4PH1A

C-terminal domain of capsid protein from bovine leukemia virus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
78
structure length
73
Chain Sequence
SVQPWSTIVQGPAESYVEFVNRLQISLADNPKEPIIDSLSYANANKECQQILQGRGLVAAPVGQKLQACAHWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BLV capsid
publication title STRUCTURAL VIROLOGY. Conformational plasticity of a native retroviral capsid revealed by x-ray crystallography.
pubmed doi rcsb
source organism Bovine leukemia virus
molecule tags Viral protein
total genus 29
structure length 73
sequence length 78
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4ph1A00
3DS1A 5JPAA 3G1GA 3H47A 4COPA 3LRYA 5HGOA 5HGNA 4U0EA 4U0DA 3DS3A 2M8PA 2ONTA 1E6JP 4U0FA 5HGMA 3DPHA 3G29A 4XFZA 2M8LA 3G26A 1A8OA 2M8NA 5I4TG 4COCA 4QNBA 2BUOA 2L6EA 3NTEA 2JYLA 3G0VA 4PH1A 4U0AA 4WYMA 4XFXA 2JYGA 1A43A 2LF4A 2XV6A 1D1DA 1QRJA 5DCKA 2KODA 2XT1A 3DS5A 3DS4A 3G21A 3MGEA 4PH0A 3VRLC 3P05A 3H4EA 4IPYA 4U0BA 5HGLA 2XXMA 3DTJA 2JO0A 4XROA 4U0CA 2EIAA 1EIAA 3DS2A 1AUMA 3G1IA 4XFYA 3DS0A 4M0IA 4XRQA 3G28A 1EOQA 1BAJA
chains in the Genus database with same CATH superfamily
1VQKP 2GZJA 4CA3A 3CCSP 2FHSC 2BUOA 1L0HA 1ZMBA 1GXGA 5F2KA 2LIUA 1KQSO 2CNRA 1RO0A 2LPKA 3DS4A 1JJ2O 2JO0A 3GKLC 4XFYA 3B4QA 2MVUA 3CMEP 1VQ8P 3RG2A 4U0DA 3CCQP 4U0FA 5BS1A 5I4TG 1VQ6P 1YIJP 2LTEA 2OARA 3CC7P 3B5IA 2MR7A 2N50A 1L0IA 2MD9A 1OR5A 3GJNA 5KP8B 2GDYA 1YJWP 1S72P 1Q86Q 2EIAA 3H0DA 2KG6A 3LMOA 5HVCA 3DS1A 3G71P 2LMLA 5HGOA 2L4BA 2LL8A 2AFEA 4COCA 4BPFA 2N6ZA 4U0AA 2PY8A 4WYMA 1QRJA 1VQ4P 2PEKA 2K0YA 4XROA 2FQ1A 2GZIA 4BPGA 1YITP 2L9FA 2NO8A 1YJ9P 1GXHA 2KG8A 3OW2O 4PH1A 2QNWA 4PWVB 2N5HA 1EOQA 1BAJA 2FQ2A 3WBHA 4DG9A 1Z6MA 3DPHA 1F80D 1VQ5P 1ZNVA 1CEIA 2QEXP 2DNWA 4XFXA 3M1MA 2XZ0D 3G6EP 3EJDA 2K0DX 5HGLA 3CCEP 5EW5E 3CD6P 2WPTA 4PH0A 5HGNA 1T8KA 2CWOA 1A8OA 1YHQP 5F2NA 1RO2A 2MY5A 1VQ9P 1D1DA 5DCKA 3DS5A 1GPJA 3E2DA 2K0XA 3LRYA 1RNIA 2ONTA 1E6JP 2VLQA 3CC2P 3CCLP 4GR2A 2K2QA 2CGQA 1HQBA 2X2BA 2MR8A 2CG5B 2KODA 3G21A 3MGEA 3VRLC 2AF8A 1FR2A 4R0MA 3I56P 3DS2A 3CCRP 2FQ0A 2N5IA 2PNGA 3DS0A 3RG6C 2KG9A 2JU2A 3HYBA 1BXIA 4U0EA 4HKGA 3EJBA 5HGMA 2ERHA 1VQLP 2L6EA 3NY7B 1A43A 2FADA 3G4SP 1AF8A 4U0BA 2K5XA 2KOOA 1K30A 3CCMP 2FACA 1AYIA 2JB0A 2GZGA 3G29A 2KGAA 2GDWA 5F2OA 1M6NA 3CC4P 3CMAP 3G0VA 1IMQA 2JGPA 1MZ8A 1VHNA 3P05A 4MRTC 2EFJA 2FVAA 2KOQA 2MF4A 3HZQA 4XRQA 1YJNP 5HV8A 7CEIA 2M8NA 2BHVA 5KP7B 5CZDB 2KORA 1QVFO 2LF4A 2XT1A 2LOLA 4BPHA 2EHTA 2N98A 1M90Q 1N8RQ 4UHPB 2KOPA 3H47A 1UJZA 2M5RA 3I55P 2OTLP 4F37A 4NEOA 2OTJP 1VQ7P 1NQ4A 2VLNA 3G26A 2KGCA 1IUQA 2PENA 5KP6B 1UNKA 1KD1Q 4GR6A 1Q81Q 3CCVP 1ACPA 3DTJA 1W2BO 1EIAA 4H2YC 5BS2A 1K8AQ 2Z45A 3U43A 2K92A 4QNBA 3NTEA 1M1KQ 1VQMP 1EMVA 2EG5A 3H4EA 2K94A 2VLPA 3CXCO 2JBGA 2PEMA 1M74A 2N6YA 2GYKA 4M0IA 4IPYA 2EHSA 2LKIA 2VLOA 3Q20A 2PEQA 1VQPP 5EJDA 2KGEA 1VKUA 2AFDA 2JYLA 2JU1A 4QKOA 1HY8A 1M6EX 1VQOP 2ROQA 2XXMA 2E1MA 2MVVA 4U0CA 3CPWO 1K73Q 1AUMA 3G28A 2LIWA 3DS3A 2DGYA 1DV5A 2Z44A 2KW2A 2XV6A 2KOSA 3GZMA 2GZFA 3CE7A 2FAEA 2PEIA 1DNYA 1KLPA 2PEJA 3G1IA 4H2XC 2KWLA 3G1GA 4COPA 1YI2P 2JAZA 2VSQA 2AVAA 1K9MQ 2K93A 2M8PA 2M8LA 4XFZA 3CCUP 2GZEA 2QA4P 2XZ1C 1QVGO 2KR5A 4H2WC 2JYGA 3GZLA 2Z46A 3CCJP 1Q7YQ 1IMPA 1KC8Q 1E0HA 4PXHB 5JPAA 2L22A 2FVFA 2FVEA 4IZ6A 1VQNP 2KGDA 2GDXA 2PEOA 2CQ8A 2L0QA 1Q82Q 1X3OA 2JQ4A 3EJEA 2P9XA 1NJIQ
chains in the Genus database with same CATH topology
3WBHA 1VQKP 3Q20A 2PEQA 3CCSP 1VQPP 3DPHA 3G29A 1VQ5P 2BUOA 5F2OA 1M6NA 3CC4P 2JYLA 3G0VA 3CMAP 2QEXP 1ZMBA 4XFXA 3M1MA 5F2KA 3G6EP 1KQSO 1RO0A 3DS4A 1JJ2O 1M6EX 1VQOP 3P05A 5HGLA 3CCEP 2XXMA 2JO0A 2EFJA 3CD6P 2E1MA 3HZQA 4U0CA 3CPWO 4XRQA 1K73Q 1AUMA 4XFYA 3G28A 4PH0A 3CMEP 1YJNP 1VQ8P 5HGNA 4U0DA 3CCQP 3DS3A 4U0FA 2CWOA 5BS1A 2DGYA 5I4TG 1VQ6P 1A8OA 2M8NA 1YIJP 2BHVA 1YHQP 2OARA 5F2NA 3CC7P 3B5IA 1QVFO 1RO2A 2Z44A 2LF4A 2XV6A 1VQ9P 5DCKA 1D1DA 2XT1A 3DS5A 1YJWP 4IPYA 1S72P 2PEIA 1M90Q 1N8RQ 2PEJA 1Q86Q 2EIAA 3H0DA 3G1IA 3E2DA 3DS1A 3G71P 3G1GA 3H47A 4COPA 3LRYA 1RNIA 3I55P 1YI2P 5HGOA 2OTLP 2OTJP 1K9MQ 2M8PA 2ONTA 1E6JP 2M8LA 1VQ7P 3CC2P 4XFZA 3CCUP 3CCLP 3G26A 1IUQA 2PENA 4COCA 4GR2A 2QA4P 4U0AA 1QVGO 1KD1Q 2PY8A 4GR6A 4WYMA 2JYGA 1QRJA 2Z46A 1Q81Q 2KODA 1VQ4P 3G21A 3MGEA 3CCVP 2PEKA 3VRLC 3CCJP 3DTJA 1Q7YQ 4XROA 1W2BO 1KC8Q 3I56P 1EIAA 3DS2A 3CCRP 1YITP 3DS0A 3RG6C 5JPAA 3HYBA 1YJ9P 5BS2A 4U0EA 1K8AQ 2Z45A 5HGMA 1VQLP 1VQNP 4QNBA 2L6EA 3NTEA 3OW2O 4PH1A 1M1KQ 2PEOA 1Q82Q 1A43A 3G4SP 1VQMP 2EG5A 3H4EA 4U0BA 3CXCO 2P9XA 2PEMA 1M74A 1NJIQ 4M0IA 1K30A 1EOQA 3CCMP 1BAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS1 A;  5JPA A;  3G1G A;  3H47 A;  4COP A;  3LRY A;  5HGO A;  5HGN A;  4U0E A;  4U0D A;  3DS3 A;  2M8P A;  2ONT A;  1E6J P;  4U0F A;  5HGM A;  3DPH A;  3G29 A;  4XFZ A;  2M8L A;  3G26 A;  1A8O A;  2M8N A;  5I4T G;  4COC A;  4QNB A;  2BUO A;  2L6E A;  3NTE A;  2JYL A;  3G0V A;  4PH1 A;  4U0A A;  4WYM A;  4XFX A;  2JYG A;  1A43 A;  2LF4 A;  2XV6 A;  1D1D A;  1QRJ A;  5DCK A;  2KOD A;  2XT1 A;  3DS5 A;  3DS4 A;  3G21 A;  3MGE A;  4PH0 A;  3VRL C;  3P05 A;  3H4E A;  4IPY A;  4U0B A;  5HGL A;  2XXM A;  3DTJ A;  2JO0 A;  4XRO A;  4U0C A;  2EIA A;  1EIA A;  3DS2 A;  1AUM A;  3G1I A;  4XFY A;  3DS0 A;  4M0I A;  4XRQ A;  3G28 A;  1EOQ A;  1BAJ A; 
#chains in the Genus database with same CATH topology
 1VQK P;  2GZJ A;  4CA3 A;  3CCS P;  2FHS C;  2BUO A;  1L0H A;  1ZMB A;  1GXG A;  5F2K A;  2LIU A;  1KQS O;  2CNR A;  1RO0 A;  2LPK A;  3DS4 A;  1JJ2 O;  2JO0 A;  3GKL C;  4XFY A;  3B4Q A;  2MVU A;  3CME P;  1VQ8 P;  3RG2 A;  4U0D A;  3CCQ P;  4U0F A;  5BS1 A;  5I4T G;  1VQ6 P;  1YIJ P;  2LTE A;  2OAR A;  3CC7 P;  3B5I A;  2MR7 A;  2N50 A;  1L0I A;  2MD9 A;  1OR5 A;  3GJN A;  5KP8 B;  2GDY A;  1YJW P;  1S72 P;  1Q86 Q;  2EIA A;  3H0D A;  2KG6 A;  3LMO A;  5HVC A;  3DS1 A;  3G71 P;  2LML A;  5HGO A;  2L4B A;  2LL8 A;  2AFE A;  4COC A;  4BPF A;  2N6Z A;  4U0A A;  2PY8 A;  4WYM A;  1QRJ A;  1VQ4 P;  2PEK A;  2K0Y A;  4XRO A;  2FQ1 A;  2GZI A;  4BPG A;  1YIT P;  2L9F A;  2NO8 A;  1YJ9 P;  1GXH A;  2KG8 A;  3OW2 O;  4PH1 A;  2QNW A;  4PWV B;  2N5H A;  1EOQ A;  1BAJ A;  2FQ2 A;  3WBH A;  4DG9 A;  1Z6M A;  3DPH A;  1F80 D;  1VQ5 P;  1ZNV A;  1CEI A;  2QEX P;  2DNW A;  4XFX A;  3M1M A;  2XZ0 D;  3G6E P;  3EJD A;  2K0D X;  5HGL A;  3CCE P;  5EW5 E;  3CD6 P;  2WPT A;  4PH0 A;  5HGN A;  1T8K A;  2CWO A;  1A8O A;  1YHQ P;  5F2N A;  1RO2 A;  2MY5 A;  1VQ9 P;  1D1D A;  5DCK A;  3DS5 A;  1GPJ A;  3E2D A;  2K0X A;  3LRY A;  1RNI A;  2ONT A;  1E6J P;  2VLQ A;  3CC2 P;  3CCL P;  4GR2 A;  2K2Q A;  2CGQ A;  1HQB A;  2X2B A;  2MR8 A;  2CG5 B;  2KOD A;  3G21 A;  3MGE A;  3VRL C;  2AF8 A;  1FR2 A;  4R0M A;  3I56 P;  3DS2 A;  3CCR P;  2FQ0 A;  2N5I A;  2PNG A;  3DS0 A;  3RG6 C;  2KG9 A;  2JU2 A;  3HYB A;  1BXI A;  4U0E A;  4HKG A;  3EJB A;  5HGM A;  2ERH A;  1VQL P;  2L6E A;  3NY7 B;  1A43 A;  2FAD A;  3G4S P;  1AF8 A;  4U0B A;  2K5X A;  2KOO A;  1K30 A;  3CCM P;  2FAC A;  1AYI A;  2JB0 A;  2GZG A;  3G29 A;  2KGA A;  2GDW A;  5F2O A;  1M6N A;  3CC4 P;  3CMA P;  3G0V A;  1IMQ A;  2JGP A;  1MZ8 A;  1VHN A;  3P05 A;  4MRT C;  2EFJ A;  2FVA A;  2KOQ A;  2MF4 A;  3HZQ A;  4XRQ A;  1YJN P;  5HV8 A;  7CEI A;  2M8N A;  2BHV A;  5KP7 B;  5CZD B;  2KOR A;  1QVF O;  2LF4 A;  2XT1 A;  2LOL A;  4BPH A;  2EHT A;  2N98 A;  1M90 Q;  1N8R Q;  4UHP B;  2KOP A;  3H47 A;  1UJZ A;  2M5R A;  3I55 P;  2OTL P;  4F37 A;  4NEO A;  2OTJ P;  1VQ7 P;  1NQ4 A;  2VLN A;  3G26 A;  2KGC A;  1IUQ A;  2PEN A;  5KP6 B;  1UNK A;  1KD1 Q;  4GR6 A;  1Q81 Q;  3CCV P;  1ACP A;  3DTJ A;  1W2B O;  1EIA A;  4H2Y C;  5BS2 A;  1K8A Q;  2Z45 A;  3U43 A;  2K92 A;  4QNB A;  3NTE A;  1M1K Q;  1VQM P;  1EMV A;  2EG5 A;  3H4E A;  2K94 A;  2VLP A;  3CXC O;  2JBG A;  2PEM A;  1M74 A;  2N6Y A;  2GYK A;  4M0I A;  4IPY A;  2EHS A;  2LKI A;  2VLO A;  3Q20 A;  2PEQ A;  1VQP P;  5EJD A;  2KGE A;  1VKU A;  2AFD A;  2JYL A;  2JU1 A;  4QKO A;  1HY8 A;  1M6E X;  1VQO P;  2ROQ A;  2XXM A;  2E1M A;  2MVV A;  4U0C A;  3CPW O;  1K73 Q;  1AUM A;  3G28 A;  2LIW A;  3DS3 A;  2DGY A;  1DV5 A;  2Z44 A;  2KW2 A;  2XV6 A;  2KOS A;  3GZM A;  2GZF A;  3CE7 A;  2FAE A;  2PEI A;  1DNY A;  1KLP A;  2PEJ A;  3G1I A;  4H2X C;  2KWL A;  3G1G A;  4COP A;  1YI2 P;  2JAZ A;  2VSQ A;  2AVA A;  1K9M Q;  2K93 A;  2M8P A;  2M8L A;  4XFZ A;  3CCU P;  2GZE A;  2QA4 P;  2XZ1 C;  1QVG O;  2KR5 A;  4H2W C;  2JYG A;  3GZL A;  2Z46 A;  3CCJ P;  1Q7Y Q;  1IMP A;  1KC8 Q;  1E0H A;  4PXH B;  5JPA A;  2L22 A;  2FVF A;  2FVE A;  4IZ6 A;  1VQN P;  2KGD A;  2GDX A;  2PEO A;  2CQ8 A;  2L0Q A;  1Q82 Q;  1X3O A;  2JQ4 A;  3EJE A;  2P9X A;  1NJI Q; 
#chains in the Genus database with same CATH homology
 3WBH A;  1VQK P;  3Q20 A;  2PEQ A;  3CCS P;  1VQP P;  3DPH A;  3G29 A;  1VQ5 P;  2BUO A;  5F2O A;  1M6N A;  3CC4 P;  2JYL A;  3G0V A;  3CMA P;  2QEX P;  1ZMB A;  4XFX A;  3M1M A;  5F2K A;  3G6E P;  1KQS O;  1RO0 A;  3DS4 A;  1JJ2 O;  1M6E X;  1VQO P;  3P05 A;  5HGL A;  3CCE P;  2XXM A;  2JO0 A;  2EFJ A;  3CD6 P;  2E1M A;  3HZQ A;  4U0C A;  3CPW O;  4XRQ A;  1K73 Q;  1AUM A;  4XFY A;  3G28 A;  4PH0 A;  3CME P;  1YJN P;  1VQ8 P;  5HGN A;  4U0D A;  3CCQ P;  3DS3 A;  4U0F A;  2CWO A;  5BS1 A;  2DGY A;  5I4T G;  1VQ6 P;  1A8O A;  2M8N A;  1YIJ P;  2BHV A;  1YHQ P;  2OAR A;  5F2N A;  3CC7 P;  3B5I A;  1QVF O;  1RO2 A;  2Z44 A;  2LF4 A;  2XV6 A;  1VQ9 P;  5DCK A;  1D1D A;  2XT1 A;  3DS5 A;  1YJW P;  4IPY A;  1S72 P;  2PEI A;  1M90 Q;  1N8R Q;  2PEJ A;  1Q86 Q;  2EIA A;  3H0D A;  3G1I A;  3E2D A;  3DS1 A;  3G71 P;  3G1G A;  3H47 A;  4COP A;  3LRY A;  1RNI A;  3I55 P;  1YI2 P;  5HGO A;  2OTL P;  2OTJ P;  1K9M Q;  2M8P A;  2ONT A;  1E6J P;  2M8L A;  1VQ7 P;  3CC2 P;  4XFZ A;  3CCU P;  3CCL P;  3G26 A;  1IUQ A;  2PEN A;  4COC A;  4GR2 A;  2QA4 P;  4U0A A;  1QVG O;  1KD1 Q;  2PY8 A;  4GR6 A;  4WYM A;  2JYG A;  1QRJ A;  2Z46 A;  1Q81 Q;  2KOD A;  1VQ4 P;  3G21 A;  3MGE A;  3CCV P;  2PEK A;  3VRL C;  3CCJ P;  3DTJ A;  1Q7Y Q;  4XRO A;  1W2B O;  1KC8 Q;  3I56 P;  1EIA A;  3DS2 A;  3CCR P;  1YIT P;  3DS0 A;  3RG6 C;  5JPA A;  3HYB A;  1YJ9 P;  5BS2 A;  4U0E A;  1K8A Q;  2Z45 A;  5HGM A;  1VQL P;  1VQN P;  4QNB A;  2L6E A;  3NTE A;  3OW2 O;  4PH1 A;  1M1K Q;  2PEO A;  1Q82 Q;  1A43 A;  3G4S P;  1VQM P;  2EG5 A;  3H4E A;  4U0B A;  3CXC O;  2P9X A;  2PEM A;  1M74 A;  1NJI Q;  4M0I A;  1K30 A;  1EOQ A;  3CCM P;  1BAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...