1DNYA

Solution structure of pcp, a prototype for the peptidyl carrier domains of modular peptide synthetases
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
YVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NON-RIBOSOMAL PEPTIDE SYNTHETASE PEPTIDYL CARRIER PROTEIN
publication title Solution structure of PCP, a prototype for the peptidyl carrier domains of modular peptide synthetases.
pubmed doi rcsb
source organism Brevibacillus brevis
molecule tags Ligase
total genus 19
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1dnyA00
2KGAA 2MR7A 2FQ1A 1T8KA 2MF4A 2MD9A 4CA3A 2KGCA 2QNWA 1VKUA 4DG9A 2KOSA 1KLPA 2N50A 2LPKA 2DNWA 2K93A 2LMLA 2N5IA 2JU1A 5EJDA 5CZDB 2K0YA 2X2BA 2FHSC 5KP7B 1NQ4A 1AF8A 1L0HA 2FVFA 2CG5B 2ROQA 2JU2A 2FVAA 2AFEA 2MVUA 2L22A 4HKGA 4PXHB 2XZ0D 2KOQA 2KR5A 2VSQA 4H2XC 2M5RA 2CQ8A 2KG8A 4MRTC 2GDWA 2KG9A 2L0QA 2N6ZA 3CE7A 4BPHA 2K0XA 4R0MA 2CNRA 2KOOA 2FVEA 2N5HA 2N98A 2LIWA 2GDYA 1DNYA 2AVAA 4BPGA 4NEOA 2K2QA 1DV5A 3NY7B 2FACA 2JQ4A 3EJDA 3EJBA 2CGQA 2FAEA 4IZ6A 2GDXA 2KOPA 5HV8A 1HY8A 2FQ2A 4H2WC 2PNGA 2EHSA 2L4BA 3LMOA 5KP6B 2AFDA 1ACPA 4BPFA 2KGEA 2LIUA 5KP8B 1X3OA 3GZMA 2MR8A 4H2YC 2MY5A 1F80D 2K94A 3EJEA 2KWLA 2JGPA 1L0IA 3RG2A 1HQBA 2LOLA 2AF8A 2KORA 2FQ0A 5HVCA 2EHTA 2XZ1C 2FADA 2KG6A 2LTEA 2N6YA 2KW2A 2LKIA 3GZLA 4PWVB 1OR5A 2K92A 2KGDA 2LL8A 2L9FA 2MVVA
chains in the Genus database with same CATH superfamily
1JJ2O 1RNIA 3CCLP 2ONTA 1S72P 3H4EA 2QNWA 2PEMA 3NTEA 1NJIQ 2OTJP 2KOSA 3DPHA 1VQNP 2LPKA 2EIAA 2K93A 2QA4P 5EJDA 5CZDB 2K0YA 3G29A 2FHSC 2K0DX 1UJZA 1L0HA 4WYMA 1YITP 2XT1A 5JPAA 2JAZA 2VSQA 3G1IA 2LF4A 2M5RA 3G28A 4MRTC 1YHQP 4XFXA 3CCRP 1QVGO 2LIWA 1A8OA 2GZIA 2AVAA 1Z6MA 3U43A 2JQ4A 5HV8A 2FQ2A 2CWOA 4H2WC 2L4BA 1BXIA 2L6EA 1M1KQ 2Z45A 4BPFA 2GZEA 5KP8B 1BAJA 1K30A 2MY5A 3EJEA 2GZJA 2KWLA 3M1MA 2JGPA 3RG2A 4GR2A 3DS1A 3CXCO 1RO2A 1YIJP 3GZLA 2LKIA 3CC7P 1M6NA 5F2NA 1OR5A 3LRYA 2L9FA 3Q20A 2KGAA 2M8NA 1KD1Q 2FQ1A 2MF4A 2M8PA 3CPWO 4XFYA 2KGCA 2JYGA 2GZFA 1VQ4P 3MGEA 1VQ8P 3H47A 5BS2A 2X2BA 1E0HA 3P05A 4PH1A 2KODA 4PH0A 3CCUP 2MVUA 1VQ5P 4PXHB 1KQSO 2KOQA 2OARA 1VQPP 3CC2P 2KR5A 2XXMA 3DS2A 2KG9A 2PY8A 3CE7A 1IMQA 5HGLA 2K0XA 1VQOP 2CNRA 2FVEA 3HZQA 3E2DA 2WPTA 4NEOA 2K2QA 1DV5A 3CCEP 3EJBA 4QKOA 3I56P 2GDXA 1VQMP 2NO8A 1K73Q 1HY8A 4U0CA 1RO0A 5HGNA 1D1DA 4U0FA 1VQLP 3GZMA 2K94A 5HGMA 3G21A 2XZ1C 1Q86Q 3VRLC 2LTEA 1UNKA 1Q81Q 2N6YA 3CCSP 4IPYA 4XRQA 3CMAP 3DS5A 2EG5A 2KGDA 2LL8A 1K9MQ 3CCMP 2Z46A 1GXHA 2MVVA 3DS3A 4U0DA 2MR7A 1T8KA 1CEIA 2BHVA 2PEKA 4CA3A 1QVFO 2DNWA 2JYLA 2JO0A 2P9XA 2JU1A 2PEIA 1MZ8A 1IMPA 5KP7B 1NQ4A 4U0BA 2CG5B 2ROQA 2AFEA 4H2XC 5F2KA 4GR6A 2KG8A 1ZNVA 1EMVA 1A43A 4BPHA 1KC8Q 2N5HA 1W2BO 1DNYA 3H0DA 2QEXP 4U0EA 3CCJP 2CGQA 1FR2A 2K5XA 4QNBA 5BS1A 1VQ6P 2FAEA 2KOPA 2VLOA 2Z44A 1GXGA 3GJNA 1EIAA 2PNGA 2OTLP 3G26A 4M0IA 2EHSA 5KP6B 1EOQA 2BUOA 3CD6P 1GPJA 2AFDA 3G0VA 4U0AA 1AYIA 4H2YC 1N8RQ 5I4TG 3DS0A 1VHNA 1VQ7P 4UHPB 2PEOA 3CC4P 1YJ9P 2JBGA 3CMEP 2KORA 2FQ0A 3G1GA 2PENA 5HVCA 2EHTA 4COCA 3G4SP 4F37A 2K92A 3HYBA 1VQ9P 1M74A 2M8LA 5EW5E 2MD9A 2VLPA 1VKUA 4DG9A 3WBHA 2GZGA 1KLPA 2N50A 1M90Q 2LMLA 2N5IA 2E1MA 1AF8A 1YI2P 2FVFA 2JU2A 2FVAA 1YJWP 3GKLC 2L22A 4HKGA 2XZ0D 1Q7YQ 4COPA 3G71P 2JB0A 4XROA 2CQ8A 5F2OA 3OW2O 2GDWA 2L0QA 2N6ZA 2PEJA 1E6JP 4R0MA 2KOOA 2N98A 1QRJA 1K8AQ 1IUQA 2GDYA 3B5IA 1M6EX 2XV6A 4BPGA 3NY7B 2FACA 2VLNA 3EJDA 1AUMA 1VQKP 5HGOA 7CEIA 4IZ6A 3G6EP 3LMOA 1ACPA 4XFZA 2DGYA 2GYKA 2KGEA 3CCQP 2LIUA 1X3OA 2PEQA 3DS4A 2MR8A 3I55P 1F80D 1ZMBA 1Q82Q 1L0IA 3CCVP 1HQBA 2LOLA 2AF8A 2FADA 3RG6C 2KG6A 3B4QA 2VLQA 1YJNP 2KW2A 4PWVB 2ERHA 3DTJA 2EFJA 5DCKA
chains in the Genus database with same CATH topology
2KGAA 2MR7A 2FQ1A 1T8KA 2MF4A 2MD9A 4CA3A 2KGCA 2QNWA 1VKUA 4DG9A 2KOSA 1KLPA 2N50A 2LPKA 2DNWA 2K93A 2LMLA 2N5IA 2JU1A 5EJDA 5CZDB 2K0YA 2X2BA 2FHSC 5KP7B 1NQ4A 1AF8A 1L0HA 2FVFA 2CG5B 2ROQA 2JU2A 2FVAA 2AFEA 2MVUA 2L22A 4HKGA 4PXHB 2XZ0D 2KOQA 2KR5A 2VSQA 4H2XC 2M5RA 2CQ8A 2KG8A 4MRTC 2GDWA 2KG9A 2L0QA 2N6ZA 3CE7A 4BPHA 2K0XA 4R0MA 2CNRA 2KOOA 2FVEA 2N5HA 2N98A 2LIWA 2GDYA 1DNYA 2AVAA 4BPGA 4NEOA 2K2QA 1DV5A 3NY7B 2FACA 2JQ4A 3EJDA 3EJBA 2CGQA 2FAEA 4IZ6A 2GDXA 2KOPA 5HV8A 1HY8A 2FQ2A 4H2WC 2PNGA 2EHSA 2L4BA 3LMOA 5KP6B 2AFDA 1ACPA 4BPFA 2KGEA 2LIUA 5KP8B 1X3OA 3GZMA 2MR8A 4H2YC 2MY5A 1F80D 2K94A 3EJEA 2KWLA 2JGPA 1L0IA 3RG2A 1HQBA 2LOLA 2AF8A 2KORA 2FQ0A 5HVCA 2EHTA 2XZ1C 2FADA 2KG6A 2LTEA 2N6YA 2KW2A 2LKIA 3GZLA 4PWVB 1OR5A 2K92A 2KGDA 2LL8A 2L9FA 2MVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGA A;  2MR7 A;  2FQ1 A;  1T8K A;  2MF4 A;  2MD9 A;  4CA3 A;  2KGC A;  2QNW A;  1VKU A;  4DG9 A;  2KOS A;  1KLP A;  2N50 A;  2LPK A;  2DNW A;  2K93 A;  2LML A;  2N5I A;  2JU1 A;  5EJD A;  5CZD B;  2K0Y A;  2X2B A;  2FHS C;  5KP7 B;  1NQ4 A;  1AF8 A;  1L0H A;  2FVF A;  2CG5 B;  2ROQ A;  2JU2 A;  2FVA A;  2AFE A;  2MVU A;  2L22 A;  4HKG A;  4PXH B;  2XZ0 D;  2KOQ A;  2KR5 A;  2VSQ A;  4H2X C;  2M5R A;  2CQ8 A;  2KG8 A;  4MRT C;  2GDW A;  2KG9 A;  2L0Q A;  2N6Z A;  3CE7 A;  4BPH A;  2K0X A;  4R0M A;  2CNR A;  2KOO A;  2FVE A;  2N5H A;  2N98 A;  2LIW A;  2GDY A;  1DNY A;  2AVA A;  4BPG A;  4NEO A;  2K2Q A;  1DV5 A;  3NY7 B;  2FAC A;  2JQ4 A;  3EJD A;  3EJB A;  2CGQ A;  2FAE A;  4IZ6 A;  2GDX A;  2KOP A;  5HV8 A;  1HY8 A;  2FQ2 A;  4H2W C;  2PNG A;  2EHS A;  2L4B A;  3LMO A;  5KP6 B;  2AFD A;  1ACP A;  4BPF A;  2KGE A;  2LIU A;  5KP8 B;  1X3O A;  3GZM A;  2MR8 A;  4H2Y C;  2MY5 A;  1F80 D;  2K94 A;  3EJE A;  2KWL A;  2JGP A;  1L0I A;  3RG2 A;  1HQB A;  2LOL A;  2AF8 A;  2KOR A;  2FQ0 A;  5HVC A;  2EHT A;  2XZ1 C;  2FAD A;  2KG6 A;  2LTE A;  2N6Y A;  2KW2 A;  2LKI A;  3GZL A;  4PWV B;  1OR5 A;  2K92 A;  2KGD A;  2LL8 A;  2L9F A;  2MVV A; 
#chains in the Genus database with same CATH topology
 1JJ2 O;  1RNI A;  3CCL P;  2ONT A;  1S72 P;  3H4E A;  2QNW A;  2PEM A;  3NTE A;  1NJI Q;  2OTJ P;  2KOS A;  3DPH A;  1VQN P;  2LPK A;  2EIA A;  2K93 A;  2QA4 P;  5EJD A;  5CZD B;  2K0Y A;  3G29 A;  2FHS C;  2K0D X;  1UJZ A;  1L0H A;  4WYM A;  1YIT P;  2XT1 A;  5JPA A;  2JAZ A;  2VSQ A;  3G1I A;  2LF4 A;  2M5R A;  3G28 A;  4MRT C;  1YHQ P;  4XFX A;  3CCR P;  1QVG O;  2LIW A;  1A8O A;  2GZI A;  2AVA A;  1Z6M A;  3U43 A;  2JQ4 A;  5HV8 A;  2FQ2 A;  2CWO A;  4H2W C;  2L4B A;  1BXI A;  2L6E A;  1M1K Q;  2Z45 A;  4BPF A;  2GZE A;  5KP8 B;  1BAJ A;  1K30 A;  2MY5 A;  3EJE A;  2GZJ A;  2KWL A;  3M1M A;  2JGP A;  3RG2 A;  4GR2 A;  3DS1 A;  3CXC O;  1RO2 A;  1YIJ P;  3GZL A;  2LKI A;  3CC7 P;  1M6N A;  5F2N A;  1OR5 A;  3LRY A;  2L9F A;  3Q20 A;  2KGA A;  2M8N A;  1KD1 Q;  2FQ1 A;  2MF4 A;  2M8P A;  3CPW O;  4XFY A;  2KGC A;  2JYG A;  2GZF A;  1VQ4 P;  3MGE A;  1VQ8 P;  3H47 A;  5BS2 A;  2X2B A;  1E0H A;  3P05 A;  4PH1 A;  2KOD A;  4PH0 A;  3CCU P;  2MVU A;  1VQ5 P;  4PXH B;  1KQS O;  2KOQ A;  2OAR A;  1VQP P;  3CC2 P;  2KR5 A;  2XXM A;  3DS2 A;  2KG9 A;  2PY8 A;  3CE7 A;  1IMQ A;  5HGL A;  2K0X A;  1VQO P;  2CNR A;  2FVE A;  3HZQ A;  3E2D A;  2WPT A;  4NEO A;  2K2Q A;  1DV5 A;  3CCE P;  3EJB A;  4QKO A;  3I56 P;  2GDX A;  1VQM P;  2NO8 A;  1K73 Q;  1HY8 A;  4U0C A;  1RO0 A;  5HGN A;  1D1D A;  4U0F A;  1VQL P;  3GZM A;  2K94 A;  5HGM A;  3G21 A;  2XZ1 C;  1Q86 Q;  3VRL C;  2LTE A;  1UNK A;  1Q81 Q;  2N6Y A;  3CCS P;  4IPY A;  4XRQ A;  3CMA P;  3DS5 A;  2EG5 A;  2KGD A;  2LL8 A;  1K9M Q;  3CCM P;  2Z46 A;  1GXH A;  2MVV A;  3DS3 A;  4U0D A;  2MR7 A;  1T8K A;  1CEI A;  2BHV A;  2PEK A;  4CA3 A;  1QVF O;  2DNW A;  2JYL A;  2JO0 A;  2P9X A;  2JU1 A;  2PEI A;  1MZ8 A;  1IMP A;  5KP7 B;  1NQ4 A;  4U0B A;  2CG5 B;  2ROQ A;  2AFE A;  4H2X C;  5F2K A;  4GR6 A;  2KG8 A;  1ZNV A;  1EMV A;  1A43 A;  4BPH A;  1KC8 Q;  2N5H A;  1W2B O;  1DNY A;  3H0D A;  2QEX P;  4U0E A;  3CCJ P;  2CGQ A;  1FR2 A;  2K5X A;  4QNB A;  5BS1 A;  1VQ6 P;  2FAE A;  2KOP A;  2VLO A;  2Z44 A;  1GXG A;  3GJN A;  1EIA A;  2PNG A;  2OTL P;  3G26 A;  4M0I A;  2EHS A;  5KP6 B;  1EOQ A;  2BUO A;  3CD6 P;  1GPJ A;  2AFD A;  3G0V A;  4U0A A;  1AYI A;  4H2Y C;  1N8R Q;  5I4T G;  3DS0 A;  1VHN A;  1VQ7 P;  4UHP B;  2PEO A;  3CC4 P;  1YJ9 P;  2JBG A;  3CME P;  2KOR A;  2FQ0 A;  3G1G A;  2PEN A;  5HVC A;  2EHT A;  4COC A;  3G4S P;  4F37 A;  2K92 A;  3HYB A;  1VQ9 P;  1M74 A;  2M8L A;  5EW5 E;  2MD9 A;  2VLP A;  1VKU A;  4DG9 A;  3WBH A;  2GZG A;  1KLP A;  2N50 A;  1M90 Q;  2LML A;  2N5I A;  2E1M A;  1AF8 A;  1YI2 P;  2FVF A;  2JU2 A;  2FVA A;  1YJW P;  3GKL C;  2L22 A;  4HKG A;  2XZ0 D;  1Q7Y Q;  4COP A;  3G71 P;  2JB0 A;  4XRO A;  2CQ8 A;  5F2O A;  3OW2 O;  2GDW A;  2L0Q A;  2N6Z A;  2PEJ A;  1E6J P;  4R0M A;  2KOO A;  2N98 A;  1QRJ A;  1K8A Q;  1IUQ A;  2GDY A;  3B5I A;  1M6E X;  2XV6 A;  4BPG A;  3NY7 B;  2FAC A;  2VLN A;  3EJD A;  1AUM A;  1VQK P;  5HGO A;  7CEI A;  4IZ6 A;  3G6E P;  3LMO A;  1ACP A;  4XFZ A;  2DGY A;  2GYK A;  2KGE A;  3CCQ P;  2LIU A;  1X3O A;  2PEQ A;  3DS4 A;  2MR8 A;  3I55 P;  1F80 D;  1ZMB A;  1Q82 Q;  1L0I A;  3CCV P;  1HQB A;  2LOL A;  2AF8 A;  2FAD A;  3RG6 C;  2KG6 A;  3B4Q A;  2VLQ A;  1YJN P;  2KW2 A;  4PWV B;  2ERH A;  3DTJ A;  2EFJ A;  5DCK A; 
#chains in the Genus database with same CATH homology
 2KGA A;  2MR7 A;  2FQ1 A;  1T8K A;  2MF4 A;  2MD9 A;  4CA3 A;  2KGC A;  2QNW A;  1VKU A;  4DG9 A;  2KOS A;  1KLP A;  2N50 A;  2LPK A;  2DNW A;  2K93 A;  2LML A;  2N5I A;  2JU1 A;  5EJD A;  5CZD B;  2K0Y A;  2X2B A;  2FHS C;  5KP7 B;  1NQ4 A;  1AF8 A;  1L0H A;  2FVF A;  2CG5 B;  2ROQ A;  2JU2 A;  2FVA A;  2AFE A;  2MVU A;  2L22 A;  4HKG A;  4PXH B;  2XZ0 D;  2KOQ A;  2KR5 A;  2VSQ A;  4H2X C;  2M5R A;  2CQ8 A;  2KG8 A;  4MRT C;  2GDW A;  2KG9 A;  2L0Q A;  2N6Z A;  3CE7 A;  4BPH A;  2K0X A;  4R0M A;  2CNR A;  2KOO A;  2FVE A;  2N5H A;  2N98 A;  2LIW A;  2GDY A;  1DNY A;  2AVA A;  4BPG A;  4NEO A;  2K2Q A;  1DV5 A;  3NY7 B;  2FAC A;  2JQ4 A;  3EJD A;  3EJB A;  2CGQ A;  2FAE A;  4IZ6 A;  2GDX A;  2KOP A;  5HV8 A;  1HY8 A;  2FQ2 A;  4H2W C;  2PNG A;  2EHS A;  2L4B A;  3LMO A;  5KP6 B;  2AFD A;  1ACP A;  4BPF A;  2KGE A;  2LIU A;  5KP8 B;  1X3O A;  3GZM A;  2MR8 A;  4H2Y C;  2MY5 A;  1F80 D;  2K94 A;  3EJE A;  2KWL A;  2JGP A;  1L0I A;  3RG2 A;  1HQB A;  2LOL A;  2AF8 A;  2KOR A;  2FQ0 A;  5HVC A;  2EHT A;  2XZ1 C;  2FAD A;  2KG6 A;  2LTE A;  2N6Y A;  2KW2 A;  2LKI A;  3GZL A;  4PWV B;  1OR5 A;  2K92 A;  2KGD A;  2LL8 A;  2L9F A;  2MVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...