4PH1A

C-terminal domain of capsid protein from bovine leukemia virus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
73
Chain Sequence
SVQPWSTIVQGPAESYVEFVNRLQISLADNPKEPIIDSLSYANANKECQQILQGRGLVAAPVGQKLQACAHWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords BLV capsid
publication title STRUCTURAL VIROLOGY. Conformational plasticity of a native retroviral capsid revealed by x-ray crystallography.
pubmed doi rcsb
source organism Bovine leukemia virus
total genus 29
structure length 73
sequence length 78
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4ph1A00
4XRQA 4WYMA 3G1GA 4XFZA 2BUOA 3G1IA 3DS1A 3DS0A 2KODA 2EIAA 1EOQA 3H4EA 3G29A 4PH0A 2JO0A 2JYGA 1BAJA 2L6EA 4XROA 3G28A 3NTEA 5JPAA 2XXMA 3DPHA 4COPA 5HGNA 3DS2A 3DS4A 4COCA 1D1DA 3G26A 2LF4A 3VRLC 2M8LA 1A43A 1E6JP 3DTJA 3G21A 3DS5A 4U0FA 3P05A 3H47A 4M0IA 3G0VA 4IPYA 4XFXA 2M8PA 5HGOA 5DCKA 3LRYA 4U0EA 4XFYA 4U0DA 4PH1A 4U0CA 2M8NA 5I4TG 3MGEA 2JYLA 1EIAA 2ONTA 1AUMA 3DS3A 2XT1A 4U0AA 5HGLA 4QNBA 2XV6A 5HGMA 1A8OA 1QRJA 4U0BA
chains in the Genus database with same CATH superfamily
2N98A 1DNYA 1VQNP 2E1MA 2AVAA 5F2KA 1CEIA 2FVAA 5CZDB 3NTEA 3I55P 2LF4A 3P05A 2CWOA 1VQOP 4PH1A 1NQ4A 5I4TG 2LPKA 2K94A 2PEMA 2PEJA 2BUOA 2VLOA 2OTLP 1K73Q 3VRLC 3DTJA 1OR5A 2DGYA 3G0VA 1M90Q 3NY7B 4GR6A 1EIAA 2XT1A 2MVVA 2KGAA 2VLQA 3CXCO 1YJNP 2EIAA 1S72P 3CCSP 4GR2A 1UNKA 3G21A 1EMVA 4IPYA 1L0HA 3LRYA 1QVGO 1VQ7P 2GZGA 2NO8A 4XRQA 2GZEA 2OTJP 3GZLA 1VQPP 2BHVA 2LIUA 5HGNA 2JQ4A 2FVEA 1A43A 1VQ6P 1UJZA 2M8PA 4U0EA 2KWLA 4U0DA 1VQLP 3B4QA 1KQSO 2VLPA 1BXIA 3RG6C 2OARA 1IMPA 3HZQA 4H2YC 3CD6P 1T8KA 3WBHA 2K0XA 4COPA 4COCA 2VSQA 1YI2P 7CEIA 5HGOA 2CQ8A 2JAZA 2JU2A 2KR5A 3CCJP 3EJEA 2Z44A 3Q20A 4MRTC 2XV6A 4U0CA 4CA3A 3RG2A 1W2BO 2MR7A 2CG5B 3CCMP 2Z45A 2PEQA 1RO0A 5EJDA 1L0IA 2XZ0D 2JO0A 3G6EP 3HYBA 3DS4A 1KD1Q 4NEOA 2L0QA 2N5IA 2JU1A 4XFYA 2L9FA 1VKUA 2L4BA 4BPFA 1A8OA 4IZ6A 2KOPA 1IUQA 1K8AQ 1K30A 2KG8A 2FADA 1RO2A 4H2XC 1HY8A 2PY8A 2LMLA 2JBGA 3H47A 2X2BA 1KLPA 3CMEP 2MR8A 1AYIA 2ROQA 1GXHA 3MGEA 2KW2A 4BPGA 1JJ2O 2K93A 3G1GA 1RNIA 3DS1A 2EHTA 3G29A 3GZMA 2FAEA 1DV5A 1BAJA 1VQ4P 4R0MA 5JPAA 1VHNA 1YJWP 5BS1A 2QNWA 1HQBA 2KOQA 2XZ1C 2M8NA 5KP7B 3CCVP 2PNGA 4F37A 2GZFA 1Z6MA 4WYMA 5KP8B 3CCEP 4PXHB 2VLNA 4BPHA 2N5HA 1YITP 1GPJA 2KG9A 4U0FA 1YIJP 2PEKA 2GDXA 2MVUA 2MY5A 2MF4A 5HV8A 2MD9A 1FR2A 2PENA 1K9MQ 3CE7A 3H4EA 3I56P 2K0DX 5EW5E 2CGQA 2K0YA 3EJBA 2PEOA 1VQMP 5BS2A 3CC2P 2EFJA 5HGLA 2KG6A 2JGPA 5KP6B 1NJIQ 1Q7YQ 2JB0A 1ZNVA 5HVCA 4UHPB 4H2WC 3H0DA 1KC8Q 1VQKP 2EHSA 1VQ9P 2AFDA 4DG9A 4U0AA 3DS3A 2PEIA 1IMQA 1ZMBA 1Q86Q 5F2NA 1F80D 1EOQA 2L22A 3G28A 2LL8A 1Q82Q 3E2DA 2FHSC 1YHQP 2N6ZA 1VQ5P 2LOLA 2QEXP 2GDWA 2ERHA 2M8LA 2M5RA 3CCRP 5HGMA 2KOSA 2LIWA 1N8RQ 2P9XA 1ACPA 2WPTA 2JYGA 3CMAP 4HKGA 2FQ1A 5F2OA 3CCLP 2GDYA 5DCKA 2GZJA 2JYLA 2KORA 1QVFO 2EG5A 2FQ2A 3CC7P 2CNRA 2L6EA 3LMOA 2XXMA 2AF8A 3U43A 3B5IA 1E6JP 1M1KQ 4M0IA 2N6YA 1YJ9P 3CCQP 3G4SP 1AF8A 2Z46A 1MZ8A 1E0HA 4U0BA 1M74A 1GXGA 2GZIA 2K5XA 4XFZA 3M1MA 2KODA 3CPWO 4PH0A 2GYKA 2KOOA 3GKLC 4PWVB 3CCUP 4QKOA 2K2QA 3DS5A 1VQ8P 1AUMA 2DNWA 1QRJA 2KGEA 3GJNA 3G1IA 3DS0A 2KGDA 3OW2O 4XROA 3EJDA 1X3OA 1M6EX 2LTEA 3DPHA 3DS2A 1D1DA 3G26A 2QA4P 2AFEA 3G71P 2FVFA 2FACA 3CC4P 2K92A 1M6NA 2N50A 2FQ0A 2KGCA 2ONTA 2LKIA 4QNBA 4XFXA 1Q81Q
chains in the Genus database with same CATH topology
3RG6C 2OARA 3CCEP 2P9XA 4WYMA 1VQNP 2E1MA 3HZQA 5F2KA 3CD6P 3WBHA 2JYGA 3CMAP 3NTEA 3I55P 4COPA 4COCA 5F2OA 1YI2P 1YITP 3CCLP 2LF4A 4U0FA 3P05A 1YIJP 2CWOA 5HGOA 5DCKA 2PEKA 1VQOP 4PH1A 3CCJP 5I4TG 2PEMA 2JYLA 2Z44A 1QVFO 3Q20A 2XV6A 4U0CA 2PEJA 2EG5A 1W2BO 3CCMP 2Z45A 2PEQA 2PENA 1RO0A 2BUOA 1K9MQ 3CC7P 3H4EA 3I56P 2JO0A 1Q81Q 2L6EA 3G6EP 2XXMA 3HYBA 3DS4A 2OTLP 1K73Q 1KD1Q 3VRLC 3B5IA 1E6JP 3DTJA 1M1KQ 2PEOA 4M0IA 2DGYA 3G0VA 1VQMP 1YJ9P 3CCQP 3G4SP 1M90Q 4XFYA 2Z46A 4GR6A 5BS2A 3CC2P 2EFJA 1EIAA 5HGLA 2XT1A 1A8OA 4U0BA 3CXCO 1M74A 1NJIQ 1IUQA 4XFZA 1YJNP 1K8AQ 1K30A 3M1MA 2KODA 2EIAA 3CPWO 4PH0A 1S72P 1Q7YQ 3CCSP 3CCUP 1RO2A 4GR2A 2PY8A 3G21A 3DS5A 3H47A 3H0DA 4IPYA 1KC8Q 1VQKP 3LRYA 1QVGO 3CMEP 1VQ9P 1VQ7P 3MGEA 1VQ8P 1AUMA 3DS3A 4U0AA 2PEIA 1JJ2O 1QRJA 4XRQA 1ZMBA 1Q86Q 1N8RQ 3G1GA 1RNIA 3G1IA 5F2NA 3DS1A 3DS0A 1EOQA 2OTJP 3G29A 3OW2O 1BAJA 2BHVA 4XROA 1VQPP 3G28A 1VQ4P 5JPAA 1M6EX 1Q82Q 3DPHA 3E2DA 5HGNA 3DS2A 1D1DA 3G26A 2QA4P 2M8LA 1A43A 3G71P 1YHQP 1YJWP 1VQ6P 3CC4P 5BS1A 1VQ5P 2M8PA 4U0EA 1M6NA 4U0DA 1VQLP 2QEXP 1KQSO 2M8NA 2ONTA 4QNBA 3CCVP 4XFXA 3CCRP 5HGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRQ A;  4WYM A;  3G1G A;  4XFZ A;  2BUO A;  3G1I A;  3DS1 A;  3DS0 A;  2KOD A;  2EIA A;  1EOQ A;  3H4E A;  3G29 A;  4PH0 A;  2JO0 A;  2JYG A;  1BAJ A;  2L6E A;  4XRO A;  3G28 A;  3NTE A;  5JPA A;  2XXM A;  3DPH A;  4COP A;  5HGN A;  3DS2 A;  3DS4 A;  4COC A;  1D1D A;  3G26 A;  2LF4 A;  3VRL C;  2M8L A;  1A43 A;  1E6J P;  3DTJ A;  3G21 A;  3DS5 A;  4U0F A;  3P05 A;  3H47 A;  4M0I A;  3G0V A;  4IPY A;  4XFX A;  2M8P A;  5HGO A;  5DCK A;  3LRY A;  4U0E A;  4XFY A;  4U0D A;  4PH1 A;  4U0C A;  2M8N A;  5I4T G;  3MGE A;  2JYL A;  1EIA A;  2ONT A;  1AUM A;  3DS3 A;  2XT1 A;  4U0A A;  5HGL A;  4QNB A;  2XV6 A;  5HGM A;  1A8O A;  1QRJ A;  4U0B A; 
#chains in the Genus database with same CATH topology
 2N98 A;  1DNY A;  1VQN P;  2E1M A;  2AVA A;  5F2K A;  1CEI A;  2FVA A;  5CZD B;  3NTE A;  3I55 P;  2LF4 A;  3P05 A;  2CWO A;  1VQO P;  4PH1 A;  1NQ4 A;  5I4T G;  2LPK A;  2K94 A;  2PEM A;  2PEJ A;  2BUO A;  2VLO A;  2OTL P;  1K73 Q;  3VRL C;  3DTJ A;  1OR5 A;  2DGY A;  3G0V A;  1M90 Q;  3NY7 B;  4GR6 A;  1EIA A;  2XT1 A;  2MVV A;  2KGA A;  2VLQ A;  3CXC O;  1YJN P;  2EIA A;  1S72 P;  3CCS P;  4GR2 A;  1UNK A;  3G21 A;  1EMV A;  4IPY A;  1L0H A;  3LRY A;  1QVG O;  1VQ7 P;  2GZG A;  2NO8 A;  4XRQ A;  2GZE A;  2OTJ P;  3GZL A;  1VQP P;  2BHV A;  2LIU A;  5HGN A;  2JQ4 A;  2FVE A;  1A43 A;  1VQ6 P;  1UJZ A;  2M8P A;  4U0E A;  2KWL A;  4U0D A;  1VQL P;  3B4Q A;  1KQS O;  2VLP A;  1BXI A;  3RG6 C;  2OAR A;  1IMP A;  3HZQ A;  4H2Y C;  3CD6 P;  1T8K A;  3WBH A;  2K0X A;  4COP A;  4COC A;  2VSQ A;  1YI2 P;  7CEI A;  5HGO A;  2CQ8 A;  2JAZ A;  2JU2 A;  2KR5 A;  3CCJ P;  3EJE A;  2Z44 A;  3Q20 A;  4MRT C;  2XV6 A;  4U0C A;  4CA3 A;  3RG2 A;  1W2B O;  2MR7 A;  2CG5 B;  3CCM P;  2Z45 A;  2PEQ A;  1RO0 A;  5EJD A;  1L0I A;  2XZ0 D;  2JO0 A;  3G6E P;  3HYB A;  3DS4 A;  1KD1 Q;  4NEO A;  2L0Q A;  2N5I A;  2JU1 A;  4XFY A;  2L9F A;  1VKU A;  2L4B A;  4BPF A;  1A8O A;  4IZ6 A;  2KOP A;  1IUQ A;  1K8A Q;  1K30 A;  2KG8 A;  2FAD A;  1RO2 A;  4H2X C;  1HY8 A;  2PY8 A;  2LML A;  2JBG A;  3H47 A;  2X2B A;  1KLP A;  3CME P;  2MR8 A;  1AYI A;  2ROQ A;  1GXH A;  3MGE A;  2KW2 A;  4BPG A;  1JJ2 O;  2K93 A;  3G1G A;  1RNI A;  3DS1 A;  2EHT A;  3G29 A;  3GZM A;  2FAE A;  1DV5 A;  1BAJ A;  1VQ4 P;  4R0M A;  5JPA A;  1VHN A;  1YJW P;  5BS1 A;  2QNW A;  1HQB A;  2KOQ A;  2XZ1 C;  2M8N A;  5KP7 B;  3CCV P;  2PNG A;  4F37 A;  2GZF A;  1Z6M A;  4WYM A;  5KP8 B;  3CCE P;  4PXH B;  2VLN A;  4BPH A;  2N5H A;  1YIT P;  1GPJ A;  2KG9 A;  4U0F A;  1YIJ P;  2PEK A;  2GDX A;  2MVU A;  2MY5 A;  2MF4 A;  5HV8 A;  2MD9 A;  1FR2 A;  2PEN A;  1K9M Q;  3CE7 A;  3H4E A;  3I56 P;  2K0D X;  5EW5 E;  2CGQ A;  2K0Y A;  3EJB A;  2PEO A;  1VQM P;  5BS2 A;  3CC2 P;  2EFJ A;  5HGL A;  2KG6 A;  2JGP A;  5KP6 B;  1NJI Q;  1Q7Y Q;  2JB0 A;  1ZNV A;  5HVC A;  4UHP B;  4H2W C;  3H0D A;  1KC8 Q;  1VQK P;  2EHS A;  1VQ9 P;  2AFD A;  4DG9 A;  4U0A A;  3DS3 A;  2PEI A;  1IMQ A;  1ZMB A;  1Q86 Q;  5F2N A;  1F80 D;  1EOQ A;  2L22 A;  3G28 A;  2LL8 A;  1Q82 Q;  3E2D A;  2FHS C;  1YHQ P;  2N6Z A;  1VQ5 P;  2LOL A;  2QEX P;  2GDW A;  2ERH A;  2M8L A;  2M5R A;  3CCR P;  5HGM A;  2KOS A;  2LIW A;  1N8R Q;  2P9X A;  1ACP A;  2WPT A;  2JYG A;  3CMA P;  4HKG A;  2FQ1 A;  5F2O A;  3CCL P;  2GDY A;  5DCK A;  2GZJ A;  2JYL A;  2KOR A;  1QVF O;  2EG5 A;  2FQ2 A;  3CC7 P;  2CNR A;  2L6E A;  3LMO A;  2XXM A;  2AF8 A;  3U43 A;  3B5I A;  1E6J P;  1M1K Q;  4M0I A;  2N6Y A;  1YJ9 P;  3CCQ P;  3G4S P;  1AF8 A;  2Z46 A;  1MZ8 A;  1E0H A;  4U0B A;  1M74 A;  1GXG A;  2GZI A;  2K5X A;  4XFZ A;  3M1M A;  2KOD A;  3CPW O;  4PH0 A;  2GYK A;  2KOO A;  3GKL C;  4PWV B;  3CCU P;  4QKO A;  2K2Q A;  3DS5 A;  1VQ8 P;  1AUM A;  2DNW A;  1QRJ A;  2KGE A;  3GJN A;  3G1I A;  3DS0 A;  2KGD A;  3OW2 O;  4XRO A;  3EJD A;  1X3O A;  1M6E X;  2LTE A;  3DPH A;  3DS2 A;  1D1D A;  3G26 A;  2QA4 P;  2AFE A;  3G71 P;  2FVF A;  2FAC A;  3CC4 P;  2K92 A;  1M6N A;  2N50 A;  2FQ0 A;  2KGC A;  2ONT A;  2LKI A;  4QNB A;  4XFX A;  1Q81 Q; 
#chains in the Genus database with same CATH homology
 3RG6 C;  2OAR A;  3CCE P;  2P9X A;  4WYM A;  1VQN P;  2E1M A;  3HZQ A;  5F2K A;  3CD6 P;  3WBH A;  2JYG A;  3CMA P;  3NTE A;  3I55 P;  4COP A;  4COC A;  5F2O A;  1YI2 P;  1YIT P;  3CCL P;  2LF4 A;  4U0F A;  3P05 A;  1YIJ P;  2CWO A;  5HGO A;  5DCK A;  2PEK A;  1VQO P;  4PH1 A;  3CCJ P;  5I4T G;  2PEM A;  2JYL A;  2Z44 A;  1QVF O;  3Q20 A;  2XV6 A;  4U0C A;  2PEJ A;  2EG5 A;  1W2B O;  3CCM P;  2Z45 A;  2PEQ A;  2PEN A;  1RO0 A;  2BUO A;  1K9M Q;  3CC7 P;  3H4E A;  3I56 P;  2JO0 A;  1Q81 Q;  2L6E A;  3G6E P;  2XXM A;  3HYB A;  3DS4 A;  2OTL P;  1K73 Q;  1KD1 Q;  3VRL C;  3B5I A;  1E6J P;  3DTJ A;  1M1K Q;  2PEO A;  4M0I A;  2DGY A;  3G0V A;  1VQM P;  1YJ9 P;  3CCQ P;  3G4S P;  1M90 Q;  4XFY A;  2Z46 A;  4GR6 A;  5BS2 A;  3CC2 P;  2EFJ A;  1EIA A;  5HGL A;  2XT1 A;  1A8O A;  4U0B A;  3CXC O;  1M74 A;  1NJI Q;  1IUQ A;  4XFZ A;  1YJN P;  1K8A Q;  1K30 A;  3M1M A;  2KOD A;  2EIA A;  3CPW O;  4PH0 A;  1S72 P;  1Q7Y Q;  3CCS P;  3CCU P;  1RO2 A;  4GR2 A;  2PY8 A;  3G21 A;  3DS5 A;  3H47 A;  3H0D A;  4IPY A;  1KC8 Q;  1VQK P;  3LRY A;  1QVG O;  3CME P;  1VQ9 P;  1VQ7 P;  3MGE A;  1VQ8 P;  1AUM A;  3DS3 A;  4U0A A;  2PEI A;  1JJ2 O;  1QRJ A;  4XRQ A;  1ZMB A;  1Q86 Q;  1N8R Q;  3G1G A;  1RNI A;  3G1I A;  5F2N A;  3DS1 A;  3DS0 A;  1EOQ A;  2OTJ P;  3G29 A;  3OW2 O;  1BAJ A;  2BHV A;  4XRO A;  1VQP P;  3G28 A;  1VQ4 P;  5JPA A;  1M6E X;  1Q82 Q;  3DPH A;  3E2D A;  5HGN A;  3DS2 A;  1D1D A;  3G26 A;  2QA4 P;  2M8L A;  1A43 A;  3G71 P;  1YHQ P;  1YJW P;  1VQ6 P;  3CC4 P;  5BS1 A;  1VQ5 P;  2M8P A;  4U0E A;  1M6N A;  4U0D A;  1VQL P;  2QEX P;  1KQS O;  2M8N A;  2ONT A;  4QNB A;  3CCV P;  4XFX A;  3CCR P;  5HGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...