3GZLA

Crystal structure of holo pfacp disulfide-linked dimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
SSLKSTFDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Acyl carrier protein
publication title Plasmodium falciparum acyl carrier protein crystal structures in disulfide-linked and reduced states and their prevalence during blood stage growth.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 25
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 3gzlA00
2KW2A 3GZLA 2MR7A 1HQBA 2CGQA 2QNWA 1DV5A 2FACA 2KGAA 2ROQA 2FVFA 1L0HA 2N50A 2KG6A 2FVAA 2LPKA 2AVAA 2EHTA 2K0XA 2LIUA 2M5RA 5EJDA 2N5IA 4PWVB 2LIWA 2CQ8A 2KOPA 2LTEA 2XZ1C 3RG2A 2CG5B 3EJDA 2KOOA 2FVEA 2N98A 2PNGA 2FQ0A 2GDYA 4HKGA 2LOLA 1ACPA 2AFDA 2L9FA 2LL8A 3NY7B 2EHSA 5KP8B 2VSQA 1T8KA 2L22A 2KGDA 2KWLA 2KGCA 3EJBA 4H2XC 2LKIA 1AF8A 1L0IA 2KORA 2MR8A 2L0QA 2XZ0D 2K94A 2AFEA 2MVVA 4DG9A 2N6YA 1X3OA 2JGPA 1F80D 4PXHB 4BPHA 2N5HA 1NQ4A 2KOQA 2K2QA 2JU1A 2LMLA 3LMOA 1VKUA 2MVUA 4H2YC 4R0MA 5CZDB 1OR5A 2KGEA 5KP6B 2JQ4A 5HV8A 2L4BA 2X2BA 2K93A 2GDXA 2JU2A 5HVCA 3GZMA 2MD9A 4CA3A 4H2WC 4NEOA 2FADA 2FAEA 2FHSC 2K92A 2MF4A 1KLPA 2KR5A 2DNWA 2AF8A 4BPGA 2GDWA 2FQ1A 2KG9A 2MY5A 4MRTC 2CNRA 1HY8A 3CE7A 2KG8A 2N6ZA 2K0YA 4IZ6A 1DNYA 4BPFA 3EJEA 5KP7B 2KOSA 2FQ2A
chains in the Genus database with same CATH superfamily
2KW2A 3GZLA 1HQBA 4XFYA 2FACA 4PH1A 2ROQA 2LIUA 2M8LA 1K73Q 2XXMA 3CCVP 2LIWA 2CQ8A 2KOPA 2DGYA 1M1KQ 1JJ2O 4QNBA 1UNKA 2FQ0A 3DPHA 1M6NA 7CEIA 3U43A 4IPYA 1E6JP 2LF4A 1T8KA 2JYGA 2KGCA 2PEKA 2LKIA 2PEMA 2QEXP 1AF8A 1L0IA 2MR8A 2L0QA 1VQ7P 3CPWO 3DTJA 1FR2A 2PY8A 2K0DX 3Q20A 1F80D 5F2KA 3VRLC 1VQLP 4BPHA 3E2DA 2JO0A 2N5HA 2K2QA 2JU1A 4U0DA 3GKLC 5KP6B 5HV8A 3H4EA 3GZMA 2MD9A 1VQNP 3CCRP 3DS4A 2KODA 2FAEA 2K92A 1KLPA 2MF4A 3G1IA 1M6EX 2JB0A 1KC8Q 2OTLP 1VQKP 2KG9A 4XFXA 2CNRA 1VHNA 4M0IA 3CD6P 2KOSA 2FQ2A 2JAZA 3CXCO 2CGQA 2QNWA 1DV5A 2N50A 3G4SP 2AVAA 3CCSP 4GR2A 5EJDA 1E0HA 1AYIA 1QVFO 2LTEA 2CG5B 1IMQA 2PEQA 3EJDA 2FVEA 3LRYA 3G0VA 5HGNA 1KD1Q 2Z46A 1BXIA 2GZGA 2LOLA 1ACPA 1Q81Q 2VLPA 5KP8B 1UJZA 3EJBA 2K94A 1ZMBA 4DG9A 4PXHB 1NQ4A 3LMOA 1VKUA 3DS1A 5CZDB 1GPJA 2GYKA 3G21A 1VQ6P 2GDXA 3CMAP 4PH0A 4H2WC 1KQSO 4NEOA 2FADA 3I56P 2FHSC 2KR5A 3DS2A 1YITP 1EIAA 2P9XA 5DCKA 2XV6A 3H47A 2M8NA 4MRTC 3G28A 3CE7A 3WBHA 2N6ZA 2K0YA 1DNYA 4XFZA 3EJEA 1W2BO 1VQ9P 2GZEA 2Z44A 3M1MA 2MR7A 1VQMP 3GJNA 1YJWP 4U0CA 2KGAA 2EIAA 2FVFA 3P05A 1M90Q 2KG6A 4U0EA 2LPKA 2K0XA 2M5RA 2N5IA 1QVGO 1YJ9P 2XZ1C 3RG2A 2JBGA 1K9MQ 2PNGA 5EW5E 3CCMP 3CCEP 4HKGA 2PEOA 3NY7B 1VQPP 2VSQA 5I4TG 2KGDA 2Z45A 2JYLA 2KORA 2XZ0D 5HGMA 1X3OA 2ERHA 5HGOA 3I55P 1K8AQ 3MGEA 2GZFA 4XROA 2LMLA 2EG5A 4GR6A 3G71P 4H2YC 1A8OA 3CMEP 2KGEA 2JQ4A 4U0FA 2X2BA 2JU2A 2PEJA 4CA3A 3CCQP 1N8RQ 1M74A 1IMPA 4F37A 2BHVA 2DNWA 3CC7P 5BS1A 2AF8A 1Q7YQ 2GDWA 4XRQA 5JPAA 2MY5A 1Q86Q 1Q82Q 3B4QA 2GZIA 2KG8A 2K5XA 4COPA 1A43A 4IZ6A 2OTJP 5HGLA 5F2NA 2E1MA 2L6EA 2VLOA 3G29A 2WPTA 3B5IA 3OW2O 1VQ5P 4QKOA 1YHQP 1D1DA 1L0HA 1RNIA 2FVAA 1MZ8A 2EHTA 2ONTA 2VLNA 1YIJP 4PWVB 1S72P 4UHPB 2QA4P 3CC2P 2EFJA 2PENA 2KOOA 2M8PA 2N98A 2GDYA 3DS3A 1YJNP 2NO8A 2OARA 1ZNVA 2AFDA 2L9FA 2LL8A 1VQ4P 2EHSA 1BAJA 3CCLP 2L22A 2XT1A 1RO0A 2KWLA 3CCUP 1YI2P 1GXGA 4H2XC 2VLQA 4U0BA 1IUQA 4U0AA 5BS2A 2AFEA 1K30A 2MVVA 2N6YA 1Z6MA 2JGPA 1VQ8P 3G6EP 2KOQA 3HYBA 1AUMA 1CEIA 2PEIA 2CWOA 2MVUA 4WYMA 4R0MA 3DS5A 1GXHA 1OR5A 3G1GA 3DS0A 1EOQA 1VQOP 2L4BA 2K93A 5HVCA 3H0DA 1NJIQ 1QRJA 3CCJP 3NTEA 5F2OA 4COCA 3RG6C 4BPGA 2FQ1A 1RO2A 1HY8A 2GZJA 3G26A 2BUOA 4BPFA 1EMVA 3CC4P 3HZQA 5KP7B
chains in the Genus database with same CATH topology
2KW2A 3GZLA 2MR7A 1HQBA 2CGQA 2QNWA 1DV5A 2FACA 2KGAA 2ROQA 2FVFA 1L0HA 2N50A 2KG6A 2FVAA 2LPKA 2AVAA 2EHTA 2K0XA 2LIUA 2M5RA 5EJDA 2N5IA 4PWVB 2LIWA 2CQ8A 2KOPA 2LTEA 2XZ1C 3RG2A 2CG5B 3EJDA 2KOOA 2FVEA 2N98A 2PNGA 2FQ0A 2GDYA 4HKGA 2LOLA 1ACPA 2AFDA 2L9FA 2LL8A 3NY7B 2EHSA 5KP8B 2VSQA 1T8KA 2L22A 2KGDA 2KWLA 2KGCA 3EJBA 4H2XC 2LKIA 1AF8A 1L0IA 2KORA 2MR8A 2L0QA 2XZ0D 2K94A 2AFEA 2MVVA 4DG9A 2N6YA 1X3OA 2JGPA 1F80D 4PXHB 4BPHA 2N5HA 1NQ4A 2KOQA 2K2QA 2JU1A 2LMLA 3LMOA 1VKUA 2MVUA 4H2YC 4R0MA 5CZDB 1OR5A 2KGEA 5KP6B 2JQ4A 5HV8A 2L4BA 2X2BA 2K93A 2GDXA 2JU2A 5HVCA 3GZMA 2MD9A 4CA3A 4H2WC 4NEOA 2FADA 2FAEA 2FHSC 2K92A 2MF4A 1KLPA 2KR5A 2DNWA 2AF8A 4BPGA 2GDWA 2FQ1A 2KG9A 2MY5A 4MRTC 2CNRA 1HY8A 3CE7A 2KG8A 2N6ZA 2K0YA 4IZ6A 1DNYA 4BPFA 3EJEA 5KP7B 2KOSA 2FQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW2 A;  3GZL A;  2MR7 A;  1HQB A;  2CGQ A;  2QNW A;  1DV5 A;  2FAC A;  2KGA A;  2ROQ A;  2FVF A;  1L0H A;  2N50 A;  2KG6 A;  2FVA A;  2LPK A;  2AVA A;  2EHT A;  2K0X A;  2LIU A;  2M5R A;  5EJD A;  2N5I A;  4PWV B;  2LIW A;  2CQ8 A;  2KOP A;  2LTE A;  2XZ1 C;  3RG2 A;  2CG5 B;  3EJD A;  2KOO A;  2FVE A;  2N98 A;  2PNG A;  2FQ0 A;  2GDY A;  4HKG A;  2LOL A;  1ACP A;  2AFD A;  2L9F A;  2LL8 A;  3NY7 B;  2EHS A;  5KP8 B;  2VSQ A;  1T8K A;  2L22 A;  2KGD A;  2KWL A;  2KGC A;  3EJB A;  4H2X C;  2LKI A;  1AF8 A;  1L0I A;  2KOR A;  2MR8 A;  2L0Q A;  2XZ0 D;  2K94 A;  2AFE A;  2MVV A;  4DG9 A;  2N6Y A;  1X3O A;  2JGP A;  1F80 D;  4PXH B;  4BPH A;  2N5H A;  1NQ4 A;  2KOQ A;  2K2Q A;  2JU1 A;  2LML A;  3LMO A;  1VKU A;  2MVU A;  4H2Y C;  4R0M A;  5CZD B;  1OR5 A;  2KGE A;  5KP6 B;  2JQ4 A;  5HV8 A;  2L4B A;  2X2B A;  2K93 A;  2GDX A;  2JU2 A;  5HVC A;  3GZM A;  2MD9 A;  4CA3 A;  4H2W C;  4NEO A;  2FAD A;  2FAE A;  2FHS C;  2K92 A;  2MF4 A;  1KLP A;  2KR5 A;  2DNW A;  2AF8 A;  4BPG A;  2GDW A;  2FQ1 A;  2KG9 A;  2MY5 A;  4MRT C;  2CNR A;  1HY8 A;  3CE7 A;  2KG8 A;  2N6Z A;  2K0Y A;  4IZ6 A;  1DNY A;  4BPF A;  3EJE A;  5KP7 B;  2KOS A;  2FQ2 A; 
#chains in the Genus database with same CATH topology
 2KW2 A;  3GZL A;  1HQB A;  4XFY A;  2FAC A;  4PH1 A;  2ROQ A;  2LIU A;  2M8L A;  1K73 Q;  2XXM A;  3CCV P;  2LIW A;  2CQ8 A;  2KOP A;  2DGY A;  1M1K Q;  1JJ2 O;  4QNB A;  1UNK A;  2FQ0 A;  3DPH A;  1M6N A;  7CEI A;  3U43 A;  4IPY A;  1E6J P;  2LF4 A;  1T8K A;  2JYG A;  2KGC A;  2PEK A;  2LKI A;  2PEM A;  2QEX P;  1AF8 A;  1L0I A;  2MR8 A;  2L0Q A;  1VQ7 P;  3CPW O;  3DTJ A;  1FR2 A;  2PY8 A;  2K0D X;  3Q20 A;  1F80 D;  5F2K A;  3VRL C;  1VQL P;  4BPH A;  3E2D A;  2JO0 A;  2N5H A;  2K2Q A;  2JU1 A;  4U0D A;  3GKL C;  5KP6 B;  5HV8 A;  3H4E A;  3GZM A;  2MD9 A;  1VQN P;  3CCR P;  3DS4 A;  2KOD A;  2FAE A;  2K92 A;  1KLP A;  2MF4 A;  3G1I A;  1M6E X;  2JB0 A;  1KC8 Q;  2OTL P;  1VQK P;  2KG9 A;  4XFX A;  2CNR A;  1VHN A;  4M0I A;  3CD6 P;  2KOS A;  2FQ2 A;  2JAZ A;  3CXC O;  2CGQ A;  2QNW A;  1DV5 A;  2N50 A;  3G4S P;  2AVA A;  3CCS P;  4GR2 A;  5EJD A;  1E0H A;  1AYI A;  1QVF O;  2LTE A;  2CG5 B;  1IMQ A;  2PEQ A;  3EJD A;  2FVE A;  3LRY A;  3G0V A;  5HGN A;  1KD1 Q;  2Z46 A;  1BXI A;  2GZG A;  2LOL A;  1ACP A;  1Q81 Q;  2VLP A;  5KP8 B;  1UJZ A;  3EJB A;  2K94 A;  1ZMB A;  4DG9 A;  4PXH B;  1NQ4 A;  3LMO A;  1VKU A;  3DS1 A;  5CZD B;  1GPJ A;  2GYK A;  3G21 A;  1VQ6 P;  2GDX A;  3CMA P;  4PH0 A;  4H2W C;  1KQS O;  4NEO A;  2FAD A;  3I56 P;  2FHS C;  2KR5 A;  3DS2 A;  1YIT P;  1EIA A;  2P9X A;  5DCK A;  2XV6 A;  3H47 A;  2M8N A;  4MRT C;  3G28 A;  3CE7 A;  3WBH A;  2N6Z A;  2K0Y A;  1DNY A;  4XFZ A;  3EJE A;  1W2B O;  1VQ9 P;  2GZE A;  2Z44 A;  3M1M A;  2MR7 A;  1VQM P;  3GJN A;  1YJW P;  4U0C A;  2KGA A;  2EIA A;  2FVF A;  3P05 A;  1M90 Q;  2KG6 A;  4U0E A;  2LPK A;  2K0X A;  2M5R A;  2N5I A;  1QVG O;  1YJ9 P;  2XZ1 C;  3RG2 A;  2JBG A;  1K9M Q;  2PNG A;  5EW5 E;  3CCM P;  3CCE P;  4HKG A;  2PEO A;  3NY7 B;  1VQP P;  2VSQ A;  5I4T G;  2KGD A;  2Z45 A;  2JYL A;  2KOR A;  2XZ0 D;  5HGM A;  1X3O A;  2ERH A;  5HGO A;  3I55 P;  1K8A Q;  3MGE A;  2GZF A;  4XRO A;  2LML A;  2EG5 A;  4GR6 A;  3G71 P;  4H2Y C;  1A8O A;  3CME P;  2KGE A;  2JQ4 A;  4U0F A;  2X2B A;  2JU2 A;  2PEJ A;  4CA3 A;  3CCQ P;  1N8R Q;  1M74 A;  1IMP A;  4F37 A;  2BHV A;  2DNW A;  3CC7 P;  5BS1 A;  2AF8 A;  1Q7Y Q;  2GDW A;  4XRQ A;  5JPA A;  2MY5 A;  1Q86 Q;  1Q82 Q;  3B4Q A;  2GZI A;  2KG8 A;  2K5X A;  4COP A;  1A43 A;  4IZ6 A;  2OTJ P;  5HGL A;  5F2N A;  2E1M A;  2L6E A;  2VLO A;  3G29 A;  2WPT A;  3B5I A;  3OW2 O;  1VQ5 P;  4QKO A;  1YHQ P;  1D1D A;  1L0H A;  1RNI A;  2FVA A;  1MZ8 A;  2EHT A;  2ONT A;  2VLN A;  1YIJ P;  4PWV B;  1S72 P;  4UHP B;  2QA4 P;  3CC2 P;  2EFJ A;  2PEN A;  2KOO A;  2M8P A;  2N98 A;  2GDY A;  3DS3 A;  1YJN P;  2NO8 A;  2OAR A;  1ZNV A;  2AFD A;  2L9F A;  2LL8 A;  1VQ4 P;  2EHS A;  1BAJ A;  3CCL P;  2L22 A;  2XT1 A;  1RO0 A;  2KWL A;  3CCU P;  1YI2 P;  1GXG A;  4H2X C;  2VLQ A;  4U0B A;  1IUQ A;  4U0A A;  5BS2 A;  2AFE A;  1K30 A;  2MVV A;  2N6Y A;  1Z6M A;  2JGP A;  1VQ8 P;  3G6E P;  2KOQ A;  3HYB A;  1AUM A;  1CEI A;  2PEI A;  2CWO A;  2MVU A;  4WYM A;  4R0M A;  3DS5 A;  1GXH A;  1OR5 A;  3G1G A;  3DS0 A;  1EOQ A;  1VQO P;  2L4B A;  2K93 A;  5HVC A;  3H0D A;  1NJI Q;  1QRJ A;  3CCJ P;  3NTE A;  5F2O A;  4COC A;  3RG6 C;  4BPG A;  2FQ1 A;  1RO2 A;  1HY8 A;  2GZJ A;  3G26 A;  2BUO A;  4BPF A;  1EMV A;  3CC4 P;  3HZQ A;  5KP7 B; 
#chains in the Genus database with same CATH homology
 2KW2 A;  3GZL A;  2MR7 A;  1HQB A;  2CGQ A;  2QNW A;  1DV5 A;  2FAC A;  2KGA A;  2ROQ A;  2FVF A;  1L0H A;  2N50 A;  2KG6 A;  2FVA A;  2LPK A;  2AVA A;  2EHT A;  2K0X A;  2LIU A;  2M5R A;  5EJD A;  2N5I A;  4PWV B;  2LIW A;  2CQ8 A;  2KOP A;  2LTE A;  2XZ1 C;  3RG2 A;  2CG5 B;  3EJD A;  2KOO A;  2FVE A;  2N98 A;  2PNG A;  2FQ0 A;  2GDY A;  4HKG A;  2LOL A;  1ACP A;  2AFD A;  2L9F A;  2LL8 A;  3NY7 B;  2EHS A;  5KP8 B;  2VSQ A;  1T8K A;  2L22 A;  2KGD A;  2KWL A;  2KGC A;  3EJB A;  4H2X C;  2LKI A;  1AF8 A;  1L0I A;  2KOR A;  2MR8 A;  2L0Q A;  2XZ0 D;  2K94 A;  2AFE A;  2MVV A;  4DG9 A;  2N6Y A;  1X3O A;  2JGP A;  1F80 D;  4PXH B;  4BPH A;  2N5H A;  1NQ4 A;  2KOQ A;  2K2Q A;  2JU1 A;  2LML A;  3LMO A;  1VKU A;  2MVU A;  4H2Y C;  4R0M A;  5CZD B;  1OR5 A;  2KGE A;  5KP6 B;  2JQ4 A;  5HV8 A;  2L4B A;  2X2B A;  2K93 A;  2GDX A;  2JU2 A;  5HVC A;  3GZM A;  2MD9 A;  4CA3 A;  4H2W C;  4NEO A;  2FAD A;  2FAE A;  2FHS C;  2K92 A;  2MF4 A;  1KLP A;  2KR5 A;  2DNW A;  2AF8 A;  4BPG A;  2GDW A;  2FQ1 A;  2KG9 A;  2MY5 A;  4MRT C;  2CNR A;  1HY8 A;  3CE7 A;  2KG8 A;  2N6Z A;  2K0Y A;  4IZ6 A;  1DNY A;  4BPF A;  3EJE A;  5KP7 B;  2KOS A;  2FQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...