4PH1A

C-terminal domain of capsid protein from bovine leukemia virus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
73
Chain Sequence
b'SVQPWSTIVQGPAESYVEFVNRLQISLADNPKEPIIDSLSYANANKECQQILQGRGLVAAPVGQKLQACAHWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BLV capsid
publication title STRUCTURAL VIROLOGY. Conformational plasticity of a native retroviral capsid revealed by x-ray crystallography.
pubmed doi rcsb
source organism Bovine leukemia virus
molecule tags Viral protein
total genus 29
structure length 73
sequence length 78
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4ph1A00
2EIAA 1QRJA 4WYMA 3P05A 3VRLC 5JPAA 3DS1A 3G21A 5HGMA 2M8LA 2ONTA 4XFZA 3H4EA 3G28A 3G26A 4U0CA 3DS4A 3DS3A 5HGLA 2JYLA 4PH1A 2LF4A 2XT1A 3H47A 5DCKA 1A8OA 4XFXA 4U0FA 3NTEA 3DTJA 3G1GA 3LRYA 4PH0A 4M0IA 5I4TG 1AUMA 1A43A 1E6JP 3MGEA 4COCA 5HGOA 1BAJA 3DS2A 5HGNA 3G1IA 4XFYA 1EIAA 4XRQA 3G0VA 3DS5A 3G29A 4XROA 4QNBA 2XV6A 4U0DA 4U0BA 1D1DA 4COPA 2JYGA 2L6EA 1EOQA 2BUOA 2JO0A 4U0EA 3DS0A 2KODA 3DPHA 2XXMA 4IPYA 4U0AA 2M8NA 2M8PA
chains in the Genus database with same CATH superfamily
1JJ2O 5HGMA 3CCEP 1AYIA 2MVVA 5F2KA 1Q7YQ 1YJ9P 3NTEA 3OW2O 2L4BA 3DS2A 3G1IA 4PWVB 3CCRP 2JYGA 1VQPP 1QRJA 3LMOA 2KORA 2KOSA 1KC8Q 3M1MA 3RG6C 3NY7B 2Z46A 4GR6A 4MRTC 3CCQP 1BXIA 2N5HA 1VKUA 1UJZA 4XRQA 3DS5A 2Z44A 2X2BA 2VLOA 1VQOP 3P05A 5JPAA 1ZNVA 1KQSO 2ONTA 2PEOA 3E2DA 2CNRA 2JU2A 2QNWA 2E1MA 2K2QA 3CCJP 1HY8A 2P9XA 1YJWP 2N50A 2MF4A 4BPFA 5BS1A 4BPGA 1DV5A 1Q81Q 1CEIA 2KGCA 1VQ9P 4DG9A 4HKGA 2FADA 2DGYA 3CCLP 1IUQA 3CMAP 2LL8A 3U43A 4CA3A 2XT1A 3CC7P 2FHSC 1Q86Q 2EHTA 2PY8A 1ACPA 1YIJP 1VQ8P 2GZFA 3GJNA 4U0EA 1GXGA 2LKIA 1M6EX 4XFZA 2DNWA 3I55P 2LF4A 5DCKA 4QKOA 4R0MA 4U0FA 1L0HA 3HYBA 5HGOA 2MY5A 1HQBA 2KWLA 2K0YA 1F80D 4COPA 4IZ6A 3HZQA 3CC4P 4IPYA 2LTEA 1GXHA 2L22A 4XFXA 3G71P 2OTJP 2VLPA 3RG2A 2QA4P 5KP7B 5HVCA 2PEMA 1VQKP 1YHQP 1M74A 2JBGA 1KLPA 2MVUA 1FR2A 3G21A 1GPJA 1M6NA 4H2YC 3H47A 1A8OA 2OTLP 2M5RA 2K5XA 1AUMA 1YJNP 3CCVP 1BAJA 2AFDA 1EIAA 2K94A 4U0BA 4NEOA 1VQ5P 3CPWO 4BPHA 4WYMA 3CD6P 3CCSP 2QEXP 3H4EA 4H2WC 3DS3A 2NO8A 1RO2A 3G6EP 5CZDB 1YITP 1MZ8A 2Z45A 2FACA 1IMPA 3GZMA 1AF8A 2CGQA 1T8KA 1VQLP 1K8AQ 2KGEA 2K93A 2XXMA 3B5IA 2LMLA 3GZLA 3G28A 5HGLA 1VQNP 2LIWA 4UHPB 2GZIA 3CCMP 1UNKA 3B4QA 1YI2P 2N5IA 2N6ZA 2KG6A 2GZJA 2FAEA 5HV8A 2GDWA 2XZ1C 1W2BO 2L6EA 1EOQA 3DPHA 1M90Q 3VRLC 1X3OA 2L9FA 1ZMBA 2M8LA 4U0CA 2VLQA 2KW2A 1VQ4P 2LPKA 5HGNA 2K0XA 1QVGO 3G29A 4QNBA 4U0DA 4U0AA 5EJDA 1E0HA 2GDYA 1VHNA 2EHSA 2JU1A 5KP6B 3DS4A 2PEKA 3GKLC 4PH0A 1A43A 2VSQA 2FVFA 1N8RQ 2XZ0D 3EJEA 2PNGA 4F37A 2CWOA 1QVFO 1VQ6P 5I4TG 2KOPA 1RO0A 2MR7A 2VLNA 5EW5E 4PH1A 3G1GA 2JB0A 3MGEA 2KGDA 2K92A 1EMVA 2KG8A 2ROQA 2EIAA 5KP8B 2MD9A 2AVAA 2CQ8A 2BHVA 1Q82Q 4H2XC 3H0DA 2MR8A 2GYKA 1KD1Q 2WPTA 1M1KQ 1L0IA 2EFJA 3WBHA 1D1DA 3CC2P 1DNYA 2JAZA 5F2NA 5BS2A 2KGAA 2PEIA 3CXCO 3EJBA 1K9MQ 1IMQA 1K73Q 2N98A 2FQ1A 4COCA 2K0DX 3EJDA 4XFYA 1NJIQ 2XV6A 2ERHA 2KOQA 2PEJA 2N6YA 3DS0A 2AF8A 2JGPA 2M8NA 2M8PA 2LIUA 2L0QA 1OR5A 2PEQA 4PXHB 2CG5B 2GDXA 2JQ4A 3CMEP 3LRYA 1S72P 3CCUP 1VQMP 1RNIA 2KR5A 3G0VA 2LOLA 7CEIA 2BUOA 2KODA 1NQ4A 2FVEA 3DS1A 2KG9A 3G26A 3CE7A 2AFEA 2OARA 2JYLA 1Z6MA 2FVAA 4M0IA 5F2OA 3G4SP 1E6JP 2GZEA 2KOOA 1VQ7P 4XROA 2GZGA 1K30A 2EG5A 2FQ2A 2JO0A 2PENA 2FQ0A 3Q20A 3I56P 4GR2A 3DTJA
chains in the Genus database with same CATH topology
2EIAA 3B5IA 1JJ2O 5HGMA 3CCEP 1M6EX 4XFZA 3G28A 2BHVA 1Q82Q 5HGLA 3I55P 5F2KA 2LF4A 3H0DA 5DCKA 1VQNP 1Q7YQ 4U0FA 1YJ9P 3NTEA 3OW2O 3CCMP 3HYBA 1KD1Q 5HGOA 1YI2P 1M1KQ 3DS2A 3G1IA 2EFJA 3CCRP 3WBHA 1D1DA 4COPA 2JYGA 1VQPP 2L6EA 1EOQA 1W2BO 3CC2P 3HZQA 3CC4P 4IPYA 3DPHA 1M90Q 5F2NA 1QRJA 3VRLC 5BS2A 1ZMBA 2M8LA 4U0CA 2PEIA 3CXCO 1KC8Q 1VQ4P 1K9MQ 3M1MA 3RG6C 4XFXA 1K73Q 2Z46A 4GR6A 3G71P 4COCA 2OTJP 3CCQP 5HGNA 2QA4P 4XFYA 1NJIQ 1QVGO 2PEMA 4XRQA 1VQKP 3DS5A 3G29A 1YHQP 2Z44A 4QNBA 2XV6A 4U0DA 1M74A 2PEJA 3DS0A 4U0AA 2M8NA 2M8PA 1VQOP 3P05A 5JPAA 3G21A 2PEQA 1KQSO 2ONTA 1M6NA 2PEOA 3DS4A 3E2DA 3H47A 2E1MA 2PEKA 1A8OA 2OTLP 3CMEP 3LRYA 1S72P 4PH0A 3CCJP 3CCUP 1AUMA 1A43A 1YJNP 3CCVP 2P9XA 1BAJA 1VQMP 1YJWP 1RNIA 1N8RQ 1EIAA 3G0VA 5BS1A 4U0BA 1Q81Q 2BUOA 2CWOA 1VQ5P 1QVFO 2KODA 5I4TG 3CPWO 1VQ9P 1VQ6P 2DGYA 3CCLP 4WYMA 1RO0A 3DS1A 3CD6P 1IUQA 3CCSP 3CMAP 2QEXP 3H4EA 3G26A 3DS3A 1RO2A 2OARA 2JYLA 4PH1A 3G6EP 2XT1A 1YITP 2Z45A 3CC7P 3G1GA 1Q86Q 4M0IA 5F2OA 3G4SP 1E6JP 3MGEA 2PY8A 1YIJP 1VQ8P 1VQ7P 4XROA 1VQLP 1K8AQ 1K30A 2EG5A 2JO0A 4U0EA 2PENA 3Q20A 2XXMA 3I56P 4GR2A 3DTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIA A;  1QRJ A;  4WYM A;  3P05 A;  3VRL C;  5JPA A;  3DS1 A;  3G21 A;  5HGM A;  2M8L A;  2ONT A;  4XFZ A;  3H4E A;  3G28 A;  3G26 A;  4U0C A;  3DS4 A;  3DS3 A;  5HGL A;  2JYL A;  4PH1 A;  2LF4 A;  2XT1 A;  3H47 A;  5DCK A;  1A8O A;  4XFX A;  4U0F A;  3NTE A;  3DTJ A;  3G1G A;  3LRY A;  4PH0 A;  4M0I A;  5I4T G;  1AUM A;  1A43 A;  1E6J P;  3MGE A;  4COC A;  5HGO A;  1BAJ A;  3DS2 A;  5HGN A;  3G1I A;  4XFY A;  1EIA A;  4XRQ A;  3G0V A;  3DS5 A;  3G29 A;  4XRO A;  4QNB A;  2XV6 A;  4U0D A;  4U0B A;  1D1D A;  4COP A;  2JYG A;  2L6E A;  1EOQ A;  2BUO A;  2JO0 A;  4U0E A;  3DS0 A;  2KOD A;  3DPH A;  2XXM A;  4IPY A;  4U0A A;  2M8N A;  2M8P A; 
#chains in the Genus database with same CATH topology
 1JJ2 O;  5HGM A;  3CCE P;  1AYI A;  2MVV A;  5F2K A;  1Q7Y Q;  1YJ9 P;  3NTE A;  3OW2 O;  2L4B A;  3DS2 A;  3G1I A;  4PWV B;  3CCR P;  2JYG A;  1VQP P;  1QRJ A;  3LMO A;  2KOR A;  2KOS A;  1KC8 Q;  3M1M A;  3RG6 C;  3NY7 B;  2Z46 A;  4GR6 A;  4MRT C;  3CCQ P;  1BXI A;  2N5H A;  1VKU A;  1UJZ A;  4XRQ A;  3DS5 A;  2Z44 A;  2X2B A;  2VLO A;  1VQO P;  3P05 A;  5JPA A;  1ZNV A;  1KQS O;  2ONT A;  2PEO A;  3E2D A;  2CNR A;  2JU2 A;  2QNW A;  2E1M A;  2K2Q A;  3CCJ P;  1HY8 A;  2P9X A;  1YJW P;  2N50 A;  2MF4 A;  4BPF A;  5BS1 A;  4BPG A;  1DV5 A;  1Q81 Q;  1CEI A;  2KGC A;  1VQ9 P;  4DG9 A;  4HKG A;  2FAD A;  2DGY A;  3CCL P;  1IUQ A;  3CMA P;  2LL8 A;  3U43 A;  4CA3 A;  2XT1 A;  3CC7 P;  2FHS C;  1Q86 Q;  2EHT A;  2PY8 A;  1ACP A;  1YIJ P;  1VQ8 P;  2GZF A;  3GJN A;  4U0E A;  1GXG A;  2LKI A;  1M6E X;  4XFZ A;  2DNW A;  3I55 P;  2LF4 A;  5DCK A;  4QKO A;  4R0M A;  4U0F A;  1L0H A;  3HYB A;  5HGO A;  2MY5 A;  1HQB A;  2KWL A;  2K0Y A;  1F80 D;  4COP A;  4IZ6 A;  3HZQ A;  3CC4 P;  4IPY A;  2LTE A;  1GXH A;  2L22 A;  4XFX A;  3G71 P;  2OTJ P;  2VLP A;  3RG2 A;  2QA4 P;  5KP7 B;  5HVC A;  2PEM A;  1VQK P;  1YHQ P;  1M74 A;  2JBG A;  1KLP A;  2MVU A;  1FR2 A;  3G21 A;  1GPJ A;  1M6N A;  4H2Y C;  3H47 A;  1A8O A;  2OTL P;  2M5R A;  2K5X A;  1AUM A;  1YJN P;  3CCV P;  1BAJ A;  2AFD A;  1EIA A;  2K94 A;  4U0B A;  4NEO A;  1VQ5 P;  3CPW O;  4BPH A;  4WYM A;  3CD6 P;  3CCS P;  2QEX P;  3H4E A;  4H2W C;  3DS3 A;  2NO8 A;  1RO2 A;  3G6E P;  5CZD B;  1YIT P;  1MZ8 A;  2Z45 A;  2FAC A;  1IMP A;  3GZM A;  1AF8 A;  2CGQ A;  1T8K A;  1VQL P;  1K8A Q;  2KGE A;  2K93 A;  2XXM A;  3B5I A;  2LML A;  3GZL A;  3G28 A;  5HGL A;  1VQN P;  2LIW A;  4UHP B;  2GZI A;  3CCM P;  1UNK A;  3B4Q A;  1YI2 P;  2N5I A;  2N6Z A;  2KG6 A;  2GZJ A;  2FAE A;  5HV8 A;  2GDW A;  2XZ1 C;  1W2B O;  2L6E A;  1EOQ A;  3DPH A;  1M90 Q;  3VRL C;  1X3O A;  2L9F A;  1ZMB A;  2M8L A;  4U0C A;  2VLQ A;  2KW2 A;  1VQ4 P;  2LPK A;  5HGN A;  2K0X A;  1QVG O;  3G29 A;  4QNB A;  4U0D A;  4U0A A;  5EJD A;  1E0H A;  2GDY A;  1VHN A;  2EHS A;  2JU1 A;  5KP6 B;  3DS4 A;  2PEK A;  3GKL C;  4PH0 A;  1A43 A;  2VSQ A;  2FVF A;  1N8R Q;  2XZ0 D;  3EJE A;  2PNG A;  4F37 A;  2CWO A;  1QVF O;  1VQ6 P;  5I4T G;  2KOP A;  1RO0 A;  2MR7 A;  2VLN A;  5EW5 E;  4PH1 A;  3G1G A;  2JB0 A;  3MGE A;  2KGD A;  2K92 A;  1EMV A;  2KG8 A;  2ROQ A;  2EIA A;  5KP8 B;  2MD9 A;  2AVA A;  2CQ8 A;  2BHV A;  1Q82 Q;  4H2X C;  3H0D A;  2MR8 A;  2GYK A;  1KD1 Q;  2WPT A;  1M1K Q;  1L0I A;  2EFJ A;  3WBH A;  1D1D A;  3CC2 P;  1DNY A;  2JAZ A;  5F2N A;  5BS2 A;  2KGA A;  2PEI A;  3CXC O;  3EJB A;  1K9M Q;  1IMQ A;  1K73 Q;  2N98 A;  2FQ1 A;  4COC A;  2K0D X;  3EJD A;  4XFY A;  1NJI Q;  2XV6 A;  2ERH A;  2KOQ A;  2PEJ A;  2N6Y A;  3DS0 A;  2AF8 A;  2JGP A;  2M8N A;  2M8P A;  2LIU A;  2L0Q A;  1OR5 A;  2PEQ A;  4PXH B;  2CG5 B;  2GDX A;  2JQ4 A;  3CME P;  3LRY A;  1S72 P;  3CCU P;  1VQM P;  1RNI A;  2KR5 A;  3G0V A;  2LOL A;  7CEI A;  2BUO A;  2KOD A;  1NQ4 A;  2FVE A;  3DS1 A;  2KG9 A;  3G26 A;  3CE7 A;  2AFE A;  2OAR A;  2JYL A;  1Z6M A;  2FVA A;  4M0I A;  5F2O A;  3G4S P;  1E6J P;  2GZE A;  2KOO A;  1VQ7 P;  4XRO A;  2GZG A;  1K30 A;  2EG5 A;  2FQ2 A;  2JO0 A;  2PEN A;  2FQ0 A;  3Q20 A;  3I56 P;  4GR2 A;  3DTJ A; 
#chains in the Genus database with same CATH homology
 2EIA A;  3B5I A;  1JJ2 O;  5HGM A;  3CCE P;  1M6E X;  4XFZ A;  3G28 A;  2BHV A;  1Q82 Q;  5HGL A;  3I55 P;  5F2K A;  2LF4 A;  3H0D A;  5DCK A;  1VQN P;  1Q7Y Q;  4U0F A;  1YJ9 P;  3NTE A;  3OW2 O;  3CCM P;  3HYB A;  1KD1 Q;  5HGO A;  1YI2 P;  1M1K Q;  3DS2 A;  3G1I A;  2EFJ A;  3CCR P;  3WBH A;  1D1D A;  4COP A;  2JYG A;  1VQP P;  2L6E A;  1EOQ A;  1W2B O;  3CC2 P;  3HZQ A;  3CC4 P;  4IPY A;  3DPH A;  1M90 Q;  5F2N A;  1QRJ A;  3VRL C;  5BS2 A;  1ZMB A;  2M8L A;  4U0C A;  2PEI A;  3CXC O;  1KC8 Q;  1VQ4 P;  1K9M Q;  3M1M A;  3RG6 C;  4XFX A;  1K73 Q;  2Z46 A;  4GR6 A;  3G71 P;  4COC A;  2OTJ P;  3CCQ P;  5HGN A;  2QA4 P;  4XFY A;  1NJI Q;  1QVG O;  2PEM A;  4XRQ A;  1VQK P;  3DS5 A;  3G29 A;  1YHQ P;  2Z44 A;  4QNB A;  2XV6 A;  4U0D A;  1M74 A;  2PEJ A;  3DS0 A;  4U0A A;  2M8N A;  2M8P A;  1VQO P;  3P05 A;  5JPA A;  3G21 A;  2PEQ A;  1KQS O;  2ONT A;  1M6N A;  2PEO A;  3DS4 A;  3E2D A;  3H47 A;  2E1M A;  2PEK A;  1A8O A;  2OTL P;  3CME P;  3LRY A;  1S72 P;  4PH0 A;  3CCJ P;  3CCU P;  1AUM A;  1A43 A;  1YJN P;  3CCV P;  2P9X A;  1BAJ A;  1VQM P;  1YJW P;  1RNI A;  1N8R Q;  1EIA A;  3G0V A;  5BS1 A;  4U0B A;  1Q81 Q;  2BUO A;  2CWO A;  1VQ5 P;  1QVF O;  2KOD A;  5I4T G;  3CPW O;  1VQ9 P;  1VQ6 P;  2DGY A;  3CCL P;  4WYM A;  1RO0 A;  3DS1 A;  3CD6 P;  1IUQ A;  3CCS P;  3CMA P;  2QEX P;  3H4E A;  3G26 A;  3DS3 A;  1RO2 A;  2OAR A;  2JYL A;  4PH1 A;  3G6E P;  2XT1 A;  1YIT P;  2Z45 A;  3CC7 P;  3G1G A;  1Q86 Q;  4M0I A;  5F2O A;  3G4S P;  1E6J P;  3MGE A;  2PY8 A;  1YIJ P;  1VQ8 P;  1VQ7 P;  4XRO A;  1VQL P;  1K8A Q;  1K30 A;  2EG5 A;  2JO0 A;  4U0E A;  2PEN A;  3Q20 A;  2XXM A;  3I56 P;  4GR2 A;  3DTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...