3GZLA

Crystal structure of holo pfacp disulfide-linked dimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
SSLKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Plasmodium falciparum acyl carrier protein crystal structures in disulfide-linked and reduced states and their prevalence during blood stage growth.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Biosynthetic protein
total genus 25
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3gzlA00
2KW2A 4IZ6A 2FAEA 4H2WC 2XZ0D 2N50A 4H2YC 2FVEA 2N5HA 2L22A 2KGCA 2ROQA 1DV5A 5HVCA 2L9FA 4CA3A 2DNWA 5CZDB 1T8KA 2LIUA 2EHSA 2K0YA 1VKUA 2PNGA 2AFEA 2LKIA 3RG2A 2LIWA 2N5IA 2MVVA 2KGDA 1NQ4A 2KWLA 2LOLA 2MF4A 2MR8A 5KP7B 2FHSC 1L0IA 5KP8B 2MR7A 2KOSA 3EJEA 2N6YA 2L4BA 2LTEA 2FVFA 2JU1A 4H2XC 1L0HA 4BPFA 3EJDA 4PXHB 2XZ1C 4DG9A 2JGPA 2GDYA 2KOPA 2KORA 2GDXA 1X3OA 2FQ2A 3NY7B 2LPKA 2FQ1A 1ACPA 2JU2A 2KR5A 3GZLA 2FVAA 2KGAA 2N98A 3CE7A 2FADA 2KOQA 2K2QA 2VSQA 4HKGA 2AVAA 2GDWA 3GZMA 2KOOA 2MD9A 3LMOA 4MRTC 2CG5B 2K94A 5HV8A 2KG8A 2JQ4A 2QNWA 2FACA 2EHTA 2CGQA 2KG6A 2M5RA 2AFDA 4BPHA 2MVUA 2K92A 2L0QA 2LMLA 2KGEA 1DNYA 1HY8A 2KG9A 2FQ0A 3EJBA 4R0MA 2N6ZA 1AF8A 1HQBA 4NEOA 2MY5A 1KLPA 2AF8A 2X2BA 5KP6B 5EJDA 4PWVB 2CQ8A 2LL8A 1F80D 2K0XA 2CNRA 4BPGA 2K93A 1OR5A
chains in the Genus database with same CATH superfamily
3CXCO 1VQ7P 4IZ6A 4H2WC 2N50A 3Q20A 2N5HA 5HGMA 2KGCA 1M6NA 1Q86Q 3CCEP 4CA3A 2JAZA 5CZDB 2LIUA 1E6JP 2K0YA 1VKUA 2LKIA 1YIJP 3G0VA 4QKOA 1FR2A 2M8PA 3MGEA 1NQ4A 2LOLA 2P9XA 1GXHA 1D1DA 2PEIA 3EJEA 2FVFA 1YJNP 2KODA 1L0HA 2PEQA 2GDYA 4XROA 3HYBA 2PEKA 5I4TG 5DCKA 4IPYA 2BUOA 3LRYA 3GZLA 3CMEP 3CE7A 3DTJA 1UNKA 2M8NA 2KOOA 2K94A 2JQ4A 2K0DX 1RO2A 2CGQA 2KG6A 1IMPA 1VQLP 2VLPA 2OTJP 1HY8A 2KG9A 3U43A 4U0FA 2N6ZA 4XFYA 1BAJA 1K30A 4WYMA 1EMVA 1RO0A 3DS5A 2DGYA 3P05A 2FAEA 3CD6P 3DS3A 2XZ0D 4U0CA 4PH1A 2L22A 2ROQA 3H0DA 2K5XA 1T8KA 2EHSA 1VQ4P 2BHVA 1YITP 1AYIA 1K73Q 2LIWA 3CCQP 1M1KQ 3CMAP 3B4QA 3DS1A 2N5IA 2MF4A 2MR8A 1GXGA 7CEIA 3CC2P 2FHSC 2JBGA 1ZNVA 3G1IA 2N6YA 3CCVP 2LTEA 3CCJP 1GPJA 4BPFA 5F2NA 3CCLP 2JGPA 2GYKA 2ONTA 4U0EA 1Q81Q 3NY7B 2KR5A 2FADA 3G1GA 2KOQA 1S72P 1VQ9P 2K2QA 4HKGA 2AVAA 2GDWA 2MD9A 1VQ6P 1IUQA 2CG5B 5HV8A 2KG8A 2Z45A 1VHNA 4U0DA 3VRLC 2EHTA 1A8OA 2PEOA 3DS2A 2GZGA 3G21A 2AFDA 2EG5A 3G26A 2LMLA 4COPA 3G6EP 1Q7YQ 3WBHA 4R0MA 2M8LA 1HQBA 5F2KA 2OTLP 2VLOA 4COCA 1VQNP 2MY5A 2PEMA 2L6EA 2GZEA 2X2BA 5EJDA 2CQ8A 1F80D 1CEIA 2K0XA 4GR2A 4U0AA 3G4SP 3GKLC 5F2OA 1MZ8A 4GR6A 2KW2A 4H2YC 2QA4P 1JJ2O 2L9FA 1IMQA 4QNBA 2DNWA 2Z44A 2PY8A 3M1MA 4M0IA 2GZFA 3RG2A 1YI2P 5KP7B 2MVVA 2KGDA 1AUMA 1QVGO 1L0IA 5KP8B 3CPWO 2PEJA 3CCMP 3CCSP 3HZQA 1YJWP 2ERHA 3G29A 4DG9A 2LF4A 2KOPA 2GDXA 2FQ2A 1A43A 2FQ1A 2JU2A 3CCRP 1VQ5P 2FVAA 2N98A 1RNIA 2Z46A 2JYLA 3GZMA 1M90Q 3CC4P 2QNWA 2FACA 1VQOP 2OARA 1EIAA 1QVFO 2K92A 2L0QA 2QEXP 1DNYA 3CCUP 3H47A 1K9MQ 2FQ0A 2GZJA 1VQPP 3EJBA 2EIAA 2E1MA 1AF8A 1VQKP 5HGNA 1VQ8P 5BS1A 2XXMA 1K8AQ 4PWVB 2LL8A 4UHPB 2CNRA 4BPGA 2K93A 1OR5A 3RG6C 3NTEA 2CWOA 1YJ9P 3GJNA 3DS0A 4XFXA 1KQSO 2FVEA 3I56P 2VLQA 1DV5A 5HVCA 2JO0A 4F37A 3H4EA 1NJIQ 2EFJA 2PNGA 2AFEA 1BXIA 1N8RQ 2KWLA 1E0HA 2VLNA 3G28A 3G71P 2MR7A 2KOSA 3E2DA 2L4BA 1EOQA 5JPAA 1YHQP 3DPHA 1Q82Q 2JU1A 1M6EX 4H2XC 1VQMP 3DS4A 3EJDA 4PXHB 2XZ1C 4PH0A 3I55P 2KORA 2XV6A 1X3OA 4XFZA 2PENA 2JB0A 2LPKA 2GZIA 1ACPA 5BS2A 2KGAA 1QRJA 4U0BA 1KC8Q 2VSQA 4MRTC 3LMOA 5HGLA 1Z6MA 1M74A 2M5RA 4BPHA 2MVUA 2XT1A 1KD1Q 2KGEA 2WPTA 4XRQA 3CC7P 3OW2O 4NEOA 1ZMBA 5EW5E 1KLPA 3B5IA 2AF8A 5HGOA 2JYGA 5KP6B 2NO8A 1UJZA 1W2BO
chains in the Genus database with same CATH topology
2KW2A 4IZ6A 2FAEA 4H2WC 2XZ0D 2N50A 4H2YC 2FVEA 2N5HA 2L22A 2KGCA 2ROQA 1DV5A 5HVCA 2L9FA 4CA3A 2DNWA 5CZDB 1T8KA 2LIUA 2EHSA 2K0YA 1VKUA 2PNGA 2AFEA 2LKIA 3RG2A 2LIWA 2N5IA 2MVVA 2KGDA 1NQ4A 2KWLA 2LOLA 2MF4A 2MR8A 5KP7B 2FHSC 1L0IA 5KP8B 2MR7A 2KOSA 3EJEA 2N6YA 2L4BA 2LTEA 2FVFA 2JU1A 4H2XC 1L0HA 4BPFA 3EJDA 4PXHB 2XZ1C 4DG9A 2JGPA 2GDYA 2KOPA 2KORA 2GDXA 1X3OA 2FQ2A 3NY7B 2LPKA 2FQ1A 1ACPA 2JU2A 2KR5A 3GZLA 2FVAA 2KGAA 2N98A 3CE7A 2FADA 2KOQA 2K2QA 2VSQA 4HKGA 2AVAA 2GDWA 3GZMA 2KOOA 2MD9A 3LMOA 4MRTC 2CG5B 2K94A 5HV8A 2KG8A 2JQ4A 2QNWA 2FACA 2EHTA 2CGQA 2KG6A 2M5RA 2AFDA 4BPHA 2MVUA 2K92A 2L0QA 2LMLA 2KGEA 1DNYA 1HY8A 2KG9A 2FQ0A 3EJBA 4R0MA 2N6ZA 1AF8A 1HQBA 4NEOA 2MY5A 1KLPA 2AF8A 2X2BA 5KP6B 5EJDA 4PWVB 2CQ8A 2LL8A 1F80D 2K0XA 2CNRA 4BPGA 2K93A 1OR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW2 A;  4IZ6 A;  2FAE A;  4H2W C;  2XZ0 D;  2N50 A;  4H2Y C;  2FVE A;  2N5H A;  2L22 A;  2KGC A;  2ROQ A;  1DV5 A;  5HVC A;  2L9F A;  4CA3 A;  2DNW A;  5CZD B;  1T8K A;  2LIU A;  2EHS A;  2K0Y A;  1VKU A;  2PNG A;  2AFE A;  2LKI A;  3RG2 A;  2LIW A;  2N5I A;  2MVV A;  2KGD A;  1NQ4 A;  2KWL A;  2LOL A;  2MF4 A;  2MR8 A;  5KP7 B;  2FHS C;  1L0I A;  5KP8 B;  2MR7 A;  2KOS A;  3EJE A;  2N6Y A;  2L4B A;  2LTE A;  2FVF A;  2JU1 A;  4H2X C;  1L0H A;  4BPF A;  3EJD A;  4PXH B;  2XZ1 C;  4DG9 A;  2JGP A;  2GDY A;  2KOP A;  2KOR A;  2GDX A;  1X3O A;  2FQ2 A;  3NY7 B;  2LPK A;  2FQ1 A;  1ACP A;  2JU2 A;  2KR5 A;  3GZL A;  2FVA A;  2KGA A;  2N98 A;  3CE7 A;  2FAD A;  2KOQ A;  2K2Q A;  2VSQ A;  4HKG A;  2AVA A;  2GDW A;  3GZM A;  2KOO A;  2MD9 A;  3LMO A;  4MRT C;  2CG5 B;  2K94 A;  5HV8 A;  2KG8 A;  2JQ4 A;  2QNW A;  2FAC A;  2EHT A;  2CGQ A;  2KG6 A;  2M5R A;  2AFD A;  4BPH A;  2MVU A;  2K92 A;  2L0Q A;  2LML A;  2KGE A;  1DNY A;  1HY8 A;  2KG9 A;  2FQ0 A;  3EJB A;  4R0M A;  2N6Z A;  1AF8 A;  1HQB A;  4NEO A;  2MY5 A;  1KLP A;  2AF8 A;  2X2B A;  5KP6 B;  5EJD A;  4PWV B;  2CQ8 A;  2LL8 A;  1F80 D;  2K0X A;  2CNR A;  4BPG A;  2K93 A;  1OR5 A; 
#chains in the Genus database with same CATH topology
 3CXC O;  1VQ7 P;  4IZ6 A;  4H2W C;  2N50 A;  3Q20 A;  2N5H A;  5HGM A;  2KGC A;  1M6N A;  1Q86 Q;  3CCE P;  4CA3 A;  2JAZ A;  5CZD B;  2LIU A;  1E6J P;  2K0Y A;  1VKU A;  2LKI A;  1YIJ P;  3G0V A;  4QKO A;  1FR2 A;  2M8P A;  3MGE A;  1NQ4 A;  2LOL A;  2P9X A;  1GXH A;  1D1D A;  2PEI A;  3EJE A;  2FVF A;  1YJN P;  2KOD A;  1L0H A;  2PEQ A;  2GDY A;  4XRO A;  3HYB A;  2PEK A;  5I4T G;  5DCK A;  4IPY A;  2BUO A;  3LRY A;  3GZL A;  3CME P;  3CE7 A;  3DTJ A;  1UNK A;  2M8N A;  2KOO A;  2K94 A;  2JQ4 A;  2K0D X;  1RO2 A;  2CGQ A;  2KG6 A;  1IMP A;  1VQL P;  2VLP A;  2OTJ P;  1HY8 A;  2KG9 A;  3U43 A;  4U0F A;  2N6Z A;  4XFY A;  1BAJ A;  1K30 A;  4WYM A;  1EMV A;  1RO0 A;  3DS5 A;  2DGY A;  3P05 A;  2FAE A;  3CD6 P;  3DS3 A;  2XZ0 D;  4U0C A;  4PH1 A;  2L22 A;  2ROQ A;  3H0D A;  2K5X A;  1T8K A;  2EHS A;  1VQ4 P;  2BHV A;  1YIT P;  1AYI A;  1K73 Q;  2LIW A;  3CCQ P;  1M1K Q;  3CMA P;  3B4Q A;  3DS1 A;  2N5I A;  2MF4 A;  2MR8 A;  1GXG A;  7CEI A;  3CC2 P;  2FHS C;  2JBG A;  1ZNV A;  3G1I A;  2N6Y A;  3CCV P;  2LTE A;  3CCJ P;  1GPJ A;  4BPF A;  5F2N A;  3CCL P;  2JGP A;  2GYK A;  2ONT A;  4U0E A;  1Q81 Q;  3NY7 B;  2KR5 A;  2FAD A;  3G1G A;  2KOQ A;  1S72 P;  1VQ9 P;  2K2Q A;  4HKG A;  2AVA A;  2GDW A;  2MD9 A;  1VQ6 P;  1IUQ A;  2CG5 B;  5HV8 A;  2KG8 A;  2Z45 A;  1VHN A;  4U0D A;  3VRL C;  2EHT A;  1A8O A;  2PEO A;  3DS2 A;  2GZG A;  3G21 A;  2AFD A;  2EG5 A;  3G26 A;  2LML A;  4COP A;  3G6E P;  1Q7Y Q;  3WBH A;  4R0M A;  2M8L A;  1HQB A;  5F2K A;  2OTL P;  2VLO A;  4COC A;  1VQN P;  2MY5 A;  2PEM A;  2L6E A;  2GZE A;  2X2B A;  5EJD A;  2CQ8 A;  1F80 D;  1CEI A;  2K0X A;  4GR2 A;  4U0A A;  3G4S P;  3GKL C;  5F2O A;  1MZ8 A;  4GR6 A;  2KW2 A;  4H2Y C;  2QA4 P;  1JJ2 O;  2L9F A;  1IMQ A;  4QNB A;  2DNW A;  2Z44 A;  2PY8 A;  3M1M A;  4M0I A;  2GZF A;  3RG2 A;  1YI2 P;  5KP7 B;  2MVV A;  2KGD A;  1AUM A;  1QVG O;  1L0I A;  5KP8 B;  3CPW O;  2PEJ A;  3CCM P;  3CCS P;  3HZQ A;  1YJW P;  2ERH A;  3G29 A;  4DG9 A;  2LF4 A;  2KOP A;  2GDX A;  2FQ2 A;  1A43 A;  2FQ1 A;  2JU2 A;  3CCR P;  1VQ5 P;  2FVA A;  2N98 A;  1RNI A;  2Z46 A;  2JYL A;  3GZM A;  1M90 Q;  3CC4 P;  2QNW A;  2FAC A;  1VQO P;  2OAR A;  1EIA A;  1QVF O;  2K92 A;  2L0Q A;  2QEX P;  1DNY A;  3CCU P;  3H47 A;  1K9M Q;  2FQ0 A;  2GZJ A;  1VQP P;  3EJB A;  2EIA A;  2E1M A;  1AF8 A;  1VQK P;  5HGN A;  1VQ8 P;  5BS1 A;  2XXM A;  1K8A Q;  4PWV B;  2LL8 A;  4UHP B;  2CNR A;  4BPG A;  2K93 A;  1OR5 A;  3RG6 C;  3NTE A;  2CWO A;  1YJ9 P;  3GJN A;  3DS0 A;  4XFX A;  1KQS O;  2FVE A;  3I56 P;  2VLQ A;  1DV5 A;  5HVC A;  2JO0 A;  4F37 A;  3H4E A;  1NJI Q;  2EFJ A;  2PNG A;  2AFE A;  1BXI A;  1N8R Q;  2KWL A;  1E0H A;  2VLN A;  3G28 A;  3G71 P;  2MR7 A;  2KOS A;  3E2D A;  2L4B A;  1EOQ A;  5JPA A;  1YHQ P;  3DPH A;  1Q82 Q;  2JU1 A;  1M6E X;  4H2X C;  1VQM P;  3DS4 A;  3EJD A;  4PXH B;  2XZ1 C;  4PH0 A;  3I55 P;  2KOR A;  2XV6 A;  1X3O A;  4XFZ A;  2PEN A;  2JB0 A;  2LPK A;  2GZI A;  1ACP A;  5BS2 A;  2KGA A;  1QRJ A;  4U0B A;  1KC8 Q;  2VSQ A;  4MRT C;  3LMO A;  5HGL A;  1Z6M A;  1M74 A;  2M5R A;  4BPH A;  2MVU A;  2XT1 A;  1KD1 Q;  2KGE A;  2WPT A;  4XRQ A;  3CC7 P;  3OW2 O;  4NEO A;  1ZMB A;  5EW5 E;  1KLP A;  3B5I A;  2AF8 A;  5HGO A;  2JYG A;  5KP6 B;  2NO8 A;  1UJZ A;  1W2B O; 
#chains in the Genus database with same CATH homology
 2KW2 A;  4IZ6 A;  2FAE A;  4H2W C;  2XZ0 D;  2N50 A;  4H2Y C;  2FVE A;  2N5H A;  2L22 A;  2KGC A;  2ROQ A;  1DV5 A;  5HVC A;  2L9F A;  4CA3 A;  2DNW A;  5CZD B;  1T8K A;  2LIU A;  2EHS A;  2K0Y A;  1VKU A;  2PNG A;  2AFE A;  2LKI A;  3RG2 A;  2LIW A;  2N5I A;  2MVV A;  2KGD A;  1NQ4 A;  2KWL A;  2LOL A;  2MF4 A;  2MR8 A;  5KP7 B;  2FHS C;  1L0I A;  5KP8 B;  2MR7 A;  2KOS A;  3EJE A;  2N6Y A;  2L4B A;  2LTE A;  2FVF A;  2JU1 A;  4H2X C;  1L0H A;  4BPF A;  3EJD A;  4PXH B;  2XZ1 C;  4DG9 A;  2JGP A;  2GDY A;  2KOP A;  2KOR A;  2GDX A;  1X3O A;  2FQ2 A;  3NY7 B;  2LPK A;  2FQ1 A;  1ACP A;  2JU2 A;  2KR5 A;  3GZL A;  2FVA A;  2KGA A;  2N98 A;  3CE7 A;  2FAD A;  2KOQ A;  2K2Q A;  2VSQ A;  4HKG A;  2AVA A;  2GDW A;  3GZM A;  2KOO A;  2MD9 A;  3LMO A;  4MRT C;  2CG5 B;  2K94 A;  5HV8 A;  2KG8 A;  2JQ4 A;  2QNW A;  2FAC A;  2EHT A;  2CGQ A;  2KG6 A;  2M5R A;  2AFD A;  4BPH A;  2MVU A;  2K92 A;  2L0Q A;  2LML A;  2KGE A;  1DNY A;  1HY8 A;  2KG9 A;  2FQ0 A;  3EJB A;  4R0M A;  2N6Z A;  1AF8 A;  1HQB A;  4NEO A;  2MY5 A;  1KLP A;  2AF8 A;  2X2B A;  5KP6 B;  5EJD A;  4PWV B;  2CQ8 A;  2LL8 A;  1F80 D;  2K0X A;  2CNR A;  4BPG A;  2K93 A;  1OR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...