3GZLA

Crystal structure of holo pfacp disulfide-linked dimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
SSLKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Plasmodium falciparum acyl carrier protein crystal structures in disulfide-linked and reduced states and their prevalence during blood stage growth.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Biosynthetic protein
total genus 25
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3gzlA00
2DNWA 3EJEA 2LL8A 2GDXA 2KOSA 1HY8A 3RG2A 2JQ4A 2AF8A 2L0QA 3GZMA 2FVEA 2MY5A 5HV8A 2MR7A 2LMLA 1VKUA 2LKIA 2N5HA 4BPFA 4IZ6A 4CA3A 2EHSA 2LPKA 1T8KA 2N50A 2JU2A 4MRTC 5KP8B 2MR8A 2FAEA 1DV5A 2MVUA 2FHSC 3NY7B 2L9FA 4PWVB 1L0IA 4H2YC 2ROQA 2K94A 1NQ4A 4PXHB 2M5RA 1AF8A 1L0HA 3GZLA 2N98A 2LIWA 4R0MA 2FACA 2CG5B 2KGDA 1X3OA 2KG8A 2CGQA 2KGAA 5CZDB 2N6YA 2CQ8A 2AFDA 1KLPA 4H2XC 2GDYA 1ACPA 2KG6A 2KW2A 2K92A 2KWLA 2KGEA 2KOPA 2K0YA 2N5IA 2KOQA 2XZ0D 1F80D 2JU1A 2KG9A 2EHTA 4NEOA 2FQ1A 2MVVA 3CE7A 3LMOA 2MF4A 3EJBA 2AVAA 2FQ2A 2L22A 2KGCA 5KP6B 2GDWA 2LOLA 2K2QA 2KORA 2MD9A 4HKGA 2FADA 4BPHA 2FVFA 2QNWA 2FVAA 5EJDA 2PNGA 2VSQA 4DG9A 2LTEA 2KR5A 1HQBA 3EJDA 2L4BA 2N6ZA 5KP7B 1OR5A 5HVCA 2KOOA 2XZ1C 2FQ0A 2CNRA 2X2BA 2K93A 4BPGA 2K0XA 4H2WC 2JGPA 2LIUA 1DNYA 2AFEA
chains in the Genus database with same CATH superfamily
7CEIA 3G1IA 3GKLC 1K30A 4U0FA 3I55P 2BHVA 2JQ4A 2JB0A 4XRQA 3GJNA 2VLQA 4U0DA 2PEOA 5HV8A 5HGMA 1VKUA 2LF4A 2Z45A 2N5HA 2JYLA 3OW2O 3DS2A 2JU2A 4UHPB 1E0HA 5KP8B 2FAEA 3NTEA 3CXCO 3NY7B 2M8LA 2L9FA 4PWVB 3CC2P 4XFXA 4H2YC 1NQ4A 1L0HA 2PY8A 2N98A 1A43A 2LIWA 4R0MA 5EW5E 1Q81Q 1M74A 1VQMP 4U0BA 1X3OA 3DPHA 1UNKA 3H4EA 1ACPA 2KW2A 3B4QA 2JO0A 2KWLA 2GZFA 2XV6A 1YJWP 1VQKP 2E1MA 3DS3A 2KG9A 2EHTA 1YJ9P 2MVVA 1MZ8A 4U0EA 1RO2A 2MF4A 1ZMBA 2AVAA 2FQ2A 3CCJP 1VQ8P 3DS5A 2XXMA 3G1GA 2PEJA 1VQ9P 2KORA 2MD9A 3G26A 2K0DX 5HGOA 5I4TG 1EOQA 2VSQA 2LTEA 3CMEP 4GR2A 1QRJA 2KOOA 2GZIA 1GPJA 5F2NA 5DCKA 2LIUA 2AFEA 3CD6P 3EJEA 2EG5A 3RG2A 3I56P 2PEIA 1VQ4P 1Z6MA 2MY5A 4M0IA 2LMLA 3G29A 2DGYA 5F2OA 4BPFA 1FR2A 2LPKA 3CCUP 1T8KA 2OTJP 2PEKA 1NJIQ 2VLPA 1L0IA 4PXHB 2M5RA 2EFJA 3DS0A 2KGDA 2JYGA 2KG8A 3CCVP 2CGQA 2CWOA 2KGAA 2N6YA 2CQ8A 2AFDA 1KLPA 1M90Q 3LRYA 3P05A 4U0AA 1M6EX 2GZEA 2K92A 3H0DA 2XZ0D 2PEQA 1M1KQ 2K5XA 2VLNA 2FQ1A 3CCEP 3CCRP 3EJBA 5F2KA 2KODA 2QA4P 4XROA 2JBGA 2LOLA 2FADA 2FVFA 1VQPP 4GR6A 5EJDA 3G21A 1VQLP 1D1DA 1K73Q 1K8AQ 2FQ0A 2CNRA 2X2BA 4BPGA 3CCSP 2K0XA 2JGPA 2DNWA 3CC7P 2LL8A 2GYKA 2KOSA 1HY8A 1VQ6P 2AF8A 2GZGA 1YI2P 3DS1A 3GZMA 3CCMP 2FVEA 1GXHA 2PENA 3DS4A 2MR7A 3M1MA 3G4SP 2JAZA 2LKIA 1CEIA 2Z46A 4CA3A 2EHSA 3CPWO 2N50A 4MRTC 2MR8A 1DV5A 2MVUA 4COCA 2OTLP 1A8OA 1AF8A 3GZLA 3CMAP 1Q86Q 1VQOP 2FACA 2CG5B 5CZDB 4WYMA 1K9MQ 3HZQA 3VRLC 2GZJA 4QNBA 5BS2A 1AYIA 1IMQA 2BUOA 1EMVA 2KGEA 2KOPA 2K0YA 1KQSO 1YJNP 2N5IA 1Q7YQ 2KOQA 4COPA 1F80D 1EIAA 2JU1A 4XFZA 4NEOA 3CE7A 1JJ2O 4PH0A 3U43A 3RG6C 1BAJA 1VQ7P 2K2QA 2ONTA 3Q20A 2PEMA 1VQ5P 2PNGA 4DG9A 2KR5A 3H47A 3G71P 2L4BA 2N6ZA 2NO8A 1VQNP 1OR5A 1AUMA 4U0CA 1W2BO 1IMPA 1IUQA 1S72P 1DNYA 1RNIA 4F37A 2Z44A 1YIJP 2GDXA 4IPYA 1Q82Q 1YHQP 3E2DA 1VHNA 2L0QA 3G0VA 4QKOA 3CCLP 1GXGA 5HGNA 1BXIA 3DTJA 4IZ6A 2P9XA 3CC4P 2XT1A 3HYBA 3WBHA 2FHSC 2EIAA 2ROQA 2K94A 1N8RQ 2OARA 2L6EA 3MGEA 1RO0A 1ZNVA 2M8NA 2QEXP 3G28A 1M6NA 4H2XC 2GDYA 2KG6A 5HGLA 1QVGO 1KC8Q 4PH1A 3LMOA 4XFYA 3CCQP 2L22A 2KGCA 2VLOA 5KP6B 2GDWA 3B5IA 1YITP 5BS1A 4HKGA 5JPAA 4BPHA 2QNWA 2FVAA 2WPTA 2ERHA 1HQBA 3EJDA 5KP7B 3G6EP 5HVCA 1KD1Q 1QVFO 2XZ1C 2M8PA 1UJZA 2K93A 4H2WC 1E6JP
chains in the Genus database with same CATH topology
2DNWA 3EJEA 2LL8A 2GDXA 2KOSA 1HY8A 3RG2A 2JQ4A 2AF8A 2L0QA 3GZMA 2FVEA 2MY5A 5HV8A 2MR7A 2LMLA 1VKUA 2LKIA 2N5HA 4BPFA 4IZ6A 4CA3A 2EHSA 2LPKA 1T8KA 2N50A 2JU2A 4MRTC 5KP8B 2MR8A 2FAEA 1DV5A 2MVUA 2FHSC 3NY7B 2L9FA 4PWVB 1L0IA 4H2YC 2ROQA 2K94A 1NQ4A 4PXHB 2M5RA 1AF8A 1L0HA 3GZLA 2N98A 2LIWA 4R0MA 2FACA 2CG5B 2KGDA 1X3OA 2KG8A 2CGQA 2KGAA 5CZDB 2N6YA 2CQ8A 2AFDA 1KLPA 4H2XC 2GDYA 1ACPA 2KG6A 2KW2A 2K92A 2KWLA 2KGEA 2KOPA 2K0YA 2N5IA 2KOQA 2XZ0D 1F80D 2JU1A 2KG9A 2EHTA 4NEOA 2FQ1A 2MVVA 3CE7A 3LMOA 2MF4A 3EJBA 2AVAA 2FQ2A 2L22A 2KGCA 5KP6B 2GDWA 2LOLA 2K2QA 2KORA 2MD9A 4HKGA 2FADA 4BPHA 2FVFA 2QNWA 2FVAA 5EJDA 2PNGA 2VSQA 4DG9A 2LTEA 2KR5A 1HQBA 3EJDA 2L4BA 2N6ZA 5KP7B 1OR5A 5HVCA 2KOOA 2XZ1C 2FQ0A 2CNRA 2X2BA 2K93A 4BPGA 2K0XA 4H2WC 2JGPA 2LIUA 1DNYA 2AFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DNW A;  3EJE A;  2LL8 A;  2GDX A;  2KOS A;  1HY8 A;  3RG2 A;  2JQ4 A;  2AF8 A;  2L0Q A;  3GZM A;  2FVE A;  2MY5 A;  5HV8 A;  2MR7 A;  2LML A;  1VKU A;  2LKI A;  2N5H A;  4BPF A;  4IZ6 A;  4CA3 A;  2EHS A;  2LPK A;  1T8K A;  2N50 A;  2JU2 A;  4MRT C;  5KP8 B;  2MR8 A;  2FAE A;  1DV5 A;  2MVU A;  2FHS C;  3NY7 B;  2L9F A;  4PWV B;  1L0I A;  4H2Y C;  2ROQ A;  2K94 A;  1NQ4 A;  4PXH B;  2M5R A;  1AF8 A;  1L0H A;  3GZL A;  2N98 A;  2LIW A;  4R0M A;  2FAC A;  2CG5 B;  2KGD A;  1X3O A;  2KG8 A;  2CGQ A;  2KGA A;  5CZD B;  2N6Y A;  2CQ8 A;  2AFD A;  1KLP A;  4H2X C;  2GDY A;  1ACP A;  2KG6 A;  2KW2 A;  2K92 A;  2KWL A;  2KGE A;  2KOP A;  2K0Y A;  2N5I A;  2KOQ A;  2XZ0 D;  1F80 D;  2JU1 A;  2KG9 A;  2EHT A;  4NEO A;  2FQ1 A;  2MVV A;  3CE7 A;  3LMO A;  2MF4 A;  3EJB A;  2AVA A;  2FQ2 A;  2L22 A;  2KGC A;  5KP6 B;  2GDW A;  2LOL A;  2K2Q A;  2KOR A;  2MD9 A;  4HKG A;  2FAD A;  4BPH A;  2FVF A;  2QNW A;  2FVA A;  5EJD A;  2PNG A;  2VSQ A;  4DG9 A;  2LTE A;  2KR5 A;  1HQB A;  3EJD A;  2L4B A;  2N6Z A;  5KP7 B;  1OR5 A;  5HVC A;  2KOO A;  2XZ1 C;  2FQ0 A;  2CNR A;  2X2B A;  2K93 A;  4BPG A;  2K0X A;  4H2W C;  2JGP A;  2LIU A;  1DNY A;  2AFE A; 
#chains in the Genus database with same CATH topology
 7CEI A;  3G1I A;  3GKL C;  1K30 A;  4U0F A;  3I55 P;  2BHV A;  2JQ4 A;  2JB0 A;  4XRQ A;  3GJN A;  2VLQ A;  4U0D A;  2PEO A;  5HV8 A;  5HGM A;  1VKU A;  2LF4 A;  2Z45 A;  2N5H A;  2JYL A;  3OW2 O;  3DS2 A;  2JU2 A;  4UHP B;  1E0H A;  5KP8 B;  2FAE A;  3NTE A;  3CXC O;  3NY7 B;  2M8L A;  2L9F A;  4PWV B;  3CC2 P;  4XFX A;  4H2Y C;  1NQ4 A;  1L0H A;  2PY8 A;  2N98 A;  1A43 A;  2LIW A;  4R0M A;  5EW5 E;  1Q81 Q;  1M74 A;  1VQM P;  4U0B A;  1X3O A;  3DPH A;  1UNK A;  3H4E A;  1ACP A;  2KW2 A;  3B4Q A;  2JO0 A;  2KWL A;  2GZF A;  2XV6 A;  1YJW P;  1VQK P;  2E1M A;  3DS3 A;  2KG9 A;  2EHT A;  1YJ9 P;  2MVV A;  1MZ8 A;  4U0E A;  1RO2 A;  2MF4 A;  1ZMB A;  2AVA A;  2FQ2 A;  3CCJ P;  1VQ8 P;  3DS5 A;  2XXM A;  3G1G A;  2PEJ A;  1VQ9 P;  2KOR A;  2MD9 A;  3G26 A;  2K0D X;  5HGO A;  5I4T G;  1EOQ A;  2VSQ A;  2LTE A;  3CME P;  4GR2 A;  1QRJ A;  2KOO A;  2GZI A;  1GPJ A;  5F2N A;  5DCK A;  2LIU A;  2AFE A;  3CD6 P;  3EJE A;  2EG5 A;  3RG2 A;  3I56 P;  2PEI A;  1VQ4 P;  1Z6M A;  2MY5 A;  4M0I A;  2LML A;  3G29 A;  2DGY A;  5F2O A;  4BPF A;  1FR2 A;  2LPK A;  3CCU P;  1T8K A;  2OTJ P;  2PEK A;  1NJI Q;  2VLP A;  1L0I A;  4PXH B;  2M5R A;  2EFJ A;  3DS0 A;  2KGD A;  2JYG A;  2KG8 A;  3CCV P;  2CGQ A;  2CWO A;  2KGA A;  2N6Y A;  2CQ8 A;  2AFD A;  1KLP A;  1M90 Q;  3LRY A;  3P05 A;  4U0A A;  1M6E X;  2GZE A;  2K92 A;  3H0D A;  2XZ0 D;  2PEQ A;  1M1K Q;  2K5X A;  2VLN A;  2FQ1 A;  3CCE P;  3CCR P;  3EJB A;  5F2K A;  2KOD A;  2QA4 P;  4XRO A;  2JBG A;  2LOL A;  2FAD A;  2FVF A;  1VQP P;  4GR6 A;  5EJD A;  3G21 A;  1VQL P;  1D1D A;  1K73 Q;  1K8A Q;  2FQ0 A;  2CNR A;  2X2B A;  4BPG A;  3CCS P;  2K0X A;  2JGP A;  2DNW A;  3CC7 P;  2LL8 A;  2GYK A;  2KOS A;  1HY8 A;  1VQ6 P;  2AF8 A;  2GZG A;  1YI2 P;  3DS1 A;  3GZM A;  3CCM P;  2FVE A;  1GXH A;  2PEN A;  3DS4 A;  2MR7 A;  3M1M A;  3G4S P;  2JAZ A;  2LKI A;  1CEI A;  2Z46 A;  4CA3 A;  2EHS A;  3CPW O;  2N50 A;  4MRT C;  2MR8 A;  1DV5 A;  2MVU A;  4COC A;  2OTL P;  1A8O A;  1AF8 A;  3GZL A;  3CMA P;  1Q86 Q;  1VQO P;  2FAC A;  2CG5 B;  5CZD B;  4WYM A;  1K9M Q;  3HZQ A;  3VRL C;  2GZJ A;  4QNB A;  5BS2 A;  1AYI A;  1IMQ A;  2BUO A;  1EMV A;  2KGE A;  2KOP A;  2K0Y A;  1KQS O;  1YJN P;  2N5I A;  1Q7Y Q;  2KOQ A;  4COP A;  1F80 D;  1EIA A;  2JU1 A;  4XFZ A;  4NEO A;  3CE7 A;  1JJ2 O;  4PH0 A;  3U43 A;  3RG6 C;  1BAJ A;  1VQ7 P;  2K2Q A;  2ONT A;  3Q20 A;  2PEM A;  1VQ5 P;  2PNG A;  4DG9 A;  2KR5 A;  3H47 A;  3G71 P;  2L4B A;  2N6Z A;  2NO8 A;  1VQN P;  1OR5 A;  1AUM A;  4U0C A;  1W2B O;  1IMP A;  1IUQ A;  1S72 P;  1DNY A;  1RNI A;  4F37 A;  2Z44 A;  1YIJ P;  2GDX A;  4IPY A;  1Q82 Q;  1YHQ P;  3E2D A;  1VHN A;  2L0Q A;  3G0V A;  4QKO A;  3CCL P;  1GXG A;  5HGN A;  1BXI A;  3DTJ A;  4IZ6 A;  2P9X A;  3CC4 P;  2XT1 A;  3HYB A;  3WBH A;  2FHS C;  2EIA A;  2ROQ A;  2K94 A;  1N8R Q;  2OAR A;  2L6E A;  3MGE A;  1RO0 A;  1ZNV A;  2M8N A;  2QEX P;  3G28 A;  1M6N A;  4H2X C;  2GDY A;  2KG6 A;  5HGL A;  1QVG O;  1KC8 Q;  4PH1 A;  3LMO A;  4XFY A;  3CCQ P;  2L22 A;  2KGC A;  2VLO A;  5KP6 B;  2GDW A;  3B5I A;  1YIT P;  5BS1 A;  4HKG A;  5JPA A;  4BPH A;  2QNW A;  2FVA A;  2WPT A;  2ERH A;  1HQB A;  3EJD A;  5KP7 B;  3G6E P;  5HVC A;  1KD1 Q;  1QVF O;  2XZ1 C;  2M8P A;  1UJZ A;  2K93 A;  4H2W C;  1E6J P; 
#chains in the Genus database with same CATH homology
 2DNW A;  3EJE A;  2LL8 A;  2GDX A;  2KOS A;  1HY8 A;  3RG2 A;  2JQ4 A;  2AF8 A;  2L0Q A;  3GZM A;  2FVE A;  2MY5 A;  5HV8 A;  2MR7 A;  2LML A;  1VKU A;  2LKI A;  2N5H A;  4BPF A;  4IZ6 A;  4CA3 A;  2EHS A;  2LPK A;  1T8K A;  2N50 A;  2JU2 A;  4MRT C;  5KP8 B;  2MR8 A;  2FAE A;  1DV5 A;  2MVU A;  2FHS C;  3NY7 B;  2L9F A;  4PWV B;  1L0I A;  4H2Y C;  2ROQ A;  2K94 A;  1NQ4 A;  4PXH B;  2M5R A;  1AF8 A;  1L0H A;  3GZL A;  2N98 A;  2LIW A;  4R0M A;  2FAC A;  2CG5 B;  2KGD A;  1X3O A;  2KG8 A;  2CGQ A;  2KGA A;  5CZD B;  2N6Y A;  2CQ8 A;  2AFD A;  1KLP A;  4H2X C;  2GDY A;  1ACP A;  2KG6 A;  2KW2 A;  2K92 A;  2KWL A;  2KGE A;  2KOP A;  2K0Y A;  2N5I A;  2KOQ A;  2XZ0 D;  1F80 D;  2JU1 A;  2KG9 A;  2EHT A;  4NEO A;  2FQ1 A;  2MVV A;  3CE7 A;  3LMO A;  2MF4 A;  3EJB A;  2AVA A;  2FQ2 A;  2L22 A;  2KGC A;  5KP6 B;  2GDW A;  2LOL A;  2K2Q A;  2KOR A;  2MD9 A;  4HKG A;  2FAD A;  4BPH A;  2FVF A;  2QNW A;  2FVA A;  5EJD A;  2PNG A;  2VSQ A;  4DG9 A;  2LTE A;  2KR5 A;  1HQB A;  3EJD A;  2L4B A;  2N6Z A;  5KP7 B;  1OR5 A;  5HVC A;  2KOO A;  2XZ1 C;  2FQ0 A;  2CNR A;  2X2B A;  2K93 A;  4BPG A;  2K0X A;  4H2W C;  2JGP A;  2LIU A;  1DNY A;  2AFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...