAKKP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The structure of two N-methyltransferases from the caffeine biosynthetic pathway
pubmed doi rcsb |
molecule tags |
Transferase
|
source organism |
Coffea canephora
|
molecule keywords |
3,7-dimethylxanthine methyltransferase
|
total genus |
129
|
structure length |
348
|
sequence length |
377
|
ec nomenclature |
ec
2.1.1.160: Caffeine synthase. |
pdb deposition date | 2007-02-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03492 | Methyltransf_7 | SAM dependent carboxyl methyltransferase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A | Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Vaccinia Virus protein VP39 |