2EFJA

The structure of 1,7 dimethylxanthine methyltransferase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
377
structure length
348
Chain Sequence
LQEVLHMNGTSYAKNSSYNLFLIRVKPVLEQCIQELLRANLPNINKCFKVGDLGCASGPNTFSTVRDIVQSIDKVPTIQIFLNDLFQNDFNSVFKLLPSFYRNLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLHWLSQVPSGISVNKGCIYSSKASRPPIQKAYLDQFTKDFTTFLRIHSEELISRGRMLLTFICKEDEFDHPNSMDLLEMSINDLVIEGHLEEEKLDSFNVPIYAPSTEEVKRIVEEEGSFEILYLETFNAPYDAGFSISPVSCDEHARAAHVASVVRSIYEPILASHFGEAILPDLSHRIAKNAAKVLRSGKGFYDSVIISLAKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3,7-dimethylxanthine methyltransferase
publication title The structure of two N-methyltransferases from the caffeine biosynthetic pathway
pubmed doi rcsb
source organism Coffea canephora
molecule tags Transferase
total genus 129
structure length 348
sequence length 377
ec nomenclature ec 2.1.1.160: Caffeine synthase.
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03492 Methyltransf_7 SAM dependent carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.270 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2efjA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2efjA02
4C08A 1R8XA 4E33A 3UA4A 3CJRA 1X19A 3NVMB 5CIYA 1G6Q1 3FUVA 3DMHA 1RI2A 2YTZA 3GJYA 1EQAA 3FTEA 3SR4A 1D2HA 1JQ3A 2PX8A 3A27A 3BUSA 2FYTA 3EVBA 3KQPA 4GC9A 4RYLA 2AN4A 5ICCA 2P8JA 3D2LA 3KQYA 4DKJA 3HTXA 1EIZA 3ELUA 4M38A 4RTNA 5DX0A 3SSMA 1XDZA 2WA2A 4F86A 3B7PA 3EVEA 1I9GA 1QANA 3A25A 3GIWA 5E1BA 4OX9Y 1G8SA 3LL7A 3FRIA 2ONYA 1NT2A 3GWZA 1PRYA 3HCCA 4PYLA 2H11A 2QY6A 4R6XA 3TOSA 4B17A 5ICGA 1O9HA 4OQEA 2LD4A 3A7EA 1XVAA 2ZSUA 5FA5A 3SMQA 5DSTA 2IH2A 4X1OA 1NW3A 2QM3A 3KQWA 5E1MA 3SGLA 2G70A 2HV9A 2Q41A 4IKPA 3KR0A 4GOMD 2BR5A 5HILA 4AX8A 4PIMA 5M5BA 3LSTA 3PB3A 4YV0A 2BH2A 3M4XA 4BP1A 2ZW9A 2JG3A 1NKVA 5CVJA 1ORIA 5EQJB 2B2CA 2FRXA 4GQBA 1SQGA 5IH3A 4E2XA 5MHTA 1ORHA 5FADA 4P7FA 2PBFA 5K05A 2G1PA 1EG2A 4YMHA 2IH5A 4YUZA 3BWMA 3LDFA 1DCTA 5DRTA 2FK7A 5K0LA 3SM3A 2VS1A 5LSAA 3FZGA 3PVCA 2NYUA 4E30A 2OPBA 5E9WA 5LQCA 3FUUA 3FTFA 3OZTA 3A26A 1V39A 2UYQA 2XYVA 5EIWA 1ZG3A 2NXNA 3G5LA 1X1DA 4AZSA 4DM3A 2C7OA 4Z2YA 3MTIA 2VDWA 3EVAA 3FPFA 3OZRA 4RX1A 4DCGA 5K8VA 2ORED 2NP6A 2OY0A 3VSEA 3HM2A 5FWAA 3PX2A 4IV0A 3C6MA 5DXAA 2Z6AA 5ICEA 4GF5A 2WK1A 3DLCA 3BZBA 4QVGA 5GOZA 2AOXA 4EKIA 5LQNA 3KQVA 1L3IA 2AN3A 3NWEA 5HOQA 2YXEA 3HA5A 3Q7EA 4G56A 3A4TA 4RWZA 1RI1A 2PX5A 5T6BA 4XUDA 1N7JA 4R8SA 4ATNA 3VC1A 1SUSA 2P1DA 3TRKA 1SKMA 2G71A 2OB2A 5FQOA 1INLA 2JH8A 3AY0A 5K09A 4DZRA 4RTOA 4C03A 4PGHA 2AOWA 3PX3A 5DTMA 2IP2A 4YV2A 1RJGA 4L7VA 3RW9A 2CL5A 4OBWA 4RTRA 1YZHA 2K4MA 4M7RA 2HTEA 3CJQA 3FRHA 1DUSA 4KW7A 4P7GA 4V0QA 5B1SA 4DMGA 4RTJA 2H00A 4F85A 2ZIEA 1EJ6A 3HCDA 2E5WA 2R3SA 4QTTB 4H0NA 3WSTA 2EFJA 4AZTA 3P8ZA 1VE3A 1WS6A 3I64A 4A6EA 1R8YA 1RI3A 4HTFB 5CVDA 5EKUA 1EJ0A 4E2WA 1WXXA 5K0JA 1BHJA 4QQKA 2AS0A 1X1BA 3GRZA 2WA1A 4RVDA 3EGVA 4YUVA 1EAMA 3EPPA 4X61A 1QAMA 4M37A 5EEHA 3IV6A 2YR0A 4GOLD 5P8WA 5K01A 1I4WA 4AZVA 1NV9A 1KXZA 3MCTA 3OFJA 4M36A 3B89A 4AUKA 2Y1XA 3HEMA 1R6AA 3I58A 3LHDA 3I53A 2ZCJA 1JSZA 4MQ4A 2AOVA 3ER8A 1MJFA 4O29A 5DXJA 3SX0A 1RJEA 3EVZA 3K0BA 3KR1A 3OPNA 3P9NA 3SXJA 4ER3A 3TMAA 3EVFA 3K6RA 5DM4A 5FCDA 3G5TA 5DWQA 2ZIFA 3P9CA 2ZVJA 2GB4A 1P1CA 1WY7A 2PVCA 1B42A 2ZZKA 4DCMA 4RTKA 3G8AA 1YZ3A 4RTPA 3DLIA 2I6GA 2PY6A 1KR5A 5LQKA 5GINE 3UJ8A 1ZQ9A 2N47A 2PKWA 2R6ZA 1TW3A 3B3GA 3DH0A 5CVUA 2PJDA 3P9KA 4QQNA 3LDGA 3DMFA 3FTDA 1G55A 1I1NA 2IPXA 1G60A 1X1AA 2BR4A 2YQZA 3LPMA 4QDJA 1UWVA 3ID6C 4PYNA 3OFKA 1SQFA 8MHTA 3ELDA 5FULA 5HIMA 5GM2A 4CTKA 3HCAA 4X63A 2QE6A 3X0DA 1JR4A 5BW4A 1Y8CA 3CGGA 3AXSA 1ZHFA 3ELYA 3EVGA 3PFGA 4HH4A 2P3QA 4HSGA 3NJRA 5EIFA 5DM2A 5FHRA 2A14A 5HFJA 5C0OE 4HG2A 3REOA 3KQOA 2V74B 3KPVA 5DLYA 1WZNA 5F2OA 1M6YA 5GM1A 2YVLA 3BT7A 3EVDA 3P97A 1T43A 5KQSA 1D2GA 2IDKA 1QAOA 3LKDA 1QAQA 2CWWA 2Z6UA 3BXOA 4CKCA 3JWHA 3CJTA 2HWKA 1UIRA 2PT9A 3DMGA 3T7TA 1VP3A 3HP7A 3EMBA 1NW8A 3MQ2A 5G02A 1YFLA 1H1DA 4OQDA 1L3CA 5LQAA 4QDKA 9MHTA 3FYDA 3M6XA 3TR6A 1KHHA 2JH9A 1AV6A 3HA7A 5CCXA 2P3OA 5FQNA 3M33A 3G8BA 3DULA 2PX2A 3HVIA 4HC4A 3TKYA 4EMSA 1FP1D 4HTFA 1JG3A 3C3YA 1G8AA 3E7PA 5K0FA 3EEOA 3KQTA 4KVZA 5EMMA 1HMYA 1JSXA 2AOUB 3BWBA 2Y1WA 4E32A 3PTAA 3DUWA 4C04A 1WG8A 4P7JA 2P7HA 3GNLA 2OYRA 4GBED 2G72A 5GIOE 5D1NA 3G2MA 4E2YA 3R24A 3G7UA 4R6WA 3SSOA 1JQEA 2DULA 5HIJA 4PIPA 3MERA 3TQSA 3DP7A 5EVJA 4KIGA 4ER6A 1XDSA 1VLMA 1P1BA 4YUYA 4P58A 2PLWA 3HVHA 3TPZA 5GWXA 1VPTA 4PYQA 3BWCA 1L1EA 2IIPA 5HEKA 5FUBA 3KPJA 3MCZA 4LWPA 5BW5A 4U7PB 5DM1A 5K0CA 3P2EA 4RSRA 4RVHA 4OBXA 2YUIA 4PYJA 2KW5A 1XTPA 3DXYA 3LCCA 3LDUA 3V8VA 1BC5A 3LKZA 4BY9E 4RV9A 2BM8A 3CBGA 3FPHA 4YV1A 2Z6QA 1RI5A 4RTQA 2C7PA 5HIIA 1FJXA 1R00A 3I9FA 5EG5A 3UJ7A 3Q87B 3HVKA 3RODA 5BXYA 3DXXA 4KDRA 5EMKA 1JG4A 3LGAA 2CKDA 3G2QA 4QPPA 4K6MA 5KS2A 2PWYA 3NW9A 5LR6A 2NXCA 3OZSA 4MWZA 4ER5A 5HZMA 3T7SA 4AZWA 3P9IA 2CMHA 2I62A 1BOOA 3DOUA 4LWOA 4E31A 2BZGA 5K0BA 3H2BA 1Z3CA 4QVKA 3TM5A 3UJDA 4YMGA 2ZBRA 2ZZMA 5ICFA 2O0LA 2AOTB 1NV8A 3HCFA 3KU1A 2GH1A 4PYIA 1NW7A 2IDJA 4BP3A 1F38A 3HA3A 4NECA 5FHQA 1N2XA 2PX4A 5JR3A 1ZGJA 1JTFA 1IM8A 1YUBA 2AVDA 4GEKA 3OE5A 3NTVA 4KDCA 2QYOA 4LECA 5GIPE 4P7KA 5DT2A 3G2PA 3LECA 3QOWA 3GGDA 2ONZA 7MHTA 2P3LA 1SG9A 2VDUE 2ZFUA 5DTQA 1TPYA 3AJDA 1N7IA 3KQSA 1ZGAA 4X60A 1R18A 4XUCA 5F2NA 5C1IA 1Q0SA 3GRRA 2ZWAA 5F2KA 1DL5A 3SVZA 1KPIA 1SVUA 3QV2A 5DTRA 4FT4A 5CVEA 5HIKA 3FPEA 3UZUA 4RTLA 4KRGA 4U7TB 1RJDA 2EX4A 1AQJA 1O54A 5KVAA 4KIFA 1P91A 4F84A 3LCVB 2IBSA 3CC8A 3TKAA 3GO4A 2OKCA 2ZWVA 2PXXA 2AOUA 5E9QA 1KP9A 3FTCA 1XDUA 1L9KA 5LQRA 3EVCA 10MHA 2NXJA 1RJFA 3PT9A 4PCLA 2ESRA 5K0EA 3M6UA 4PYMA 4BLUA 4IV8A 5CVVA 5DX1A 4UOEA 4CTJA 3IHTA 4FSXA 2OB1A 3CVOA 1VL5A 4FZVA 5D1HA 4C4AA 3GU3A 3UJBA 3FPGA 3UJCA 3TLJA 3UA3A 2IFTA 4CKEA 1XXLA 2JJQA 2HR1A 4OA8A 3ERCA 2AVNA 3UBTA 5DPMA 3BWYA 4CKBA 4HGYA 2IGTA 3R6TA 4MIKA 2UZ4A 3R9XB 1YF3A 4E2ZA 5GP1A 2PXAA 3MHTA 3G2OA 1AQIA 2QRVB 5EC8A 3ANXA 2JHPA 3LBFA 4CWAA 3VC2A 2ZIGA 3FYCA 1WXWA 3KHKA 4C05A 3UJ6A 2GS9A 2ZULA 4HGZA 3SSNA 3U81A 3NVKI 3AXTA 2PWPA 3LBYA 2GLUA 4GOOD 3GXOA 5K0NA 3RIEA 2G8NA 1M6EX 1BKYA 5LQUA 5EMJA 1M0EA 4Y2HA 1JQDA 1RI4A 3T0IA 3VYWA 2AZTA 1NW5A 3C0KA 3G88A 2JHCA 3R0QA 4GOND 2AOTA 2XVMA 4ZTBA 4MTLA 1G38A 2YXDA 3FUXA 3UFBA 3PLAE 5DM0A 1IY9A 1KYWA 2UYOA 5T67A 1D2CA 4JXJA 4WXHA 1X1CA 2IH4A 3LCUA 3THSA 3GRVA 3O4FA 3P71T 2B9EA 1NBHA 4PCAA 3A7DA 4POOA 3JWGA 5E2BA 3KR9A 3BGVA 3THRA 3UWPA 5KYGA 2PV0A 3BKXA 4YUXA 3DTNA 5EMLA 2P41A 3O7WA 1JG1A 5JUWA 4RTSA 2O05A 1NBIA 2YX1A 1OR8A 2ZTHA 2XBMA 3GCZA 4R8RA 2OZVA 4PONA 1YB2A 2ADMA 2ZLBA 3BGIA 1XJ5A 5EGSA 5EKXA 2NP7A 4YUWA 3OU6A 5E8JA 3EGEA 5E1OA 5CM2Z 2O06A 3EMDA 4OA5A 3NDIA 3OU2A 5E8RA 2P40A 3MTEA 3KPUA 4EKGA 4ER7A 4ER0A 1JTEA 5CD1A 4DA4A 2VP3A 3O31A 2ZZNA 2F8LA 4FSDA 2I9KA 1VIDA 3HCEA 2VDVE 3T7RA 1KPHA 4C06A 4ISCA 4XCXA 3MAGA 3EGIA 1UFKA 2I7CA 2PT6A 3OE4A 2NNWB 3OCJA 4GUAA 5ERGB 4LG1A 3ER9A 3C6KA 3ORHA 2XYRA 5H02A 1O9GA 3G89A 1U2ZA 4A6DA 4PNEA 3M6VA 4KWCA 4V0RA 3V97A 3JWIA 2H1RA 4DQ0A 4HRAA 2UYCA 1TW2A 2CMGA 4RVGA 5T64A 5E1DA 3B3FA 2FPOA 2QRVA 3B5IA 1MHTA 4EK9A 3FUTA 3M70A 4FGZA 4DF3A 1FBNA 4FP9A 1QYRA 1YFJA 2AN5A 1KPGA 3NWBA 3CKKA 1Q0TA 4C07A 2NXEA 3C3PA 3F4KA 2FCAA 2P35A 3GDHA 5EHGA 1L3BA 4IWNA 5DRYA 3L8DA 4GC5A 5EEGA 2ZBPA 4E70A 1F3LA 3KQQA 5EOVA 3KQMA 5U4XA 3KPWA 5EPEA 2HNKA 3IEIA 1IXKA 2PSSA 3EEYA 3KKZA 3IYLW 3R3HA 2C7QA 3MB5A 5E9JA 2XYQA 1SUIA 2GAFA 2DPMA 2V7EA 4XUEA 4MHTA 4R05A 4PGGA 2HMYB 2OO3A 2EJTA 4BLWA 4PYOA 1NW6A 2FK8A 2GA9A 3NDJA 4PWYA 2GPYA 3UJAA 1KYZA 5DX8A 4FR0A 3P2IA 3E8SA 3QOXA 4EQZA 3AWIA 1AF7A 3GRYA 5IKMA 2C7RA 4BLVA 3ME5A 3JWJA 1JG2A 2YXLA 2OXTA 2B25A 3HNRA 2PXCA 2FHPA 2ZBQA 3PS9A 2ERCA 1KIAA 3DR5A 3M6WA 3E23A 3LX6A 4Y30A 2UYHA 5C9ZA 3KPYA 5FTWA 5EZSA 2B3TA 1VQ1A 3CCFA 3BGDA 3DXZA 4PINA 4FS8A 1VBFA 2B78A 2BR3A 2EJUA 1VP9A 1XCLA 5KQRA 1NE2A 3BKWA 2AR0A 2XVAA 4FT2A 3FPJA 3ELWA 4QPNA 4RVFA 5CUQA 5DSXA 5EHIA 2OBFA 1QZZA 5K0GA 3GRUA 2VZ9A 2BM9A 4RTMA 1FP2A 2O57A 1R74A 4PYKA 3MGGA 5BP7A 1FPQA 3B3JA 2JHAA 1P39A 5LQJA 4EVIA 3P2KA 5FWDA 1HNNA 3OU7A 4CXMA 3KR2A 5EZQA 2PGXA 1PJZA 5FA8A 3TFWA 5K03A 5CCBA 5E2AA 4WVLA 2EG5A 1XCJA 3PFHA 1ZKDA 2P7IA 3E05A 3I5UA 2IBTA 2O07A 4QTUB 4X41A 3S68A 3HCBA 3HVJA 3FUWA 3TM4A 3NMUF 3UJ9A
chains in the Genus database with same CATH superfamily
4IQ8A 2RSLA 2IHKA 2VL7A 4M9ZA 3FD8A 2C2GA 5D01A 1JIVA 2C3YA 4BB0A 1CUAA 2C94A 1R0RE 2RH4A 3FUVA 4AXXA 2J30A 3VVCA 1V16B 4Y2XA 3SQDA 3CR3C 2UVPA 4QXQA 4HEHA 3OMLA 2Q1XA 4GE0A 4PAGA 1UT5A 5IYZA 1K98A 1OVGA 1T1RA 1U7XA 3FNBA 5DN9A 5FFFA 1XDZA 2ZCUA 3Q9NA 2BKEA 2OD7A 4UEWA 4UM7A 4CFYA 2HFJA 4HS4A 2BD0A 3AHEA 3F49S 4U0EA 4Y2QA 4EG7A 1L4UA 1EVLA 4IFTA 2CNWD 2D2XA 3ZHRA 5A9SA 4POAA 3N3AC 3TOSA 3FF4A 1KBQA 1E4OA 3FYUC 3T4EA 4F93B 1PNVA 3OOHA 3ORYA 2CNBA 3QW4B 4ZI7A 1UPBA 1DRWA 3GL9A 3IQWA 2VUHB 5A05A 2HHAA 3ZW8A 2XXBA 4C4ZA 3S70A 1AQYA 3OUTA 4R40A 2PD6A 3SNKA 4A36A 2IUYA 1DBVO 1J8FA 1UAYA 2IYFA 2NACA 3KR0A 2BR5A 4QT4A 4PAWA 4ZCRA 5M5BA 3WMWA 2BH2A 5H0IA 2ZBVA 2PX0A 3MD9A 3OC0A 1HSOA 3JALA 3N2NA 4I99A 4EA6A 5EGNA 4ZIRA 4XB2A 4ZVSA 1AA9A 5LBTA 3KAQA 5HE8A 2FN3A 2FPLA 3HV0A 1A9TA 1TVKB 4K86A 1YOVB 5JWRA 1XCMA 2CCGA 4JU9A 3ACDA 3M6FA 4BDTA 4CL0A 2XGMA 3COJA 1QIKA 2GBLA 4U0CA 3WLAA 3WLTA 3U1BA 3OOYA 5K6TA 1Y5LA 3OOSA 1O58A 1ADJA 4XYBA 1EZ4A 1OWPA 2DJ5A 1JIXA 4U0FA 1PI3A 1M66A 1PNOA 3F6YA 4LEIA 3NBMA 4K7JA 3KUXA 4AULA 2QRNA 1IPEA 2HKIA 5H83A 4Z2YA 4URWR 2N5HA 3QV1A 4TWRA 5CFPA 5KHOC 3WQQA 3I23A 3PPWA 3R6WA 1PNRA 3IUYA 3DTTA 1S3IA 3H13A 1IATA 1SZDA 4GI7A 3NUGA 4MVWA 5B4VA 1TM3E 2Z58A 2BGJA 1WDMA 1UT6A 1VA4A 3DLCA 1GFSA 4O2BB 4DLUA 1AS3A 1FU4A 1F7UA 4MIOA 4DCNA 2OVBA 1YR3A 4JENA 3H4IA 3BAFA 1L4NA 3HN7A 4GVLA 4N3AA 4OHYA 1LV8A 3TTWA 1NSFA 4EJFA 3P32A 1DC3A 4RZ3A 1RWQA 3K8ZA 4PX3A 3OJWA 1JHOA 5FBRB 3OZWA 7AT1A 4RVCA 3T9FA 4RTOA 4QAQA 4PGHA 4D3SA 2PRSA 4PG4A 2QJFA 4Z54A 2XMQA 5L7TA 3V42A 3RW9A 4OBWA 1M5RA 2I80A 4Y8VA 4MQMA 1JA1A 2DTDA 4BPRA 2GHRA 1V37A 2O7RA 3DOJA 4DMGA 4DV4B 1D2NA 2OHFA 1FU7A 1SUEA 1QX3A 1WNTA 3HBNA 3HCDA 3K6KA 3KB1A 4QPDA 3RHSA 3TUIC 4LMRA 4ZI2A 4AJNA 1QIEA 2H54A 3OPVA 1VE3A 1WS6A 1IQ0A 3TDKA 4E7PA 2KORA 3WKAA 3KLNA 4CBVA 3OOWA 1U9YA 2FQQA 4PLHA 1RQ2A 1E1YA 2AXEA 4J07A 1S9DA 3HY6A 2R6AA 3OM9A 1GDDA 4D99A 2FZCA 4HRXA 1JZSA 3KLMX 1DTEA 1EQUA 2G6BA 5HPYB 2DP4E 2ONJA 4WLOA 4AUNA 1C3XA 4J4BA 4JDUA 3L5OA 5KNDH 2N98A 2IYEA 1QAMA 4C7KA 2XD9A 3E3AA 2YR0A 5DH9A 4A5SA 5JCOA 3K9HA 4JLWA 4CN8A 4BL5A 4LNUB 4LOLA 1F9AA 1ZJ4A 1KAHA 3ND5A 5JS6A 1E6CA 1RAHA 1Z2PX 1QRTA 2XB4A 5K3CA 1Q0LA 2XR1A 2JBWA 4CM6A 1NG1A 3DGFC 3CCVP 4BCBA 3TXXA 4ZC8A 2CFCA 1QU3A 5E3JA 1YGYA 3I6ZA 4YI5A 3R74A 1LA2A 4RU1A 5DWQA 4BO0A 3OVMA 4UARA 1ZMRA 2BDUA 3P9CA 1JEYB 7CEIA 3RVRA 3H5RA 3ZE8A 4G0PA 2WSSA 4ZU6X 3IO3A 3G8AA 4OQPA 5T7BA 1FC0A 3REGA 4W7IA 4REQA 2ZIUB 3D8HA 4K6FA 4UXIA 3V4SA 1I7QB 4ARCA 4B7XA 1KYVA 2R6ZA 3EW7A 3OE7A 2F43A 5AJYA 3UAXA 3UW1A 5EP1A 2ZDGA 4IIDA 4GBMA 1I1NA 2QTAA 1T4DA 4MRMB 1Y8QA 3U39A 3TQRA 3GFQA 3ID6C 3WBFA 2FU5C 3UK6A 2IZ6A 2BBOA 3VO1A 4BUZA 4H6PA 4X63A 5KSZA 1QHGA 1JR4A 3QLJA 4RO0A 3PNSA 1SG0A 4LOHA 1RXVA 4TV9F 2GZEA 1K6XA 1A4XA 1KQ3A 1T8WA 1J97A 1U3CA 2ALJA 1QV6A 2DHCA 2R1ZA 3PEUA 4HH4A 4PSKA 5C0OE 3R7WB 3RVSA 5AW3A 2B8EA 2H9IA 4PZCA 3TNDA 1WZNA 1WV0A 5F2OA 3ISTA 4B35A 4KEAA 5LYJB 2DGYA 1IDN1 4CTMA 1O95D 2CWWA 4B4UA 2J6CA 3ZUGA 2WE7A 3ET4A 1N5RA 2Z4RA 1HOXA 3NKVA 4C1NA 1H0KA 3IIEA 1Z16A 4GR9A 3ZJVA 4MV3A 3HPQA 3I04A 4OQDA 4XSGA 1BMFA 1U1GA 9MHTA 4Y1FA 2Z45A 3WZ2A 3T1YB 1G5PA 5CCXA 2EF1A 2HXYA 4NOJA 2P3OA 3G8BA 3O9VA 3REFA 2P9TA 5IT9A 3TKYA 1L6RA 1JBKA 1HF3A 1W94A 1U0GA 1CF2O 2J9GA 3SHFA 1Q86Q 2ECPA 2X0NA 1U5CA 1BGXT 3FSEA 3QE3A 1GNSA 5BVHA 3IBYA 4NG4A 1W4ZA 3BD7A 1FX1A 1G9XA 2AKYA 4I9UA 4YQZA 3UT5B 3JQEA 4KKVA 5IVDA 5BUZA 2RGEA 4GD3Q 1U8AA 2O3RA 1SCBA 4XQEA 5CJJA 2P2LA 3FTPA 2MR8A 5EQFA 3DOOA 5I4TG 2YMPA 3OLYA 3UHJA 2PYIA 3A3NA 1V8DA 1KO4A 1JHYA 2C97A 2JIQA 2QW1A 2VAPA 3G4SP 2PWZA 1N4DA 2FPGB 2N6ZA 1KI4A 3DOHA 3I4FA 4NZ9A 4P0TA 3CY6A 4WESB 4YJKA 4BJ1A 2VJYA 1SK9A 4CQLA 4DPKA 4FOTA 3J81k 1PT8A 4V0SA 3ZWWA 2EQBA 1XCOA 4ZDJA 2DYKA 4AJHA 5FLYA 4F9GA 2HRCA 1IZZA 1EFKA 4D57A 2XUGA 4NI5A 4KSCA 1UFQA 2EBFX 1FJXA 1DAFA 1M2OB 5K8JB 3OA0A 3AR4A 3Q87B 1MAHA 4D02A 5T4EA 4BQNA 4YRZA 2WFZA 3DS5A 2JD0A 4NBRA 4CT4B 1OJLA 1LWNA 1U99A 3NOQA 4NJEA 1XQXA 4YJFA 4DLKA 4DR7B 2W00A 2INGX 3BL8A 1MZVA 1NQTA 2NXCA 3TLBA 1M67A 2MR6A 3IOYA 4XGIA 1C80A 1G8FA 3OX1A 4E31A 5TVKA 4BFYA 1FDSA 1XZJA 1Z3CA 1FS4A 3GMDA 3UMVA 3B2EA 3WGLA 4AJEA 4B79A 3VHRA 3I2HA 2PGAA 4U4AA 3UMFA 1AF8A 4C6TA 3AL3A 4RK0A 5B3JC 2GFIA 5A3SA 8ATCA 3E2DA 1T34A 2C5HA 3U4QB 4FFMA 4LWQA 1PQPA 1IM8A 2IEAA 2MYTA 4HY3A 4M0CA 3C7KA 1H2AS 1BX1A 4A9AA 2G80A 4E13A 2VNAA 1PQYA 4LHZA 2A9OA 2CL7X 2CUNA 2QYSA 2WIKA 1G8PA 4R9RA 5BWOA 5C1OA 2WBLC 2B94A 1SXHA 3BXPA 1CSEE 4QYIB 5BR1A 2BTQB 3N6VA 4FT4A 5CVEA 1WHTA 1GTSA 1KSGA 5KNCH 1Z7BA 1YC5A 2HWWA 2YWHA 4MQFA 4CQJA 1C7ZA 3OIGA 2ODBA 5F3WB 1AQJA 4YAKA 4RY2A 1EDOA 5A6VA 2WJHA 4RD2A 3U9SA 1FS5A 1VHTA 1VHWA 2QGZA 3T52A 1XDUA 3MIIA 10MHA 4Q3BA 5BRJA 1EXMA 5EE5B 5LMUB 5C8YF 4KIWA 3NTXA 2HDWA 4G0QA 2IHZA 4NV1A 4UHPB 4O59O 4H3SA 4A5OA 3PSHA 2VC2B 3KK0A 1U11A 4RHFA 5D1HA 1UDXA 2DT8A 1NBWB 2KM1A 4J1QA 5BXQC 1DQPA 1P5HA 3TLAA 1VPVA 4ZVPA 3ZHUA 5IVPA 1IONA 1WR8A 3DHVA 2I7XA 2IS2A 1JMYA 3R3XA 4TT8A 2HR1A 2CBZA 1XJWA 1YQXA 4KVFA 2R48A 3ISVA 3JTMA 2AVNA 3VR6A 3ZOZA 2ZVDA 2RC6A 1YUMA 4KFUA 1QTIA 2A2ZA 3D6TB 4DMCA 1UAGA 4RPHA 1U7UA 3ZBUA 4GYWA 2PL5A 5A4AA 1J0AA 1V96A 2YVQA 5C18A 3MHTA 2EWMA 2EFYA 3PIDA 5LP6B 3LQQA 2G0TA 1TYDE 2A7QA 3DE5X 3NTOA 4AY2A 1W47A 4S35A 3QITA 2EFDB 4DMUB 3WWCA 5ENVA 5HKKA 1DCFA 4WI1A 1Z4NA 1RSZA 4WBSA 4RS4A 5KU1A 3ZBTA 1BKYA 1G2PA 1IMJA 4G1FA 4CEHA 4WFKA 1QX4A 5TGDA 2H0RA 4GWLA 3ZD6A 2FXVA 2JHCA 1YFZA 2A30A 4CA3A 3N5CA 4KN9S 1WDTA 4N3CA 3LP5A 4UUPA 4Z7JA 4NYJQ 4HQ0A 4XRRA 5D3QA 4B3HA 5HZKA 4Q03A 3K2IA 1KS2A 2HT6A 1EX7A 1BCSA 2AYXA 5CH5A 3QEMB 3W79A 3STVA 4PPNA 3HC7A 1AQ6A 2B61A 1CEQA 4FOOA 3GRVA 5TF0A 1NF2A 4U8HA 4YCBA 1H3NA 5KEIA 3DNPA 4JL6A 5DNUA 4FYXA 5E2BA 4XR9A 5AKEA 9GPBA 1C1DB 1OC4A 4N1AA 1MG5A 5FL7D 4YEDA 1AD2A 1RVDA 1R9NA 3BGSA 3K9NA 2A1TR 4ZYUA 4HWPA 1PJQA 4RTSA 2FP4B 4LF4B 5IJ0A 4A8TA 4FJ0A 1T0JB 2Q6LA 4OHRA 4EUKA 4Q16A 3ROFA 3O8QB 3PJFA 1OLXA 1OQAA 5HRCA 1LK7A 2XCRB 3C7CB 2EFCB 2JK0A 2ZBEA 5IKPA 1F1BA 1M2WA 2HA7A 4C0JA 1NJ2A 5H68A 4DMFA 4H77A 2FR1A 2CNKA 2R2AA 1C8BA 1UKAA 2WTNA 4I4IA 4QJIA 5G41A 4EKGA 4EG5A 1APBA 2J5RA 1G291 4J16C 5BR7A 3R40A 3HDJA 3H11B 4IO0A 2FVYA 5KTTA 3RS4A 5BWCA 1ESNA 4X1IA 3GG2A 4QG7A 3CF4G 5K8UA 2X9GA 3L4EA 4FFLA 4XCXA 1GPLA 2AJBA 2I7CA 5BORA 3CHYA 3WY9A 3NV7A 4DT1A 4WOCA 5HQ3B 3K2EA 1F06A 2C0PA 5TGZA 3LQFA 1MC4A 3ZH2A 4MROA 3EGDA 4EA7A 1X8JA 2GZIA 1I01A 1ZH2A 1B73A 2ZGVA 4B2LA 2QF7A 4HRAA 3F9IA 3OPYI 2BI8A 1C41A 2IXTA 2VFAA 3JAKA 3R09A 5A6SB 3UPDA 4WIAA 1DFHA 1F5NA 2Q0SA 2WTUA 3PI6A 2Q3FA 4JBLA 3WWEA 1DC5A 4MKZA 2L0QA 1JHQA 1V48A 1ZNZA 3LWNA 3QYPA 3V1TC 1LDEA 2AN5A 1FUYB 1KPGA 5JZMA 1H2RS 2QRLA 3FDXA 5EUBA 1JLMA 1CZUA 3CFYA 1XA3A 3RO7A 3VUFA 3K96A 4O2AB 2J3JA 3KEGA 4D0RA 3L1JA 3FB1A 1NN1A 3HWSA 3E18A 3OQJA 4GW3A 5DN6A 1QYVA 3IEIA 3NGXA 4MGKR 4ZJUA 4L2IB 3NR2A 3JW8A 1BXGA 4B71A 1JKJB 3TOCA 4NTZA 3PNOA 2R8RA 4HB4A 1NVDA 1MX1A 2MF4A 4KJZA 3CX8A 2NX2A 1VJTA 2I65A 2C5GA 3DFIA 4BQIA 1KYZA 1LBSA 3GYGA 3QBEA 4K9SA 1XNRB 3VRLC 3BXXA 5TRTA 3K0AB 2Q1YA 3VZBA 4D0LB 3I39X 3DDCA 3P5SA 1DE0A 1KMCA 3I6BA 1UQRA 4GGOA 1L7RA 5D6NA 1MEEA 3KB2A 2FHPA 2QL5A 2AE2A 3G9TA 1TO1E 1YQDA 3LY8A 3M6WA 3N8HA 4JLUA 3WBHA 1E7WA 4R68A 4WNAA 2HSDA 3F1KA 1AYIA 3BERA 1KSJA 1T3SA 4GM4A 4I4CA 4XW2A 2NZWA 3D0OA 5ALQA 5C4IA 4FS8A 4LZAA 2BR3A 4HZUA 2NTVA 2Q2OA 3WS7A 2WC1A 3AFMA 2GDJA 1C3OB 4QLBA 1JFSA 3Q3EA 4GP6A 1N2CE 3OQ1A 4QPNA 4CYMA 3GH3A 1W4RA 1JJ2O 2XWSA 4GI5A 5DLQC 3KZXA 2GCOB 3V48A 3B78A 2QLBA 1CQPA 5JAQA 3GELA 4D79A 2MYPA 2VDWB 3PQDA 3QBJA 5DJ5A 3FJ1A 4WEQA 2OZLB 4BZWA 1MCZA 3I32A 2PKYX 3FMGA 3T5GA 4NXMB 4R71A 4Z4HA 2QSJA 1GNQA 3SK0A 1KY3A 3UIEA 4H15A 1CD5A 1N0IA 3G2LA 4JJ7A 4TZTA 3AR3A 5L6MB 1EFUA 5JXHA 4MB6A 1R8XA 1EUZA 5KI6A 1X1QA 5TSDA 1DXQA 3S5UA 1Y6GA 4XD2A 3H1EA 2VCHA 4MW2A 5IDWA 2TS1A 1EQAA 3IMEA 2JI4A 1KKUA 1D2HA 1H05A 4OP2A 1IOVA 3EVBA 4R54A 5E6UA 1VG0B 5C35A 3WGTA 3E9QA 3E4DA 2QDKA 6CHYA 3HXOA 5THXA 4D3FA 1RLIA 2YZ2A 1ML3A 1RYBA 3C8DA 2P6MA 3TRIA 1U8XX 5AVRA 4I1UA 5LWQA 4OI4A 1ADGA 3SP1A 1QG6A 2IKQA 3GIWA 2A0YA 2F90A 3PQ4A 1PN3A 5IN5A 3TNJA 1G8SA 3W5BA 2BGRA 4A73A 3FRIA 1RBYA 5L3RA 4UNPA 3Q98A 5IJAA 4B9AA 4B6EA 4B17A 3CVUA 3ICPA 1B0PA 3QKRA 1CV2A 2QV7A 4MO9A 2PRJA 4RSHA 5AVSA 3QEAZ 3HY3A 2WJ3A 1R4ZA 1NY6A 4C6SA 5HVCA 4P31A 4W5OA 5FA5A 3SMQA 5DSTA 4ZHQF 2PJRA 2QZ4A 1V26A 5DLDA 5E1MA 4BFTA 5IT0A 1J0EA 4ZJYA 1EESA 1L5RA 1Z6PA 1FSGA 1BMDA 3EXIA 3SIXA 1M1NA 2SECE 2VNSA 4YV0A 1ZX1A 2YRXA 3C3BA 3JYPA 2JIOA 5CVJA 1DKUA 4QFCA 2FSIA 1K88A 2FRXA 4OXIA 1QK4A 1SQGA 5JDIC 1BHO1 5HM6A 1CQJA 1ORHA 4W5RA 2V9ZA 1FB5A 1OTYA 1WXHA 2CVZA 4U1RA 3MJTA 2FWIA 3REQB 4CM9A 5F9FA 3IUPA 1SVIA 4RZUA 3N2ZB 5I8PA 1TQ4A 4K9KA 2P68A 2NUPB 4FD3A 2OG2A 4XVQA 2C8JA 1UJ5A 1I7DA 3PVCA 4DKXA 3OZTA 4LJRA 1JSCA 1U1EA 1JE0A 2XDYA 4ZQGA 1VKNA 3R20A 1RYHA 3WWDA 2B1QA 1XWIA 4IUDS 1JJAA 2X8LA 4C4YA 4B3DA 2UVQA 2V7WA 5MGNA 1ZM3A 1NRXA 3VHXA 2VP5A 4C7JA 3E9YA 2XW6A 3ZWDA 4QUBA 4QL3A 5DGHA 4CF3A 1LPNA 1Q7TA 2WK1A 4XIJA 2XJ9A 5BV1A 1E5VA 5I7UA 4DM7A 2PZJA 4B43A 1WKCA 5L3ZA 1NOKA 5HOQA 2FPXA 7REQA 1S8FA 4ZZ1A 5AI6A 2DG2A 3HBAA 3I76A 2OTLP 1Z82A 4V1CB 2J48A 3C39A 5E4JA 4IRXA 3FY4A 1CVRA 3USES 3VC1A 2ZJ6A 3ZWKA 2XDWA 3QKWA 3U1TA 3S2YA 4N76A 3TL2A 4H35A 4OK6A 5EE1A 1CERA 4E5KA 2JQ4A 4MHSA 5L8VA 4G1EB 2NLOA 3O4RA 2AOWA 3D81A 1V8PA 2VH1A 3ONEA 4DCPA 4BLQA 3Q2OA 4IDGA 5EIAA 4ZCSA 2KGCA 2PUJA 1O5TA 5B1SA 2GWHA 1DUSA 4BGEA 4R98A 3A4NA 1R5JA 3ZDXB 1FVOA 1NSTA 2Y3IA 3BCRA 1F48A 3BCUA 4G1CA 1AM4D 1N75A 2ADOA 1VMIA 2GBIA 3ANTA 1Y89A 4FU0A 3SF0A 4RD4A 4AF8A 4EZBA 1SXIA 2Z2IA 1GCOA 1SVNA 2BE7A 1CVIA 3H65A 3IJPA 3KTAA 4JQYA 1MO5A 1O89A 2HMTA 3TTYA 4QKOA 5M2QA 3L8EA 2XHZA 4TYYA 1RM5A 5TQ2A 2IYNA 1OFUX 2BDTA 3FCCA 1I7NA 4M8NE 4NULA 3SF8A 3VKVA 3EGVA 1USIA 5AJUA 4DXHA 5BSHA 2JF0A 5ETJA 1NXPA 2VTVA 3PWZA 3KNZA 4TRRA 4EHJA 5DYGA 4EUEA 1VSTA 4UHCA 1OI3A 1LV7A 2QMOA 3RS8A 5KTKA 4R1UA 3BMOA 2FMKA 3KE8A 2CYCA 3TRFA 4H6VA 4PC1A 1FRFS 3ROQA 3UFXA 2ID7A 5F7XA 3B89A 4R1SA 5I47A 2Y1XA 1SVSA 4UCQA 3KFXA 4RS3A 2JDID 3HEMA 4RIIA 4FLMA 4UHHA 3W3ZB 3L9XA 2H57A 1RTKA 2HCBA 2XI4A 3BGWA 1ZNVA 4XB6B 3T5CA 1WXFA 4RF5A 3W5CA 4ZYZA 3DVSX 1X1SA 1E0KA 1MJHA 1UQUA 2A1UA 2FEAA 4H27A 4RA6A 3AUKA 2E48A 5SZKB 4NCNA 4UQLA 3ESCA 2MCFA 3HR4A 2IZ0A 1P1CA 3K4QA 5FORA 3V7FA 4W5NA 1C4OA 4V3BA 3UOGA 3DLIA 4BEWA 1U2GA 2ZETA 2Q7XA 5GINE 1RAIA 3TLCA 5LC1A 1A9OA 2IY7A 2PSFA 3ABIA 3GPCA 2N47A 4DB4A 1VQPP 5JSZA 1HNWB 2TYSB 5AD1A 1MC8A 3V4RA 5CFOA 5CFLA 3PC4A 4AN1A 1Z8FA 2HLHA 4JLKA 4J91A 5F51A 3BA1A 3A32A 3GP5A 1NASA 4WN9B 1L7DA 4KDFA 2O59A 1KO1A 4UM8B 2XCQA 2ECFA 3PU6A 5EMHA 4EJ2A 3ADOA 5HFJA 221PA 1PGQA 2BM0A 2YN2A 2ZDQA 3EXHC 1XD8A 3LQRA 3OCZA 2PL1A 5LOVB 4F3CA 3KAKA 2PKCA 4X8HA 5CYFA 4B3CA 5L3QA 1VE1A 3P97A 1FMTA 1MABA 1D2GA 5KQSA 4F8YA 4YUAA 5K3AA 1QAOA 4EP1A 2PMKA 1JHDA 7ADHA 1NT4A 2VZ8A 3D4BA 4IZIA 3WV5A 1J49A 3RRXA 2A67A 5JSQA 4H0FA 3MQ2A 4CVNA 4ZVNA 4EI2A 1CIVA 1BN6A 5LQAA 1KE2A 1QGUB 1A77A 1FK8A 1G5RA 4IY1A 1QDEA 1T8KA 4H4DA 5EERA 1P6UA 1Y1TA 3O3MB 1SC6A 2GGSA 1G19A 2QR5A 1FP1D 3ONDA 3I1FA 4MWGA 2UDPA 1JG3A 3LLMA 2ZIZA 4K6HA 3S81A 3Q85A 5EJ5A 2ORIA 1Z26A 5DSZA 1C0KA 5KTSA 4KRXA 3VVLA 1CNMA 4FEAA 3TBHA 1U80A 4B3MB 1U0RA 3HXLA 2GD1O 1NOIA 2Y05A 4LXYA 1VFNA 1KC3A 1LS6A 1MQ9A 4IILA 5EL0A 5FD8A 5J1TB 5FNZA 2A5FA 4R16A 1PBNA 5D1NA 3MELA 3VU8A 1SBYA 2IHBA 4I6JA 1TM7E 3KETA 1VQMP 2NU6A 2R1TB 5BQFA 1QFXA 2V6FA 1L7AA 2B30A 4IFBA 1ZVQA 2Y9PB 3BE6A 5ERXA 3TAHA 5D3KA 4EAAA 2ATXA 3IFSA 4AMUA 4PYQA 3QU5A 5BWNA 1CR1A 4DNPA 1SKUA 4Q4JB 2YCBA 3EJDA 4UTRA 4LRWA 5BOVA 1E0DA 3EMVA 3RRNA 2XMPA 1GNTA 4K5QA 4A10A 4UBNA 1HZZA 1CUWA 2KW5A 2OAEA 1F2UB 4YDQA 4Z2AA 3LKZA 4YREA 2PJUA 1SUFA 4E94A 2WPTA 4X92A 5JAIA 4M46A 1NU6A 3BRQA 3JU3A 4U3JA 3P20A 3DQPA 3SHWA 3V3TA 4DUGD 5IHPA 1LLFA 1ZICA 3GR6A 3N3BC 3I1JA 4WK6A 1K08A 1T2NA 2C2WA 1IVSA 2HOQA 1WMSA 4MQEB 5K0BA 3JQQA 5LBIA 1EUDA 3V4LA 1KP3A 2EAUA 2WILA 2GEBA 3QF4B 3RLFA 1A9ZA 1EUCB 1KZ7B 1PWXA 5B3KA 4D42A 2FEKA 5J2TA 4D8UA 3QVGA 4DIFA 1SB9A 2Y71A 1JTFA 2TMGA 2GZJA 1AN9A 5KJ1A 3AOEA 2OHIA 3WAGA 1PGOA 3RU9A 5GIPE 1FNCA 5EKTA 3R7SA 4H3KB 2OCKA 4ES6A 2R8ZA 1LSJA 2JU1A 4NYIR 3PEEA 4X60A 1FXSA 1IK4A 3IP7A 4C3VA 2Z2KA 4YJHB 4LXHA 1J22A 2OOSA 1MIHA 1NE7A 4NMWA 5AW7A 2VHJA 1QDUA 3SZUA 2P77A 1FFSA 4OGFA 2IUTA 1ZJZA 3MTDA 3PCXA 1OWNA 2YW9A 1Y8AA 1S2DA 1BVRA 1H65A 4NFLA 4NYMQ 1F0PA 2FG6C 3K09A 4JCCA 4NZYA 3ZWCA 3QG5A 4H7EA 4E5YA 1FNNA 1XEXB 3DS1A 4JLNA 2JZCA 2OKCA 2ZWVA 2VJMB 1KOLA 3TKAA 1Y9DA 1PV2A 3FTCA 3KC2A 5HG0A 4YX9A 2DFTA 3SNHA 5KDOA 3EVCA 4AQYB 5A2QA 1FDWA 4DV3B 3V6LA 1YL7A 4L9SA 1ZZEA 3DKRA 1O6GA 1UBSB 2QUAA 4ENVA 3TEMA 4AKIA 2FLKA 2J41A 4RTNA 2NU9B 4PZUA 2GX6A 2XMCA 3NIGB 2BGWA 3KUCA 3IVMA 3L04A 4IGKA 4D0NA 5MN5A 1FFEA 5ALXA 2FDCA 2JAUA 3IE1A 1MDFA 3A58B 3DM5A 3IDZA 4LRSB 3DBVO 4X45A 1K75A 3UJ3X 2BFBB 3ENVA 1ZN8A 1BH2A 2O1WA 4I4LA 1G8MA 5I3CA 1A8IA 1X7ZB 2VJKA 2UXCB 1V6SA 4KE8A 3KJIA 4G84A 2OOKA 1X39A 3IELA 4Q3DA 4QDZA 1Y4SA 4E2ZA 3HB1A 1QKJA 1Y3AA 3H99A 1A3CA 2GAJA 4JFAA 4FC7A 2QT9A 3AG5A 4LGVA 4LJLA 2G9ZA 3UK1A 3OWOA 1U7OA 6REQB 1O5OA 3E7WA 1NM5C 2W8BB 3MNFA 1ZN9A 3SXUA 4LJ8A 4S1PA 5EI5A 2B6NA 1GVHA 2AJCA 3NYRA 1XZCA 3PNVA 1T6BY 4FILA 5EHQA 1F2TB 3CB4A 1IUPA 1E7YA 3VO2A 3VPSA 1MBZA 3V46A 1X74A 4YAGA 5G0SA 1N4AA 4I9GA 4MR8A 4D4IA 2DX7A 2M6SA 4X1KA 3SYMA 2VJBA 3TX2A 1VQ4P 4E03A 3RTEA 3BTSA 4Q00A 3H17A 4D56A 1EYZA 4UPEA 4GUDA 1ISMA 3NPMA 3G9QA 3NORA 1Y3IA 3C6QA 1QCDA 2NO9A 2H1IA 5DM0A 1LTQA 1YKGA 1TAGA 1BYIA 3W4IA 1KLPA 1EFRD 2PZLA 3EQZA 2UVDA 2EVWX 1KI3A 3AERB 3RJTA 2AYZA 3OMXA 1ML4A 1N1EA 3SFZA 2GM4A 5CB4A 1DOZA 3KHTA 1EDDA 1WEHA 1PT5A 4CE6A 3VPGA 4EPWA 2PH7A 3OLWA 3SYLA 3CF4A 3SHOA 4YUXA 1NC1A 1MV8A 1O8BA 4JLBA 5G1NA 3VI3B 3RAJA 4DUYB 2FACA 4N49A 2PVSA 1B15A 1DBQA 1E3QA 1ZRHA 3DBIA 3U61B 1BD4A 2BDEA 2WWTA 2ZEJA 2G7ZA 3DVAB 4YMSA 1G98A 1VLHA 3NHYA 1Q95A 3WYFA 2O0MA 4US2R 1SD1A 1VHNA 5EGSA 1RQGA 4EQ6A 3OU6A 4OI0A 2DXIA 4W6QA 1AGYA 1POXA 5FNVA 2OP1A 2O06A 2YHIA 2YS7A 5H16A 1WMAA 2GCIA 2C42A 2I7VA 1RS0A 5AKXA 5E8RA 3WGQA 4BO9A 3HV2A 4NCKA 3H3JA 1J8VA 2P9EA 1MGPA 3NNSA 1PQWA 2OGZA 3GEGA 2D4AA 5HA5A 4CCYB 1OI2A 3MT7A 5K6AC 1NWHA 1MNAA 1RLOA 3U19A 1PEKE 4UXHA 1QBGA 2I2DA 2FZEA 2HQBA 4KC0A 4H7KA 1NQ4A 3JVUA 4LQLA 1LRKA 4N0MA 3QFFA 4OHVA 3MWDA 4A6DA 4CU5A 1WA5A 3U0VA 4OB7A 2XE6A 3KAJA 4PN3A 4EUSA 2F62A 5HYVA 3NOOA 4J0HA 1FQJA 1KD1Q 2AMYA 4C76A 2H48A 1S4MA 4DQ0A 2XJ4A 4W1QA 2LDBA 2XUIA 2DAPA 3VZDA 4Z4EA 2X2BA 5EIHA 1M2VA 1OE0A 2QRVA 3B5IA 4DA7A 1G6HA 4ZVMA 2QBYB 1JLLB 1JYSA 2ZITA 5DYNA 1YFJA 4KWEA 4BKMA 3QTBA 1CQIA 1ONPA 2FCRA 3S7ZA 2A5LA 2EKDA 3LFTA 2PEQA 4C07A 5KSWB 3VJLA 3RDPA 1J0CA 3C14C 3DV2A 4PLWA 3N2GB 2WWRA 3PNQA 5EOVA 5WRFA 3SKVA 2R0QC 2LIWA 3OQHA 3I3SR 3T7CA 1U8TA 3K16A 5FI1B 3B1FA 5L6LB 3VKHA 1Z3IX 2AD5A 1M8GA 5IX8A 3E2PA 4R05A 3RC1A 3LRYA 1PE0A 2FEOA 2OR3A 3B38A 1ZINA 3C41J 3JRXA 5FLEX 3BIXA 5BW6B 3QKSA 2R00C 5DX8A 4FR0A 3AESA 3VNUA 4ZOCA 3BBPA 3O2NA 4M21A 2BMDA 3JWPA 5TV2A 4M7OA 1O95C 5IKMA 2CLKB 2NU7B 3AEUB 3MK31 1GJRA 1PUJA 2PXCA 4LQCA 4RHUA 1UZLA 3A04A 3QTTA 5EFOA 3RKRA 5LM3A 5TNXA 2HZ7A 4NF2A 5CJ2A 1KWGA 2ECKA 5DGTA 5KUTA 5HGLA 3BH0A 4MYSA 3ZHBA 2UXBB 3QXHA 4D9GA 5SYAA 1U2EA 2B3TA 3V4PB 3NHWA 4YRLA 3O91A 3MJEA 4TTQA 2Z4SA 4OJTA 3AKZA 1Y8RB 3GA5A 2AR0A 3R3SA 4OQNA 5I8ZA 2JNWA 4AJIA 4ND1A 4X0EA 4GLBA 1GGKA 2NPFA 1CVLA 3OCCA 3VR4H 1W73A 3ZVMA 4RHCA 4RANA 2LCQA 2XA2A 5EHZA 2I6SA 4KFSA 5JPDA 3GUZA 2FRVA 4E14A 1Z74A 1T4CA 3ONVA 4FYJA 4QUJA 3RTBA 1CNEA 1NJGA 2DWCA 4QBHA 2AJTA 4EWLA 3KKOA 4PRZA 1JIQA 4X7BA 2WJIA 3GT7A 5LNK6 5AVZA 3W5HA 1ZKDA 2XZPA 1YS7A 2D4HA 4B40A 3ZGYA 5HV8A 1L7MA 2WF7A 5ALRA 2FUCA 1ECJA 3HVJA 5BQ5A 3CW2A 2CNNA 1WTAA 4M0KA 3I5YA 1M6VB 3F4BA 5THQA 3HBMA 3CCQP 4HWGA 3S1AB 1JDVA 3C5EA 1GUYA 5CIYA 4KR7A 5AK6A 1YRWA 2X58A 1RI2A 3LUCA 3O94A 1S2LA 1W5FA 3QBVA 5AJVB 3TIVA 1YFLA 5IUNC 3ZBPA 1DIOB 3ONFA 4FZJA 2P2CA 2VN8A 3C6BA 2W83A 4IJWA 4JGIA 5TMPA 1USKA 1ZA1A 2H3HA 3RD5A 1IHYA 5IAOA 1KJ8A 3L8MA 1GD1O 2VT6A 4RKFA 4WK0B 1Y63A 1VJRA 1GU0A 2OCXA 1N5JA 5TXGA 1VL6A 5JLJA 1Y3HA 1WCV1 3ZUPA 2CXTA 1J5PA 3A70A 5TPWB 3HG7A 3ROMA 3OTOB 4R6XA 2JCXA 3UYLA 3T0FA 3L1HA 1G2OA 3BRCA 1T15A 4U6SA 3ZE9A 4EATA 4BUCA 5LMNB 1F8YA 1HDEA 1VB3A 1ZOLA 3DZHA 4K03A 4WKGA 2WMOB 4KFCA 1NXTA 4PQYA 4F9TA 1I0IA 1P7CA 1PZGA 1TKCA 1QHEA 2XKBA 3KQWA 1OLSA 3G0OA 1QM5A 3RSFA 4X65B 4GBGA 3LSTA 3AETA 3U3XA 2WJJA 3LNTA 3M49A 1GAJA 3ROPA 3CMAP 5EQJB 3VHQA 5C1DA 4G1UC 3V7UA 4CL3A 4MLDA 3BCHA 2B2CA 2FEWB 4FEEA 3GEBA 1L8XA 3B36A 2SCUB 1VQOP 1OBFO 2WT4A 2ZUSA 2E0IA 4MULA 1GQSA 4PLFA 4QO7A 4XJSA 3ETHA 2QWXA 6NULA 4UUNA 2XDQA 1JU3A 2XNSA 4H7DA 5A5DA 4ZO4A 1ENZA 4G0MA 4PC6A 3SM3A 1GAEO 2GASA 2GPNA 3D4OA 4CCSA 3PCTA 1KZYC 1G5FA 4RY8A 2XQJA 4WCFA 4FIDA 4RHYA 5INTA 1SUCA 5AW6A 2E4XA 5CVCA 5IUJC 5DGDA 2QRGA 3DKKA 4QFBA 5CP8A 1C1HA 2AFHB 3S5JA 1TVCA 1X7DA 3P2JA 2BEVA 2WINI 2VLOA 2ET6A 1O57A 1ZSYA 1VRCA 5DBHX 4BOYA 2ZVQX 4M1SA 2OCDA 4B9EA 1KKMA 1E6KA 2NAPA 1MJGM 5GOZA 4US0R 2P9ZA 2XQIA 2HWYA 4G56A 1IQUA 2AC2A 1NXXA 1YMUA 1YT5A 3CUSA 1WBBA 2I34A 4HNTA 2O2EA 1FFAA 1VE9A 4C7VA 3GLFE 2CLOB 2W90A 1NONA 3JYLA 2I0FA 3OSUA 3ZVLA 1Q3HA 5CFMA 2J7PD 4ZQFA 3RFFA 2DUUA 4ZT2A 1E2NA 1AHNA 4INPA 1N2EA 4KR0A 5JXGA 3PUHA 2W4QA 3SEAA 5CA0A 3JR7A 4BB6A 5CITA 4TLLB 3CJQA 3ZDZB 1RKXA 2FPSA 1XF1A 2C9DA 2QI9F 3U4HA 3PTLA 1J9EA 1E9FA 4TWBA 3QBTA 1DAOA 2A86A 1R8YA 3SX4A 4YJDA 2WM8A 2VP0A 2VQEB 1RXUA 1EJ0A 5AM5A 5K1ZA 3WTCA 4N8SA 3VSCA 4ZGGA 3H0DA 1YL6A 1ZW6A 3KDPA 4KN5A 1SRRA 4RVDA 4MLCA 2EG9A 3ZTTA 1Z34A 1YQQA 5JJIA 4XCQA 2BC9A 1HTTA 2C5AA 3OOJA 3OZXA 2QDXA 3MJDA 2IPOA 4NCJA 5K01A 1C1XA 1L8QA 5B1YA 3CCRP 2Z8ZA 2YJZA 4OMUA 4G0VA 3JQFA 4Z5XA 3IXQA 4XI9A 3I58A 4XR4A 1GA1A 2O2JA 3H83A 1F4VA 4YC7A 3SE7A 2WIFA 2K0XA 5IJZA 1YI8A 2KBEA 3CUWA 4NDAA 1NGSA 3KR1A 5EXDA 3V8EA 1KVSA 3RR2A 1O0CA 4CG0A 3N7TA 4ER3A 3RGGA 5JNUA 3UTCA 2MSKA 2JKZA 4LSGA 3NEAA 3S2GA 4B81A 1K5PA 3W0LB 4CLHA 1B42A 2ZZKA 3VMFA 5HDQA 1MIOA 4XSHA 3NH9A 5AHOA 4ZO8A 2I6GA 3V7WA 5IWCA 1B0AA 1T8SA 4KWHA 5KZMB 5LP1A 1Q15A 4COCA 1PJ2A 2X7HA 3A6EA 3KT3A 3H5VA 3UAVA 2O7VA 1TVEA 1E2KA 3TCNA 1YVPA 2J33A 5B53A 3QPWA 4IGIA 2EIAA 3PUYA 1FSSA 3LQ4A 4G1VA 1C30A 1R15A 1UXHA 4FC6A 4XVRA 3O8RA 2YQZA 1MX9A 4ZCMA 4LW8A 2HJ9A 1HOTA 2D1SA 4O08A 1ACMA 4G2TA 4DR1B 2HSWA 1OKKA 4G97A 4C5BA 1YJAA 2C98A 5KTMA 4PPQA 1P61B 1A8HA 3PFGA 5LA6B 3R7DA 1NX6A 4O4JF 2QSYA 4F9EA 3AJRA 2Y67A 1VL0A 1JB9A 1NRJB 3RBVA 4ZGWA 1FJHA 1JQLB 2P5YA 2P62A 2YVAA 3L7CA 4OFXA 1UNKA 3VPCA 3RAPR 4C0QC 4CLEA 3HKDB 2ZI4A 2GKOA 2ZRLA 1CEIA 1K8QA 1VP3A 1DQZA 3D8BA 3FZQA 4FHGA 2V96A 4FNGA 2R4TA 4G5SA 3OF5A 4K1XA 4L74A 2JK1A 4KE6A 4YJ2F 3RYTC 3M6XA 1KHHA 2JH9A 5E95A 1P3Y1 4RPLA 2G1JA 3W5DA 3K73O 4FE3A 2WKSA 3B1ZA 3HVIA 1NVVR 2ON6A 3R5KA 4HN2A 2ZR9A 4A0SA 4ED9A 2IU0A 1DO2A 2FKAA 3STUA 4BZPA 2QGNA 3BSYA 4I55B 2JFZA 2Y1GA 2JVIA 1HMYA 5K3BA 4ALKA 4E32A 3G2HA 2FJPA 2Q4EA 1QHXA 4UMFA 3WGHA 3DYVA 3LVQE 1UMCB 3A1UA 3CZ4A 4Q6BA 2HPZA 4I3FA 1AO0A 4Q7EA 4KQJA 1QLHA 4R6WA 5LP6C 3M5CA 4LV6A 4RW0A 1RTTA 5EJIA 3FYUA 4CPDA 1ODLA 1OXTA 2J3HA 2X9NA 4ZOAA 5EVJA 4ER6A 5K0TA 1Q0TA 4KRFA 4LV5B 2V1XA 3PXUA 1XQVA 5C5EA 2I6TA 5IXYA 1GN9A 4WKBA 2GCGA 3IURA 4QE3A 2YYYA 2ONKA 4DCUA 1Q0UA 1PZFA 3A2MA 4HDSA 4K9MA 4BEVA 2GZAA 3ZGLA 3QUTA 1FXWA 2IYVA 4I19A 3SFTA 4INJA 3GAFA 2AK3A 3FPHA 4P7BA 5FPPA 3WFIA 5ARDA 4Z4CA 1SXQA 2OLJA 4FDMA 3TTXA 3A4LA 4LKRA 5K3FB 1Q6YA 3FNHA 2DQYA 5C52B 4M1MA 1VG9B 2JH3A 3HXTA 4J0GA 3RYFA 5A04A 2X42A 1EXDA 4C2UA 4BYMA 4ZEVA 4DMLA 1JG4A 4ENWA 4W5TA 2H31A 3G2QA 3M6AA 1JU9A 3GH1A 4O4LA 5IBQA 1WZIA 3TEJA 3EZ7A 1L4GA 4BE7B 2GVNA 4GLFA 2MINB 4QGHA 2O0LA 2GDYA 4FR2A 3WOVA 3U7RA 2GDZA 2IDJA 2CG5B 2FW1A 3A6LA 1W52X 2FSVC 5G2OA 4LXQA 3PXEA 2VSOA 3ROTA 2II6A 3S28A 4EFDA 5A7FA 2WP0A 3QNMA 4LECA 1X7XB 3UUEA 4X24A 1YCHA 3OF2A 3TW8B 5BURA 1TMGE 1YASA 4L1KA 3F8TA 5ECWA 2P3LA 4M0IA 13PKA 1NRIA 1OOEA 3AJDA 4JBGA 1N7IA 3WIDA 1R18A 3OQPA 3G9UA 3Q2IA 4BVFA 1DEKA 5HJEA 2IXBA 3GRRA 1VBKA 1U0HC 1YRLA 2I3BA 2WVHA 1EFAA 2ZIAA 2ZG6A 1M2KA 2X13A 4IQGA 3BD6A 4QASA 5CXXA 6LDHA 4K0KB 1NLFA 3OEYA 4L9WA 4FI3F 4R8VA 1W9MA 2AN9A 4P4LA 5E7QA 4EFNA 1I2BA 5KNDD 3LXRA 3WXMA 3FNRA 4LZWA 3TLGA 6Q21A 5JY1A 1EBFA 5AO9A 1LSOA 2LIVA 4KIFA 4YCNA 4CM3A 1FQWA 3D64A 3P4YA 1JPJA 3U09A 1UFRA 1N2CA 1HY8A 5DYWA 1GAQA 1UPXA 2WMNB 3P9RA 3ZNNA 5GADl 1FQOA 1E5LA 4DIUA 1AIPA 3VR5A 4R41A 1OXBB 1NPDA 4MW9A 4RKEA 1QIJA 2OLKA 3KJZA 4MEBA 4RXTA 3OX3A 1P29A 5MGBA 1CJBA 4LVUA 3H9UA 1JMKC 5JNTA 2J67A 1H1LB 3UJBA 2F55A 1IBKB 1LJUA 4NBKA 1JHXA 1IXRC 1T3GA 2DH5A 4LJ6A 3DAFA 3MT9A 5E4YA 2KG9A 1QH1B 3BZWA 1YS6A 3QFSA 1W4CA 1KVQA 2QW8A 3TIGA 3G5AA 3T06B 1WP9A 1Z5WA 4DE5A 2YIVX 2UZ4A 2EEZA 2IEGA 1FXUA 1DQNA 2GM5A 3NDPA 4ZU1X 1DB3A 1FFHA 1GNVA 1TLTA 1QP4A 1R4NA 4LFBB 1WPXA 3DP9A 1TI7A 4PSDA 2ZUUA 1GKIA 1ODKA 3MWEA 1WXWA 4L76A 1H69A 1G1AA 2FFQA 4KFRA 3PV0A 1OLUA 5EWJA 2CHGA 2YXPX 1B6SA 2Y6VA 1XU4A 3ANLA 3O21A 3WSVA 1M5TA 3FDZA 1M6EX 5HMLA 4C0XA 4RY9A 4I50F 3RT7A 3C5WP 1NUPA 3BJZA 2WTMA 4WQMA 1Y1LA 1O9BA 2EL7A 2F3PA 3AIMA 1A0OA 1BDMA 2YWGA 2YXDA 4J1TC 4MW7A 3HCPA 3COSA 2GYUA 4UNNA 3V5NA 2B1GA 4YMTA 1YJBA 2CWDA 2ZTLA 3PPYA 5A4IS 3DE6X 4BAGA 3A0RB 1IY9A 1ETHA 4EFKA 2UUAB 1KI8A 1D2CA 1RMQA 1N8RQ 3CRVA 5CT5A 2FQYA 2JJ2D 2VSYA 3CUKA 3L0ZA 4W5JA 3QVKA 4M6WA 4QPCA 1BAJA 3X2SA 1J00A 1Q7YQ 2PKQP 4ZCLA 3MWGA 1Y7TA 5EY5B 1ZCZA 4A0RA 4PCAA 4L5CA 2GT1A 4BNKA 3MGKA 1M0WA 4LDJA 4ILEA 3FHJA 3QPUA 3V1UA 3W8NA 4NNOA 6ABPA 4MCJA 4DNFA 3OQIA 1Z22A 3RI3A 5AI8A 2E4AA 1J2EA 1Z68A 2J85A 1CJVC 2OFFA 4JXKA 3O8BA 1Z9BA 7YASA 3PGA1 3NUQA 3BL5A 1E3EA 1VSVA 1ZNXA 3CNNA 3B7GA 3IQZA 4L8YA 4OHPA 1YDWA 3H75A 3LBNA 5J59A 4M87A 4L5BA 1YTLA 4OAQA 4TKLA 1Z33A 4EGJA 3JYHA 1AHIA 2QNIA 4TQGA 4EM6A 2VUTA 1IJFA 1VHQA 2P2NA 4B6GA 1BW9A 2O19A 1GM5A 1X38A 4R1TA 3W1WA 1W88A 1P72A 1SRQA 2Q7DA 3O31A 4P93A 1Q6ZA 4ZO9A 1ZU4A 4R9UC 2NQ2C 3CW8X 3AR5A 2HTFA 2X23A 3WIUA 3L6UA 1XN1A 5CG2A 1JJ7A 8LDHA 3GWGA 4HMQA 3QMMA 4UOQA 3UAZA 4HVTA 2GK3A 2XY4A 1UXIA 2WVAA 3G21A 1B8VA 3ORHA 5F5LA 1BX3A 3TLJA 4P3YA 3PNPA 1M6WA 4C0BA 1X9GA 2WFMA 3LP8A 1ZM7A 5DHPA 4WBNB 4EUNA 3CIFA 4IJUA 3SDZA 5DEIA 4Q37A 1PNQA 2FPOA 3B3FA 3CXUA 1ENOA 1QPBA 3EWNA 4JHLA 4DXAA 2QMYA 1OX6A 2ASEA 3IVCA 3KBBA 1DVRA 3G6WA 3KYCB 2OV3A 4FGZA 3LC0A 4K3UA 4UHBA 5AXAA 4BBZA 4PV7A 2CSUA 4MQ6A 3HBLA 3FZNA 4XLZA 3KQLA 1YUNA 5FUYA 3KJFA 1HDRA 3F4KA 2F3QA 2ZTUA 4MCHA 3Q3GE 4YN3A 4B3SB 2LNDA 4OJYA 2CWOA 3IAAA 2P6UA 1EXWA 1UBGA 3GDGA 4QUDA 5IYZF 3QU9A 3W9BA 4NU6A 5HQJA 2IUEA 1EGAA 4U5QA 3EEYA 4ZKEA 3IIMA 3AHFA 1BFDA 1Z6QA 3D2BA 2LMLA 2W48A 4XLLA 3G0HA 3CRRA 2GYKA 2M6RA 4HWKA 2FPKA 2I2CA 2WZBA 3TG8A 1A76A 1TEZA 1PJAA 5F1KA 1NQ5A 1NQAO 1X9IA 2J8ZA 3Q3IA 2VDOB 4I6EA 1NW6A 3IULA 2YFHA 4N39A 1B6RA 2J9FB 4ZI7F 5FLXA 3K7EA 2BVNA 3GFVA 1T2FA 1HEIA 1JA0A 1KEKA 2P4SA 3EXEB 4DOMA 2JEOA 1FP4B 2B25A 3EWSA 3RUFA 4YRQA 1QH9A 3EX7C 1NN5A 2V7PA 4TQUS 1K9VF 1KQSO 2ATEA 4ZRMA 4P36A 5PGMA 1ELOA 3NFYA 5B3JA 1NMEA 1VQ1A 1XVLA 3T9AA 3LE8A 4LZLA 3HABA 1RRKA 1EWKA 2EJCA 3CT6A 3PUXA 5DBIA 3STHA 1DFGA 4YRFA 4C4TA 3ELWA 3Q0IA 2B4RO 4BJ5A 2R4UA 3ZC3A 4MCAA 1D8AA 2FUG1 4LYJA 1DBPA 1H2XA 2BM9A 4Q7QA 2A9KA 4JC4A 4MV9A 3MGGA 2C2MA 1KQPA 3NI2A 4OM7A 4UBOA 5BVGB 3DS8A 1HDZA 1LQUA 2CL0X 4L57A 3I42A 3RWMB 1S8NA 4U7DA 4XFYA 1OFVA 4R01A 1U7HA 1ZMXA 3M34A 4J0EA 4TVOA 4F6RA 3PA6A 2P6RA 1PJSA 3PEVA 3PRHA 2P7IA 4BQRA 3EDCA 4LS3A 3C5VA 2G1UA 5E6SB 2XCLA 2ZYWX 3KKEA 1TUBB 1E18A 4BPHA 4DGQA 2OCBA 2W6MA 2FN9A 4NE9A 1VRVA 4NBTA 1BVUA 1FYVA 1V9CA 3KQPA 4G0NA 1J25A 4BNYA 3R4CA 3D2LA 3R4VA 4UFOA 1QFMA 3ZS8A 3VPXA 2XCSB 2GRJA 3AVOA 2LKIA 1SZJG 5EJMA 3WWZA 3BDIA 4CG3A 2IZOA 3DTVA 5IF3A 1OD6A 2FFAA 2IXGA 3BQ9A 5LD2B 2KB0A 1EFPB 2JBGA 2GN9A 2WQZA 3JARB 4K9QA 2X0FA 5I7RA 3HCCA 1NT2A 2EKQA 5KOJB 3P4XA 1JECA 1ARZA 1WU7A 4J7CA 4JGBA 1HQYE 1W8IA 1XTRA 3NALA 4PAOA 4W5HA 5D87A 5JANA 1Y6ZA 4IG9A 2WMYA 3B6IA 1K7YA 5EXTA 3A06A 1GRCA 5EJFA 4MJLA 5NULA 4X1OA 1HE5A 1EK5A 2BF4A 4CCAA 2AEFA 4Y67A 3QVOA 3KZCA 4D4GA 4QOHA 1EK2A 1OB2A 2DTXA 2IS4A 1T1GA 4RQBA 3AQ4A 2JG3A 1KFEB 4GMFA 1ULSA 1VYHA 4D9NA 1G7CA 2IC5A 2CNLA 2ISSD 2NO1A 2QPOA 4PM4A 1LEHA 2C5EA 3CX4A 5MHTA 5FADA 1BDIA 1CR4A 1JFVA 1UKVY 2WVGA 4I2NA 2RARA 3PNMA 3SQLA 1YQEA 2WDZA 4WOJA 2DPYA 3AVVA 1BE1A 2DFKB 3FZGA 3TSOA 1A88A 1EP1B 1GHTA 1HLDA 1PV1A 1VXRA 4PO8A 1CRQA 3ZGVA 2VYVA 5TMBA 4D3DA 2Z2YA 2I6QA 1WLSA 1NXQA 6AT1A 1GCUA 3AM1A 2B8NA 3G5UA 4NENB 4OYRA 5KC8A 4AQDA 3WI7A 4BB5A 4I66A 2NP6A 2HV8A 4HF7A 2ORED 4L3WA 2JW5A 3H4EA 4OFBA 3TLXA 4ZEMA 4MV1A 3EXAA 4LZJA 4KO2S 2ZRQA 4KYTA 2AJDA 2QW0X 4WJZA 3T35A 5CCEA 1LDGA 1SR8A 3M1IA 5KPJA 2P9BA 2X0KA 1N9KA 4HZIA 4YFVA 1E9EA 3UMYA 1SCIA 2EERA 1BS2A 2FPIB 3DEIA 2BH9A 2D74A 4MSUA 1R4MB 4J3NA 5B1HA 1TJYA 3ZXIA 4PG8A 4EL5A 3TRKA 2FOXA 3KFLA 4RK7A 1DELA 1KHTA 4EGSA 1QJCA 4Z1MA 2XOEA 2DC1A 1RYDA 4B31A 3SYTA 3R7BA 4C14A 5B36A 2D06A 3SBXA 3TI7A 5JJ5A 3PIIA 1RHJA 2QRUA 2EGUA 4KNWA 4XJVA 3A6JA 2WJAA 2AR9A 3R0IA 1IN1A 5I4BA 4TMFA 1XQ9A 4YJ3A 4D3ZA 2DKFA 2XUAA 1VLLA 2E4VA 4EITA 3DFUA 4HYYA 1IAQA 2XUZA 3AB7A 1SU4A 2E5WA 2V45A 5JZSA 3DCYA 1G20E 2ZUCA 3L9WA 3KDAA 4C21A 2D1FA 3PE4A 4R9VA 1D6NA 1P0MA 1ZYUA 5DNDA 4H31A 4JD5A 3SEQA 1ACLA 3UQYS 1TD1A 5CR9A 1J6UA 3JQ7A 3IMKA 3O2QB 3RSCA 4Q1VA 1PDWA 1P9OA 1RIIA 2EBHX 2B1IA 5BR4A 4R9SA 3G1UA 2VPYA 2O8CB 1M0SA 3FBWA 3OFND 2PU5A 4BHTA 4OXKA 1DV1A 4D44A 2PGLA 4M0UA 4XB1A 4OXXA 2LP4Y 2EHDA 1MZPA 1YAHA 3IH5A 2MOKA 3E6AA 2QUKA 1U3WA 4V24A 5CDGA 3X43A 2BMVA 2WU1A 3NIDB 1ATZA 3M8KA 1LS1A 1SQ5A 2C92A 2VK1A 4MQ4A 3VX4A 1B00A 1JSLA 1QQ6A 2BGNA 2YDYA 3AEQB 3UHAA 1ZUNA 2Q2VA 2GZFA 1IVNA 3G59A 4MVJM 4HAXA 2O8BB 3VH4A 1PL8A 2H1LA 2HJHA 1XZNA 4ZK6A 5CHEA 3GB9A 5F2EA 5GONF 2OAQ1 3Q41A 1VTKA 3FETA 4UZEA 1JTVA 1KZ4A 1Z47A 4GM0A 1Q83A 3HN2A 4P5EA 2QN2A 2X76A 3DT6A 1VHLA 2I76A 2OMKA 2GPTA 3EWIA 3KU4A 1M34B 1T3HA 3W9SA 4IH1A 3ZIDA 3UGKA 5LYJF 3ABRB 4YRMA 1HC7A 1OAAA 4QQNA 1IU9A 1DTWA 1ADBA 5EHXA 2NVWA 3ECCA 4P4SA 3DE1X 5FI3A 3MGBA 5J2UB 5BN4B 2PUBA 3K35A 2YZMA 4LC9A 3HKCA 5AWFC 2HSJA 1Z08A 3TTVA 2ZRKA 1AH2A 3PFCA 1NXWA 3RAGA 1R66A 1RFGE 3IPLA 4WY2A 3ZHCA 3GZNB 2E87A 3Q8LA 1D2EA 2C2XA 2ZJ4A 3HKEA 3DL7A 2A14A 5TQ0B 3DHWC 4KJXA 1QP8A 3DONA 3H16A 3NHPA 4RA9A 5DLYA 2G08A 3BT7A 1P74A 2PUDA 2YIDA 5ESXA 1XOIA 1QKKA 2OCAA 4OHZA 3WADA 1TA4A 3H86A 5KDDA 4RY0A 1U1DA 3ZZUA 4XFDA 2E4ZA 3L0DA 5FWYB 4AMVA 4D0GA 3AK4A 2Q4TA 1QWSA 1YR6A 1KQOA 5I4KA 5DZSA 3B1JA 1P4GA 1NDUA 3LOQA 3U7HB 1R0CA 3CUEF 4X85A 3RVLA 1UEIA 1E6EA 4RENA 2RHCA 3C3AA 1KI2A 3HP4A 4Q82A 2QUBA 1U0JA 3M89A 1DOAA 3U3KA 4EHAA 4C7OA 1CYDA 1CYEA 3VZCA 2AUNA 3JQ8B 1WB4A 2IEBA 3WLHA 1NJ6A 3LL4A 4ZOLB 3MS4A 1QO0A 5EJDA 2R65A 3EUAA 2P7HA 1RYEA 4G0XA 4P7JA 4A1FA 2IW1A 4Y18A 2QTLA 6PFKA 2ZJ8A 2OD2A 1TM5E 3N2YA 5FEUA 4ZAVA 1XLVA 4BAZA 3ENKA 3JAWA 5BQOA 4EO7A 3B1YA 3PPVA 5BSEA 4KR2A 2DBYA 3V4OA 4EY6A 5GJCA 3RFXA 2D2VA 5CAEA 1T8TA 2IS1A 1SAYA 1XDSA 3I37X 3L77A 2HM7A 2LV8A 2G8LA 4QUEA 5ER9A 1BRTA 2V4UA 2DR0A 5EXXA 2CD7A 2Q4RA 4YHBA 2PG3A 2OHOA 4EEXA 2YUIA 3CKMA 1TZJA 4HNAA 3LDUA 4I36A 3Q8XB 4PFQA 1AXGA 4NAVA 5HKLA 2XKKA 1TYCA 2DWPA 2QM7A 4IGFA 5C7YA 2XZDA 1XMXA 2O6HA 2IDMA 1DMRA 3N2IA 3UJ7A 8ADHA 4K0RA 4HDRA 4GLLA 1WDWB 4HX9A 5I5GA 1A7KA 3BAZA 1K97A 4RFVA 2NZYA 1ZUHA 2REQA 4U7FA 5JDIA 4UREA 4D3YA 1KDOA 2IQ5A 3SJ7A 5C8XA 2NSDA 1TLLA 2B4YA 1S3GA 1JNYA 1I2MA 1K8ZB 2VK2A 2NAFA 5FAXA 2Q3LA 4AZWA 2I62A 4BC0A 5U9CA 1R37A 1XHLA 4CKCB 1ZJWA 4AJ9A 1JF8A 4JP3A 1THZA 1XXHB 3KXDA 3M7IA 4XYMA 5ICFA 3PDIB 2ANCA 2XUOA 3AI3A 4BFSA 4JL5A 1RABA 2OQIA 4KBFA 4QO8A 5JYEA 1ZGBA 2Q5EA 3N05A 3TPCA 4JJ6A 4JBWA 4MJXA 1B76A 3KKMA 4JJKA 1J4AA 1XELA 4I1IA 3OE5A 5EP3A 5J58A 2HPVA 1G3IA 1H6CA 2RI6A 3H9GA 4W99A 4NDNE 2VOEA 4W6ZA 3U40A 4BDSA 4MRPA 5KQLA 3GUUA 1SOUA 3ZNPA 3BMQB 3I55P 2IUSA 4D25A 1U6IA 1BWPA 4UPDA 4L3OA 4QOIA 4QEZA 4BNIA 2C03A 1DL5A 1AUPA 1RWKA 3SVZA 2Z09A 4EELA 2OSVA 1OBHA 1BXZA 2PQ2A 5BUQA 1I2ZA 1IEXA 5B64A 3AUAA 4QECA 4URZR 4BV2A 5I7VA 3RGWS 2ID8A 3AH8A 1U4SA 1WCXA 1YZQA 1CUXA 1I3NA 5EYPB 1QHYA 3VISA 4A0HA 4DSAA 2NT3A 3CC8A 3GGCA 5H4GA 4PG5A 5DK4A 2HREA 5HS6A 4D9KA 2NUBA 4M49A 1Q14A 1JJFA 3MRXA 1E5QA 3IAS6 2A94A 3OZ7A 4UFNA 1QXSA 2RCNA 3B6KA 1ZK4A 4IXMA 5D85A 4PYMA 3V1MA 1Z0IA 2Z9DA 3NHKA 1ZIXA 1YB7A 2WWIA 5DN6D 1JDBB 3NT2A 1X6VA 1NW9B 3MWFA 4Y9UA 3QVXA 1WZ2A 1XV5A 2YNMA 1Z4QA 3UA3A 4CV1A 4DGSA 3DEFA 4DS3A 4LV8B 3OZCA 5F7ZA 2ZVPX 2VYQA 5ESWA 3WYBA 2HYDA 1I94B 3UTDA 4LC1A 3NTLA 1NN3A 1QRRA 3DG9A 3HH8A 3ZDRA 3TRHA 4KQFA 2MJLA 5FH9A 3D54D 5CPBA 2GM9A 1D6JA 2CFRA 4OK3A 2LTEA 3DWGA 4IIXA 3VA7A 2DBRA 3NHSA 1OU0A 5C3UA 1IBRA 3VC2A 4LFCB 4MQLA 1RYMA 3MC1A 3NTQA 1TM2A 3GEHA 2X6TA 1EX6A 3GUCA 1HLFA 2QPTA 4GOOD 1L7NA 1VMAA 2DF8A 1TM4E 2G8NA 1N7GA 4I6GA 4QDOA 4EGQA 1M0EA 2VUUA 3DBRA 3AR7A 3Q6MA 1Z62A 5HUHA 2AZTA 2F1HA 1GQQA 1QZ3A 3KWJA 4GOND 5T6MA 4BO7A 1R12A 1G38A 1VMDA 1NLMA 5LP6F 3CH5A 3GA7A 3PE3A 3AGPA 2X4GA 2BOVA 5JMWA 1L5YA 1V95A 1DLJA 1G6KA 2P5TB 5CFRA 4DV2B 2BI4A 4M1ZA 1EI9A 1GO2A 3IBCA 1PG5A 2IH4A 3NPAA 4Q39A 5LZ9A 1G2IA 4MVJG 1A8UA 1NKSA 2UZ1B 4U7JA 1YR9A 2E55A 3SJUA 3FTQA 1XZBA 3KE9A 2VLIA 4GMDA 4M1KA 4E4RA 3GLIE 1ZISA 1C4KA 1V11B 3I2YX 2UXDB 4XJXA 1RAGA 2FQXA 4K9NA 2P11A 2CVHA 4BVLA 4ARZA 3EXHA 4AY5A 3GPBA 1VC2A 2HU5A 2BWJA 4MEJA 2OZVA 1YB2A 2ZLBA 1IG3A 2MSEB 3PHLA 4E3WA 1FFXA 1EJ2A 2KG8A 2RIRA 4OBEA 3ZWQA 1UH5A 3IKTA 3U5ZB 1Y98A 1PHRA 2HRQA 4IQ4A 4B09A 3L43A 3CE9A 3MTEA 3KAPA 3QVWA 2X86A 1DAKA 1YULA 2AX4A 2FI1A 1KDVA 1UC8A 5K7SA 1E61A 4IICA 5MFZA 3AZQA 2HSZA 3NBFA 3PRYA 4IHKA 2W2MA 4Y7CA 3IKMB 4K9LA 5HF9A 2GF2A 6YASA 3MAGA 3ZDFA 3OCJA 3AKCA 4H9GA 1DX6A 5FV7A 4BNDB 2JIPA 1CJTC 3B9RA 5B4UA 4JT4A 4U2CA 1CEXA 3ZWXA 1YK1A 1T2VA 4EB6A 3P26A 3RSGA 1TD9A 5BUCA 1M2NA 1P45A 3QF7A 3W5AA 1T8PA 1T35A 2OM6A 2R5WA 4GKKB 3FNFA 1UODA 4MXDA 4TZKA 4EG6A 3BRWA 3HR7A 1C8VB 5HRUA 1GDTA 2AUMA 2VHEA 5JALA 1E59A 1SQ0A 2E2WA 3V2UA 1A5TA 1Q21A 2YWBA 3EZXA 4OYHA 5DTJA 3FNIA 1E1KA 3C3PA 4MPRA 1VGQA 4UZFA 4WKPA 2QR3A 3FZEA 3TRJA 5G4KA 3LWDA 3C3DA 3N0VA 1WSBA 5H3HA 4JUFA 1BU5A 1D1PA 1SC1A 1NVKA 3A3YA 2QD1A 3HGQA 1FTSA 2ZANA 4AECA 1DX9A 4UE3S 5KYUA 2A1IA 4GVPA 5KYYB 1W36B 3ZJUA 4IM7A 3MB5A 3NV9A 3AR8A 5AOCA 4MUXA 4L8VA 3JQDA 3ZDBA 1TU4A 2WVJA 4H3VA 1S3FA 2QD4A 4KE9A 2ZUEA 2A3RA 1AZTA 3VR3A 1IZYA 5BNFA 5JT1A 4G65A 1EA7A 2IGBA 2VHQA 1PFQA 3QOXA 1YIJP 3AWIA 4IUYA 4BBAA 2GM3A 3DE3X 4AZ0A 1JG2A 1Y1QA 2YN4A 1N2HA 3W04A 2M6LA 4A2QA 3HWRA 4EARA 4CMCA 4DR2B 1Z56C 1T6NA 3O4VA 2VXOA 1L5HA 3KPYA 3O4GA 3H84A 3D0QA 3GLHB 1L7VC 1N9GA 1VLVA 1VMEA 2Q3HA 2TRSB 3IE0A 4FEYA 4MJ3A 1K7EB 2QPLA 3GFOA 4N6GA 2ZSJA 1EFVB 4ID3A 4BPBA 3GN2A 3WP1B 2XCUA 3FDFA 1Z8HA 2WUVA 4UNIA 1F17A 5JY6A 3CEAA 2VZ9A 3LKBA 4ARUA 2V6BA 3A2KA 3PJDA 3T9EA 1FPQA 3EG9B 3ABSB 1UKBA 2JHAA 2GCNA 4LY6A 5J4HA 4PS1A 2C7GA 4X6LA 3VR2A 3UMMA 2X2OA 2EFGA 1DC7A 1PJZA 3TFWA 5GZ1A 3V2GA 1VHDA 5I45A 1Z35A 4Q7MB 4MINA 2YZ7A 4OHBA 1HM5A 1Z6YA 1R2QA 3DW1X 3KZVA 4G89A 5CT9A 5A06A 5JISA 3S68A 4UMEA 3TM4A 2QB5A 3DR3A 1O7JA 3PL5A 4U5XA 1VJGA 5CFNA 2WSIA 1K5GA 2XNJA 5CHYA 4OQLA 4EHFA 1U8ZA 2ZJ2A 1Z12A 3ICWA 1IE3A 4BP8A 3R6LA 5FO1A 1NVBA 3T6KA 3NIFB 1AGPA 3A27A 3CA8A 1YA4A 1DEAA 4W4TA 1YR7A 3DBOB 4RJTA 3W5IA 1LZKA 2GR9A 2CL6X 5K3DA 3RNOA 1HNXB 1U0LA 1F1JA 2O3JA 5BWBA 2G0AA 1Z4JA 5K8TA 4LXTA 1TQHA 4A2PA 3WLSA 1GRQA 1FX0A 3GIDA 3PFIA 2JLXA 1GEGA 4I4TB 4MAFA 4BQQA 1GARA 1NJFA 4XDHA 2X0JA 3VOTA 5DHUA 4OIMA 1DC8A 2NVUA 1PRYA 3K0HA 3ORQA 3U6BA 3HJHA 1SUBA 2M8PA 2ZS9A 4C78A 1MT3A 3E4CA 1DDOA 2NVBA 3FGOA 3S3TA 1XVAA 2W37A 4YLEA 4JOBA 2VR1A 1K7SN 4G9EA 3VR0A 1G7TA 3PUZA 1J2TA 1ZRNA 3GJNA 1NM5A 2FLVA 1HO3A 4FQ8A 4LWZA 3TQCA 4GOMD 2JKVA 4GRDA 1JS1X 5EWLA 3K0FA 3SPXA 5IFLA 5KQMA 1N5OX 1YHQP 3TL6A 4KR6A 2ZW9A 3FNEA 5K8IA 1TQ8A 1XTBA 2XZTA 3EARA 3R0JA 4HHEA 4TTVA 2Q6TA 4KDEA 4XZ3A 1BDJA 4Y3UA 1LPSA 2PUFA 4LHEA 2YBDA 1MX5A 2HBRA 5TQVA 1RWBA 1WPRA 4Y6OA 3X1MA 2C57A 4P7FA 4N9WA 3KQNA 3KT0A 4B4OA 1GCGA 2AC4A 4IJMA 3DKIA 4OI1A 3Q7PA 1BD3A 1WVGA 2FK7A 5JC8A 1E63A 4IQ0A 4RTJA 2ZUFA 2FPPA 1A9SA 3SZMA 1ZC3A 5LSAA 5G1PA 4M1TA 5J63A 2O52A 4D74A 1PFUA 2F9LA 3D1VA 4IIJA 1PU2A 2XYVA 2C3OA 2WEKA 3FR8A 3K5WA 3PQ6A 2YZKA 3TLYA 4DRXB 3G2JA 2DB3A 4LSMA 1SXJB 2WRZA 1OX4A 3LXMA 3AP3A 4TWIA 3SS9X 1J33A 2G82A 1EFHA 4PLZA 4RGQA 3RSQA 4DA9A 2D3TA 3ZK7A 1N92A 4MGHA 1DRJA 4MI9A 2EATA 1QVGO 2VBGA 3ESBA 4PGFA 4D98A 4J7AA 3IQFA 3OH8A 4O4IB 4V0MA 1I36A 1IB6A 2GPJA 4H6WA 4S0ZA 4I1RA 1T9CA 3HLYA 4LY3A 3WNZA 3OT1B 1Q91A 3A4TA 1PDVA 3FPLA 4LRXA 3ZU2A 5L4NA 1UBFA 3LQ1A 4P86A 1Y1RA 3T95A 3DKPA 3UN1A 4XD7D 1ICEA 4FWTA 3KLPX 1EHIA 2M1ZA 3QVLA 1V16A 1Z7YA 2Q3MA 4CTOA 1JIKA 1NY5A 1RE1A 2FF7A 1MKYA 5K6AA 3O3CA 4O5OA 1QK3A 3A6FA 3C1OA 4JJ8A 4R51A 5D6OA 5B2ZA 2WZDA 3SR0A 4RL4A 2E5FA 2BW0A 2XE4A 3GLUA 1F14A 1ZK1A 3BPSA 3IAEA 4OL9A 3Q9UA 1TGYA 1RZRA 2V7TA 4YO8A 3L6BA 5A4DA 2BFCB 1FMCA 1UR5A 2P90A 1AO3A 2ZJFA 2EKZA 1XAJA 3BB4A 5ECYA 1AUMA 1XFDA 3ZE7A 4MMYB 2QMUA 1EX9A 5MDHA 1EGVB 3FVQA 4F2DA 5LMZA 1UDRA 3PQCA 4FMCF 4ZAYA 5C46F 4CLDA 4QU9A 2K0YA 5EZYF 1EAMA 4NEOA 1D1TA 1KJIA 2Q5CA 3DVLA 2FN8A 3L18A 1E4EB 3MWLA 3NEYA 4M0MA 4UHDA 1SKYE 4GOKA 4X94A 4YP5A 1B41A