3GZLA

Crystal structure of holo pfacp disulfide-linked dimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
b'SSLKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Plasmodium falciparum acyl carrier protein crystal structures in disulfide-linked and reduced states and their prevalence during blood stage growth.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Biosynthetic protein
total genus 25
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3gzlA00
2FVEA 2JU1A 2KW2A 2N5HA 2EHTA 2N98A 2GDWA 3EJBA 2JU2A 1HQBA 1T8KA 1L0HA 2JQ4A 4DG9A 2VSQA 2QNWA 1L0IA 2LPKA 2DNWA 4H2XC 4IZ6A 2K93A 2JGPA 4NEOA 2MF4A 2MVVA 5HV8A 2XZ1C 2X2BA 5CZDB 2L22A 1X3OA 1OR5A 2KWLA 2CQ8A 2LIUA 5EJDA 2LIWA 4MRTC 4BPHA 2K94A 2FQ0A 1AF8A 2GDXA 4H2WC 2FAEA 1ACPA 2FQ2A 2MD9A 2K92A 4H2YC 2FQ1A 1KLPA 2CNRA 2KR5A 2FADA 2KOPA 2L4BA 3EJEA 1VKUA 2EHSA 2FVAA 2LMLA 2KG8A 2MY5A 3GZLA 2K0XA 5KP6B 2KGDA 2LKIA 3GZMA 2FHSC 4HKGA 2AFEA 4BPFA 3CE7A 2AFDA 3LMOA 4R0MA 2LOLA 2L0QA 2CG5B 5HVCA 2ROQA 2MVUA 1F80D 1NQ4A 2N50A 4PWVB 2KOQA 2MR8A 2N6ZA 5KP7B 2KOSA 2GDYA 2KG6A 2AVAA 2M5RA 2KOOA 2AF8A 1DNYA 1HY8A 2CGQA 2K2QA 2KGAA 2FVFA 4PXHB 1DV5A 2N5IA 2N6YA 5KP8B 2K0YA 2MR7A 2L9FA 2KG9A 3EJDA 4CA3A 2KGCA 2LL8A 3NY7B 2KGEA 2KORA 2PNGA 2FACA 4BPGA 3RG2A 2LTEA 2XZ0D
chains in the Genus database with same CATH superfamily
2EG5A 1RNIA 2FVEA 1N8RQ 2JU1A 3CC2P 2GZEA 2N5HA 3GJNA 2EHTA 1VQLP 1HQBA 1YI2P 5F2OA 1L0IA 5F2KA 2DNWA 1UJZA 2GYKA 1RO2A 3G1GA 2MF4A 1VQNP 2X2BA 2QEXP 1X3OA 3G4SP 1YHQP 2KWLA 1RO0A 3WBHA 1K73Q 2LIWA 1AUMA 1K8AQ 2K92A 1VQMP 4H2YC 2FQ1A 1KLPA 2JB0A 2KOPA 4IPYA 3CCVP 1KC8Q 2KG8A 5BS2A 3HZQA 2MY5A 1E6JP 2KGDA 2LKIA 1M1KQ 3CPWO 3LMOA 4M0IA 1VQ4P 3B4QA 2LOLA 1VQKP 2EIAA 5F2NA 1F80D 3H47A 2N6ZA 2Z46A 3CXCO 2AF8A 5BS1A 2JYLA 2CGQA 1VQ8P 2K2QA 2M8PA 1IUQA 2K0YA 2MR7A 4PH0A 1Q86Q 3G21A 2DGYA 4QNBA 2CWOA 4CA3A 2KGCA 1QVFO 1K9MQ 1QVGO 1VHNA 2GZIA 2N98A 1KD1Q 3EJBA 4F37A 3OW2O 3H0DA 2LPKA 2VLOA 4H2XC 3GKLC 5HGMA 2XT1A 5HV8A 2XZ1C 3DS0A 2OARA 3Q20A 3VRLC 5EJDA 4BPHA 3E2DA 1CEIA 4XFYA 5I4TG 2MD9A 4U0AA 1NJIQ 2GZFA 2PEJA 2WPTA 3DS4A 2FADA 1VQPP 2EHSA 2FVAA 3LRYA 2PENA 2OTLP 1JJ2O 5HGNA 3GZLA 2PY8A 2GZJA 3DTJA 4BPFA 4U0DA 2JAZA 5HGOA 4R0MA 3CCQP 3CCEP 2PEIA 2QA4P 1IMQA 2L6EA 2ROQA 1Q82Q 2N50A 2KOQA 5KP7B 2KOSA 2KG6A 2M5RA 2OTJP 4PXHB 2N5IA 5DCKA 1D1DA 3G28A 2KG9A 1GXHA 4U0BA 3NY7B 2KORA 4BPGA 2KODA 1VQ5P 1IMPA 1EOQA 2VLQA 4U0CA 1Z6MA 2JU2A 1L0HA 2JQ4A 4DG9A 2VSQA 1S72P 4COPA 2JBGA 3H4EA 4IZ6A 2K93A 2LF4A 4NEOA 2MVVA 3NTEA 5CZDB 2L22A 4GR6A 1EIAA 1W2BO 1GXGA 1YIJP 1ZMBA 5EW5E 4MRTC 3HYBA 3RG6C 1AF8A 4XRQA 3G1IA 1VQOP 3CCMP 2KR5A 3DS3A 1M90Q 1A43A 2PEQA 1UNKA 2NO8A 1Q7YQ 2L4BA 3CCRP 2ONTA 2ERHA 2LMLA 3MGEA 5KP6B 4U0FA 3GZMA 4GR2A 3U43A 2PEOA 2K5XA 2PEMA 2P9XA 2CG5B 5HVCA 1NQ4A 3G0VA 1YJWP 2GZGA 1Q81Q 4PWVB 3CC7P 2MR8A 1AYIA 3CCUP 1EMVA 2GDYA 2KOOA 7CEIA 1A8OA 1DNYA 2BUOA 3G29A 1YJNP 2FVFA 5HGLA 3CMEP 2N6YA 2L9FA 3EJDA 3CC4P 3CCSP 2LL8A 2PNGA 3P05A 3RG2A 1E0HA 2EFJA 2VLNA 3G71P 2PEKA 2XXMA 5JPAA 2KW2A 3CCLP 1KQSO 2GDWA 1VQ6P 3DS2A 1T8KA 3DS5A 2QNWA 1BXIA 2XV6A 2VLPA 2JGPA 2JYGA 4XROA 1OR5A 1QRJA 2CQ8A 2LIUA 2M8NA 1BAJA 2K94A 2FQ0A 3I56P 2GDXA 4H2WC 2BHVA 2FAEA 1ACPA 2FQ2A 3DPHA 3M1MA 2CNRA 3B5IA 3G6EP 4XFXA 3EJEA 4UHPB 1M6EX 1VKUA 2Z45A 3DS1A 1FR2A 3CCJP 2K0XA 2FHSC 4HKGA 2AFEA 1VQ9P 3G26A 3CE7A 2AFDA 2M8LA 2L0QA 2K0DX 4XFZA 2MVUA 1M74A 1MZ8A 2JO0A 3CD6P 2Z44A 2AVAA 4U0EA 4COCA 1ZNVA 4PH1A 4WYMA 1HY8A 1YITP 2KGAA 3I55P 1GPJA 1VQ7P 1DV5A 1M6NA 5KP8B 4QKOA 1K30A 1YJ9P 3CMAP 2KGEA 2FACA 2LTEA 2E1MA 2XZ0D
chains in the Genus database with same CATH topology
2FVEA 2JU1A 2KW2A 2N5HA 2EHTA 2N98A 2GDWA 3EJBA 2JU2A 1HQBA 1T8KA 1L0HA 2JQ4A 4DG9A 2VSQA 2QNWA 1L0IA 2LPKA 2DNWA 4H2XC 4IZ6A 2K93A 2JGPA 4NEOA 2MF4A 2MVVA 5HV8A 2XZ1C 2X2BA 5CZDB 2L22A 1X3OA 1OR5A 2KWLA 2CQ8A 2LIUA 5EJDA 2LIWA 4MRTC 4BPHA 2K94A 2FQ0A 1AF8A 2GDXA 4H2WC 2FAEA 1ACPA 2FQ2A 2MD9A 2K92A 4H2YC 2FQ1A 1KLPA 2CNRA 2KR5A 2FADA 2KOPA 2L4BA 3EJEA 1VKUA 2EHSA 2FVAA 2LMLA 2KG8A 2MY5A 3GZLA 2K0XA 5KP6B 2KGDA 2LKIA 3GZMA 2FHSC 4HKGA 2AFEA 4BPFA 3CE7A 2AFDA 3LMOA 4R0MA 2LOLA 2L0QA 2CG5B 5HVCA 2ROQA 2MVUA 1F80D 1NQ4A 2N50A 4PWVB 2KOQA 2MR8A 2N6ZA 5KP7B 2KOSA 2GDYA 2KG6A 2AVAA 2M5RA 2KOOA 2AF8A 1DNYA 1HY8A 2CGQA 2K2QA 2KGAA 2FVFA 4PXHB 1DV5A 2N5IA 2N6YA 5KP8B 2K0YA 2MR7A 2L9FA 2KG9A 3EJDA 4CA3A 2KGCA 2LL8A 3NY7B 2KGEA 2KORA 2PNGA 2FACA 4BPGA 3RG2A 2LTEA 2XZ0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FVE A;  2JU1 A;  2KW2 A;  2N5H A;  2EHT A;  2N98 A;  2GDW A;  3EJB A;  2JU2 A;  1HQB A;  1T8K A;  1L0H A;  2JQ4 A;  4DG9 A;  2VSQ A;  2QNW A;  1L0I A;  2LPK A;  2DNW A;  4H2X C;  4IZ6 A;  2K93 A;  2JGP A;  4NEO A;  2MF4 A;  2MVV A;  5HV8 A;  2XZ1 C;  2X2B A;  5CZD B;  2L22 A;  1X3O A;  1OR5 A;  2KWL A;  2CQ8 A;  2LIU A;  5EJD A;  2LIW A;  4MRT C;  4BPH A;  2K94 A;  2FQ0 A;  1AF8 A;  2GDX A;  4H2W C;  2FAE A;  1ACP A;  2FQ2 A;  2MD9 A;  2K92 A;  4H2Y C;  2FQ1 A;  1KLP A;  2CNR A;  2KR5 A;  2FAD A;  2KOP A;  2L4B A;  3EJE A;  1VKU A;  2EHS A;  2FVA A;  2LML A;  2KG8 A;  2MY5 A;  3GZL A;  2K0X A;  5KP6 B;  2KGD A;  2LKI A;  3GZM A;  2FHS C;  4HKG A;  2AFE A;  4BPF A;  3CE7 A;  2AFD A;  3LMO A;  4R0M A;  2LOL A;  2L0Q A;  2CG5 B;  5HVC A;  2ROQ A;  2MVU A;  1F80 D;  1NQ4 A;  2N50 A;  4PWV B;  2KOQ A;  2MR8 A;  2N6Z A;  5KP7 B;  2KOS A;  2GDY A;  2KG6 A;  2AVA A;  2M5R A;  2KOO A;  2AF8 A;  1DNY A;  1HY8 A;  2CGQ A;  2K2Q A;  2KGA A;  2FVF A;  4PXH B;  1DV5 A;  2N5I A;  2N6Y A;  5KP8 B;  2K0Y A;  2MR7 A;  2L9F A;  2KG9 A;  3EJD A;  4CA3 A;  2KGC A;  2LL8 A;  3NY7 B;  2KGE A;  2KOR A;  2PNG A;  2FAC A;  4BPG A;  3RG2 A;  2LTE A;  2XZ0 D; 
#chains in the Genus database with same CATH topology
 2EG5 A;  1RNI A;  2FVE A;  1N8R Q;  2JU1 A;  3CC2 P;  2GZE A;  2N5H A;  3GJN A;  2EHT A;  1VQL P;  1HQB A;  1YI2 P;  5F2O A;  1L0I A;  5F2K A;  2DNW A;  1UJZ A;  2GYK A;  1RO2 A;  3G1G A;  2MF4 A;  1VQN P;  2X2B A;  2QEX P;  1X3O A;  3G4S P;  1YHQ P;  2KWL A;  1RO0 A;  3WBH A;  1K73 Q;  2LIW A;  1AUM A;  1K8A Q;  2K92 A;  1VQM P;  4H2Y C;  2FQ1 A;  1KLP A;  2JB0 A;  2KOP A;  4IPY A;  3CCV P;  1KC8 Q;  2KG8 A;  5BS2 A;  3HZQ A;  2MY5 A;  1E6J P;  2KGD A;  2LKI A;  1M1K Q;  3CPW O;  3LMO A;  4M0I A;  1VQ4 P;  3B4Q A;  2LOL A;  1VQK P;  2EIA A;  5F2N A;  1F80 D;  3H47 A;  2N6Z A;  2Z46 A;  3CXC O;  2AF8 A;  5BS1 A;  2JYL A;  2CGQ A;  1VQ8 P;  2K2Q A;  2M8P A;  1IUQ A;  2K0Y A;  2MR7 A;  4PH0 A;  1Q86 Q;  3G21 A;  2DGY A;  4QNB A;  2CWO A;  4CA3 A;  2KGC A;  1QVF O;  1K9M Q;  1QVG O;  1VHN A;  2GZI A;  2N98 A;  1KD1 Q;  3EJB A;  4F37 A;  3OW2 O;  3H0D A;  2LPK A;  2VLO A;  4H2X C;  3GKL C;  5HGM A;  2XT1 A;  5HV8 A;  2XZ1 C;  3DS0 A;  2OAR A;  3Q20 A;  3VRL C;  5EJD A;  4BPH A;  3E2D A;  1CEI A;  4XFY A;  5I4T G;  2MD9 A;  4U0A A;  1NJI Q;  2GZF A;  2PEJ A;  2WPT A;  3DS4 A;  2FAD A;  1VQP P;  2EHS A;  2FVA A;  3LRY A;  2PEN A;  2OTL P;  1JJ2 O;  5HGN A;  3GZL A;  2PY8 A;  2GZJ A;  3DTJ A;  4BPF A;  4U0D A;  2JAZ A;  5HGO A;  4R0M A;  3CCQ P;  3CCE P;  2PEI A;  2QA4 P;  1IMQ A;  2L6E A;  2ROQ A;  1Q82 Q;  2N50 A;  2KOQ A;  5KP7 B;  2KOS A;  2KG6 A;  2M5R A;  2OTJ P;  4PXH B;  2N5I A;  5DCK A;  1D1D A;  3G28 A;  2KG9 A;  1GXH A;  4U0B A;  3NY7 B;  2KOR A;  4BPG A;  2KOD A;  1VQ5 P;  1IMP A;  1EOQ A;  2VLQ A;  4U0C A;  1Z6M A;  2JU2 A;  1L0H A;  2JQ4 A;  4DG9 A;  2VSQ A;  1S72 P;  4COP A;  2JBG A;  3H4E A;  4IZ6 A;  2K93 A;  2LF4 A;  4NEO A;  2MVV A;  3NTE A;  5CZD B;  2L22 A;  4GR6 A;  1EIA A;  1W2B O;  1GXG A;  1YIJ P;  1ZMB A;  5EW5 E;  4MRT C;  3HYB A;  3RG6 C;  1AF8 A;  4XRQ A;  3G1I A;  1VQO P;  3CCM P;  2KR5 A;  3DS3 A;  1M90 Q;  1A43 A;  2PEQ A;  1UNK A;  2NO8 A;  1Q7Y Q;  2L4B A;  3CCR P;  2ONT A;  2ERH A;  2LML A;  3MGE A;  5KP6 B;  4U0F A;  3GZM A;  4GR2 A;  3U43 A;  2PEO A;  2K5X A;  2PEM A;  2P9X A;  2CG5 B;  5HVC A;  1NQ4 A;  3G0V A;  1YJW P;  2GZG A;  1Q81 Q;  4PWV B;  3CC7 P;  2MR8 A;  1AYI A;  3CCU P;  1EMV A;  2GDY A;  2KOO A;  7CEI A;  1A8O A;  1DNY A;  2BUO A;  3G29 A;  1YJN P;  2FVF A;  5HGL A;  3CME P;  2N6Y A;  2L9F A;  3EJD A;  3CC4 P;  3CCS P;  2LL8 A;  2PNG A;  3P05 A;  3RG2 A;  1E0H A;  2EFJ A;  2VLN A;  3G71 P;  2PEK A;  2XXM A;  5JPA A;  2KW2 A;  3CCL P;  1KQS O;  2GDW A;  1VQ6 P;  3DS2 A;  1T8K A;  3DS5 A;  2QNW A;  1BXI A;  2XV6 A;  2VLP A;  2JGP A;  2JYG A;  4XRO A;  1OR5 A;  1QRJ A;  2CQ8 A;  2LIU A;  2M8N A;  1BAJ A;  2K94 A;  2FQ0 A;  3I56 P;  2GDX A;  4H2W C;  2BHV A;  2FAE A;  1ACP A;  2FQ2 A;  3DPH A;  3M1M A;  2CNR A;  3B5I A;  3G6E P;  4XFX A;  3EJE A;  4UHP B;  1M6E X;  1VKU A;  2Z45 A;  3DS1 A;  1FR2 A;  3CCJ P;  2K0X A;  2FHS C;  4HKG A;  2AFE A;  1VQ9 P;  3G26 A;  3CE7 A;  2AFD A;  2M8L A;  2L0Q A;  2K0D X;  4XFZ A;  2MVU A;  1M74 A;  1MZ8 A;  2JO0 A;  3CD6 P;  2Z44 A;  2AVA A;  4U0E A;  4COC A;  1ZNV A;  4PH1 A;  4WYM A;  1HY8 A;  1YIT P;  2KGA A;  3I55 P;  1GPJ A;  1VQ7 P;  1DV5 A;  1M6N A;  5KP8 B;  4QKO A;  1K30 A;  1YJ9 P;  3CMA P;  2KGE A;  2FAC A;  2LTE A;  2E1M A;  2XZ0 D; 
#chains in the Genus database with same CATH homology
 2FVE A;  2JU1 A;  2KW2 A;  2N5H A;  2EHT A;  2N98 A;  2GDW A;  3EJB A;  2JU2 A;  1HQB A;  1T8K A;  1L0H A;  2JQ4 A;  4DG9 A;  2VSQ A;  2QNW A;  1L0I A;  2LPK A;  2DNW A;  4H2X C;  4IZ6 A;  2K93 A;  2JGP A;  4NEO A;  2MF4 A;  2MVV A;  5HV8 A;  2XZ1 C;  2X2B A;  5CZD B;  2L22 A;  1X3O A;  1OR5 A;  2KWL A;  2CQ8 A;  2LIU A;  5EJD A;  2LIW A;  4MRT C;  4BPH A;  2K94 A;  2FQ0 A;  1AF8 A;  2GDX A;  4H2W C;  2FAE A;  1ACP A;  2FQ2 A;  2MD9 A;  2K92 A;  4H2Y C;  2FQ1 A;  1KLP A;  2CNR A;  2KR5 A;  2FAD A;  2KOP A;  2L4B A;  3EJE A;  1VKU A;  2EHS A;  2FVA A;  2LML A;  2KG8 A;  2MY5 A;  3GZL A;  2K0X A;  5KP6 B;  2KGD A;  2LKI A;  3GZM A;  2FHS C;  4HKG A;  2AFE A;  4BPF A;  3CE7 A;  2AFD A;  3LMO A;  4R0M A;  2LOL A;  2L0Q A;  2CG5 B;  5HVC A;  2ROQ A;  2MVU A;  1F80 D;  1NQ4 A;  2N50 A;  4PWV B;  2KOQ A;  2MR8 A;  2N6Z A;  5KP7 B;  2KOS A;  2GDY A;  2KG6 A;  2AVA A;  2M5R A;  2KOO A;  2AF8 A;  1DNY A;  1HY8 A;  2CGQ A;  2K2Q A;  2KGA A;  2FVF A;  4PXH B;  1DV5 A;  2N5I A;  2N6Y A;  5KP8 B;  2K0Y A;  2MR7 A;  2L9F A;  2KG9 A;  3EJD A;  4CA3 A;  2KGC A;  2LL8 A;  3NY7 B;  2KGE A;  2KOR A;  2PNG A;  2FAC A;  4BPG A;  3RG2 A;  2LTE A;  2XZ0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...