1DNYA

Solution structure of pcp, a prototype for the peptidyl carrier domains of modular peptide synthetases
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
YVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of PCP, a prototype for the peptidyl carrier domains of modular peptide synthetases.
pubmed doi rcsb
source organism Brevibacillus brevis
molecule tags Ligase
molecule keywords NON-RIBOSOMAL PEPTIDE SYNTHETASE PEPTIDYL CARRIER PROTEIN
total genus 19
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1dnyA00
3EJEA 2LIUA 2M5RA 2N6YA 4H2XC 2CNRA 1F80D 2FQ2A 2KOOA 4PXHB 2JGPA 2EHSA 2K92A 2FVFA 2MVVA 4MRTC 2JU1A 2MVUA 2L22A 2L4BA 2KORA 2K2QA 4DG9A 2CGQA 2LKIA 2FVAA 2CQ8A 2KWLA 2KW2A 2KGEA 2QNWA 2JU2A 1OR5A 1DV5A 2N6ZA 2N98A 3NY7B 2AVAA 2XZ1C 2VSQA 2K94A 1VKUA 1KLPA 2MD9A 1NQ4A 4BPFA 2MR8A 1X3OA 2DNWA 2KGCA 2KR5A 4IZ6A 2FQ0A 1HQBA 2JQ4A 2X2BA 4BPHA 2KG8A 2N50A 2AFDA 3LMOA 5KP6B 1L0HA 2KGAA 2LL8A 5EJDA 4H2YC 2L0QA 1AF8A 2EHTA 2FHSC 2CG5B 4HKGA 2LIWA 2ROQA 4BPGA 2LOLA 2FAEA 1L0IA 2LMLA 2FQ1A 4NEOA 2N5IA 4PWVB 2KOPA 2K0YA 2XZ0D 4CA3A 2PNGA 2L9FA 2FADA 3RG2A 2N5HA 2FACA 2LPKA 3CE7A 1DNYA 2AFEA 4R0MA 2GDXA 2KG9A 4H2WC 2MY5A 2K0XA 3GZMA 1ACPA 2MR7A 5HV8A 5KP8B 2GDYA 2K93A 3EJDA 2AF8A 3GZLA 5KP7B 5CZDB 2KG6A 3EJBA 2LTEA 1T8KA 2MF4A 2KOSA 5HVCA 2FVEA 2KOQA 1HY8A 2GDWA 2KGDA
chains in the Genus database with same CATH superfamily
3WBHA 2M5RA 2N6YA 1F80D 2EG5A 4PXHB 3CC2P 2JGPA 2K92A 4MRTC 4GR2A 3DS2A 3M1MA 1ZNVA 1Q7YQ 1Q82Q 1JJ2O 2L4BA 5DCKA 2JO0A 5HGLA 1KC8Q 5F2NA 2OARA 2KGEA 2QNWA 1OR5A 4U0CA 3HYBA 7CEIA 2AVAA 4U0BA 2VSQA 2K94A 3LRYA 1KLPA 2OTLP 2MD9A 1NQ4A 4BPFA 1RO0A 1HQBA 3P05A 4BPHA 2ERHA 2AFDA 1AUMA 5KP6B 2LL8A 2L6EA 5EJDA 4H2YC 5F2KA 2PENA 1AF8A 1IMPA 2LF4A 2CG5B 4HKGA 1K9MQ 3CCQP 1L0IA 2LMLA 2FQ1A 3GKLC 4NEOA 2N5IA 2K0YA 2XZ0D 1KQSO 2N5HA 3VRLC 1A43A 1FR2A 3G21A 3G6EP 3CE7A 1YHQP 2CWOA 2KG9A 2GYKA 3GZMA 5HV8A 1N8RQ 3EJDA 3GZLA 5KP7B 2KG6A 2XXMA 2FVEA 2ONTA 2QEXP 2KOQA 2GDWA 3G0VA 1VQ4P 2M8NA 1S72P 1GXHA 1Q86Q 1QVGO 2PEQA 4IPYA 2FVFA 2K5XA 2MVUA 2OTJP 2L22A 1QVFO 2VLNA 2KORA 1UJZA 2LKIA 1IMQA 4XRQA 3CCRP 1YJWP 1DV5A 2DGYA 2GZEA 1MZ8A 1VQMP 1NJIQ 3B4QA 1X3OA 2KGCA 3CCEP 2JQ4A 2N50A 4XFXA 3G26A 1VQLP 2JYGA 1EOQA 1Q81Q 2EHTA 3CMAP 1RNIA 2JYLA 2GZGA 2ROQA 4BPGA 5HGNA 3G71P 4PWVB 5HGOA 1VQKP 1RO2A 1BAJA 1ZMBA 4U0DA 2FADA 1IUQA 2LPKA 1YIJP 3H4EA 4R0MA 2Z46A 1M90Q 3CC4P 4H2WC 2K0XA 1ACPA 2MR7A 3G1IA 2K93A 1BXIA 4GR6A 1VQ7P 1VQOP 2GZFA 3CCUP 3E2DA 2KGDA 3EJEA 3HZQA 3DS0A 1AYIA 4COCA 1GPJA 2PEMA 4H2XC 4XFZA 2FQ2A 2KOOA 1K73Q 2EHSA 2MVVA 3G4SP 4QKOA 1VQ9P 3CCMP 2FVAA 3RG6C 1M6EX 2KWLA 2JU2A 1EMVA 3NY7B 4U0AA 4PH0A 1VKUA 2Z45A 2MR8A 2DNWA 3H47A 4U0FA 2X2BA 1M74A 1L0HA 2Z44A 2FHSC 2PEKA 2WPTA 4XFYA 2PY8A 1GXGA 2LOLA 3U43A 1YITP 2XT1A 2P9XA 2VLOA 5EW5E 3CD6P 1VQ5P 4UHPB 1EIAA 4COPA 1KD1Q 2PEOA 5HGMA 3RG2A 3CCVP 1A8OA 2FACA 2AFEA 1D1DA 1K8AQ 1QRJA 3CC7P 1VQ6P 2M8LA 3CCSP 3CCLP 5CZDB 3DS3A 2LTEA 3EJBA 3B5IA 5HVCA 1E6JP 1YJNP 2VLPA 1HY8A 2XV6A 3I56P 1YJ9P 2LIUA 2CNRA 2JB0A 2PEJA 3G28A 2JU1A 1VHNA 3CMEP 4DG9A 2K2QA 3I55P 2CGQA 3GJNA 4PH1A 3OW2O 3CXCO 2EFJA 2CQ8A 4QNBA 2KW2A 2GZJA 2N6ZA 2N98A 2KODA 1M1KQ 2GZIA 1YI2P 2XZ1C 1M6NA 3Q20A 3DS5A 3G29A 3DS4A 3NTEA 3G1GA 2KR5A 1K30A 4IZ6A 2FQ0A 2JBGA 2KG8A 3LMOA 2KGAA 2L0QA 4F37A 4U0EA 1UNKA 5BS1A 3H0DA 2LIWA 2K0DX 1E0HA 2NO8A 2FAEA 1W2BO 4M0IA 1Z6MA 2QA4P 2PEIA 2KOPA 3DTJA 4CA3A 2M8PA 2PNGA 4XROA 2L9FA 4WYMA 1CEIA 2EIAA 1VQNP 3MGEA 3CPWO 1DNYA 2BUOA 2VLQA 5BS2A 2GDXA 2MY5A 2E1MA 3DS1A 3CCJP 1VQPP 5KP8B 2GDYA 2AF8A 3DPHA 5I4TG 1T8KA 2MF4A 2KOSA 5JPAA 1VQ8P 2JAZA 2BHVA 5F2OA
chains in the Genus database with same CATH topology
3EJEA 2LIUA 2M5RA 2N6YA 4H2XC 2CNRA 1F80D 2FQ2A 2KOOA 4PXHB 2JGPA 2EHSA 2K92A 2FVFA 2MVVA 4MRTC 2JU1A 2MVUA 2L22A 2L4BA 2KORA 2K2QA 4DG9A 2CGQA 2LKIA 2FVAA 2CQ8A 2KWLA 2KW2A 2KGEA 2QNWA 2JU2A 1OR5A 1DV5A 2N6ZA 2N98A 3NY7B 2AVAA 2XZ1C 2VSQA 2K94A 1VKUA 1KLPA 2MD9A 1NQ4A 4BPFA 2MR8A 1X3OA 2DNWA 2KGCA 2KR5A 4IZ6A 2FQ0A 1HQBA 2JQ4A 2X2BA 4BPHA 2KG8A 2N50A 2AFDA 3LMOA 5KP6B 1L0HA 2KGAA 2LL8A 5EJDA 4H2YC 2L0QA 1AF8A 2EHTA 2FHSC 2CG5B 4HKGA 2LIWA 2ROQA 4BPGA 2LOLA 2FAEA 1L0IA 2LMLA 2FQ1A 4NEOA 2N5IA 4PWVB 2KOPA 2K0YA 2XZ0D 4CA3A 2PNGA 2L9FA 2FADA 3RG2A 2N5HA 2FACA 2LPKA 3CE7A 1DNYA 2AFEA 4R0MA 2GDXA 2KG9A 4H2WC 2MY5A 2K0XA 3GZMA 1ACPA 2MR7A 5HV8A 5KP8B 2GDYA 2K93A 3EJDA 2AF8A 3GZLA 5KP7B 5CZDB 2KG6A 3EJBA 2LTEA 1T8KA 2MF4A 2KOSA 5HVCA 2FVEA 2KOQA 1HY8A 2GDWA 2KGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJE A;  2LIU A;  2M5R A;  2N6Y A;  4H2X C;  2CNR A;  1F80 D;  2FQ2 A;  2KOO A;  4PXH B;  2JGP A;  2EHS A;  2K92 A;  2FVF A;  2MVV A;  4MRT C;  2JU1 A;  2MVU A;  2L22 A;  2L4B A;  2KOR A;  2K2Q A;  4DG9 A;  2CGQ A;  2LKI A;  2FVA A;  2CQ8 A;  2KWL A;  2KW2 A;  2KGE A;  2QNW A;  2JU2 A;  1OR5 A;  1DV5 A;  2N6Z A;  2N98 A;  3NY7 B;  2AVA A;  2XZ1 C;  2VSQ A;  2K94 A;  1VKU A;  1KLP A;  2MD9 A;  1NQ4 A;  4BPF A;  2MR8 A;  1X3O A;  2DNW A;  2KGC A;  2KR5 A;  4IZ6 A;  2FQ0 A;  1HQB A;  2JQ4 A;  2X2B A;  4BPH A;  2KG8 A;  2N50 A;  2AFD A;  3LMO A;  5KP6 B;  1L0H A;  2KGA A;  2LL8 A;  5EJD A;  4H2Y C;  2L0Q A;  1AF8 A;  2EHT A;  2FHS C;  2CG5 B;  4HKG A;  2LIW A;  2ROQ A;  4BPG A;  2LOL A;  2FAE A;  1L0I A;  2LML A;  2FQ1 A;  4NEO A;  2N5I A;  4PWV B;  2KOP A;  2K0Y A;  2XZ0 D;  4CA3 A;  2PNG A;  2L9F A;  2FAD A;  3RG2 A;  2N5H A;  2FAC A;  2LPK A;  3CE7 A;  1DNY A;  2AFE A;  4R0M A;  2GDX A;  2KG9 A;  4H2W C;  2MY5 A;  2K0X A;  3GZM A;  1ACP A;  2MR7 A;  5HV8 A;  5KP8 B;  2GDY A;  2K93 A;  3EJD A;  2AF8 A;  3GZL A;  5KP7 B;  5CZD B;  2KG6 A;  3EJB A;  2LTE A;  1T8K A;  2MF4 A;  2KOS A;  5HVC A;  2FVE A;  2KOQ A;  1HY8 A;  2GDW A;  2KGD A; 
#chains in the Genus database with same CATH topology
 3WBH A;  2M5R A;  2N6Y A;  1F80 D;  2EG5 A;  4PXH B;  3CC2 P;  2JGP A;  2K92 A;  4MRT C;  4GR2 A;  3DS2 A;  3M1M A;  1ZNV A;  1Q7Y Q;  1Q82 Q;  1JJ2 O;  2L4B A;  5DCK A;  2JO0 A;  5HGL A;  1KC8 Q;  5F2N A;  2OAR A;  2KGE A;  2QNW A;  1OR5 A;  4U0C A;  3HYB A;  7CEI A;  2AVA A;  4U0B A;  2VSQ A;  2K94 A;  3LRY A;  1KLP A;  2OTL P;  2MD9 A;  1NQ4 A;  4BPF A;  1RO0 A;  1HQB A;  3P05 A;  4BPH A;  2ERH A;  2AFD A;  1AUM A;  5KP6 B;  2LL8 A;  2L6E A;  5EJD A;  4H2Y C;  5F2K A;  2PEN A;  1AF8 A;  1IMP A;  2LF4 A;  2CG5 B;  4HKG A;  1K9M Q;  3CCQ P;  1L0I A;  2LML A;  2FQ1 A;  3GKL C;  4NEO A;  2N5I A;  2K0Y A;  2XZ0 D;  1KQS O;  2N5H A;  3VRL C;  1A43 A;  1FR2 A;  3G21 A;  3G6E P;  3CE7 A;  1YHQ P;  2CWO A;  2KG9 A;  2GYK A;  3GZM A;  5HV8 A;  1N8R Q;  3EJD A;  3GZL A;  5KP7 B;  2KG6 A;  2XXM A;  2FVE A;  2ONT A;  2QEX P;  2KOQ A;  2GDW A;  3G0V A;  1VQ4 P;  2M8N A;  1S72 P;  1GXH A;  1Q86 Q;  1QVG O;  2PEQ A;  4IPY A;  2FVF A;  2K5X A;  2MVU A;  2OTJ P;  2L22 A;  1QVF O;  2VLN A;  2KOR A;  1UJZ A;  2LKI A;  1IMQ A;  4XRQ A;  3CCR P;  1YJW P;  1DV5 A;  2DGY A;  2GZE A;  1MZ8 A;  1VQM P;  1NJI Q;  3B4Q A;  1X3O A;  2KGC A;  3CCE P;  2JQ4 A;  2N50 A;  4XFX A;  3G26 A;  1VQL P;  2JYG A;  1EOQ A;  1Q81 Q;  2EHT A;  3CMA P;  1RNI A;  2JYL A;  2GZG A;  2ROQ A;  4BPG A;  5HGN A;  3G71 P;  4PWV B;  5HGO A;  1VQK P;  1RO2 A;  1BAJ A;  1ZMB A;  4U0D A;  2FAD A;  1IUQ A;  2LPK A;  1YIJ P;  3H4E A;  4R0M A;  2Z46 A;  1M90 Q;  3CC4 P;  4H2W C;  2K0X A;  1ACP A;  2MR7 A;  3G1I A;  2K93 A;  1BXI A;  4GR6 A;  1VQ7 P;  1VQO P;  2GZF A;  3CCU P;  3E2D A;  2KGD A;  3EJE A;  3HZQ A;  3DS0 A;  1AYI A;  4COC A;  1GPJ A;  2PEM A;  4H2X C;  4XFZ A;  2FQ2 A;  2KOO A;  1K73 Q;  2EHS A;  2MVV A;  3G4S P;  4QKO A;  1VQ9 P;  3CCM P;  2FVA A;  3RG6 C;  1M6E X;  2KWL A;  2JU2 A;  1EMV A;  3NY7 B;  4U0A A;  4PH0 A;  1VKU A;  2Z45 A;  2MR8 A;  2DNW A;  3H47 A;  4U0F A;  2X2B A;  1M74 A;  1L0H A;  2Z44 A;  2FHS C;  2PEK A;  2WPT A;  4XFY A;  2PY8 A;  1GXG A;  2LOL A;  3U43 A;  1YIT P;  2XT1 A;  2P9X A;  2VLO A;  5EW5 E;  3CD6 P;  1VQ5 P;  4UHP B;  1EIA A;  4COP A;  1KD1 Q;  2PEO A;  5HGM A;  3RG2 A;  3CCV P;  1A8O A;  2FAC A;  2AFE A;  1D1D A;  1K8A Q;  1QRJ A;  3CC7 P;  1VQ6 P;  2M8L A;  3CCS P;  3CCL P;  5CZD B;  3DS3 A;  2LTE A;  3EJB A;  3B5I A;  5HVC A;  1E6J P;  1YJN P;  2VLP A;  1HY8 A;  2XV6 A;  3I56 P;  1YJ9 P;  2LIU A;  2CNR A;  2JB0 A;  2PEJ A;  3G28 A;  2JU1 A;  1VHN A;  3CME P;  4DG9 A;  2K2Q A;  3I55 P;  2CGQ A;  3GJN A;  4PH1 A;  3OW2 O;  3CXC O;  2EFJ A;  2CQ8 A;  4QNB A;  2KW2 A;  2GZJ A;  2N6Z A;  2N98 A;  2KOD A;  1M1K Q;  2GZI A;  1YI2 P;  2XZ1 C;  1M6N A;  3Q20 A;  3DS5 A;  3G29 A;  3DS4 A;  3NTE A;  3G1G A;  2KR5 A;  1K30 A;  4IZ6 A;  2FQ0 A;  2JBG A;  2KG8 A;  3LMO A;  2KGA A;  2L0Q A;  4F37 A;  4U0E A;  1UNK A;  5BS1 A;  3H0D A;  2LIW A;  2K0D X;  1E0H A;  2NO8 A;  2FAE A;  1W2B O;  4M0I A;  1Z6M A;  2QA4 P;  2PEI A;  2KOP A;  3DTJ A;  4CA3 A;  2M8P A;  2PNG A;  4XRO A;  2L9F A;  4WYM A;  1CEI A;  2EIA A;  1VQN P;  3MGE A;  3CPW O;  1DNY A;  2BUO A;  2VLQ A;  5BS2 A;  2GDX A;  2MY5 A;  2E1M A;  3DS1 A;  3CCJ P;  1VQP P;  5KP8 B;  2GDY A;  2AF8 A;  3DPH A;  5I4T G;  1T8K A;  2MF4 A;  2KOS A;  5JPA A;  1VQ8 P;  2JAZ A;  2BHV A;  5F2O A; 
#chains in the Genus database with same CATH homology
 3EJE A;  2LIU A;  2M5R A;  2N6Y A;  4H2X C;  2CNR A;  1F80 D;  2FQ2 A;  2KOO A;  4PXH B;  2JGP A;  2EHS A;  2K92 A;  2FVF A;  2MVV A;  4MRT C;  2JU1 A;  2MVU A;  2L22 A;  2L4B A;  2KOR A;  2K2Q A;  4DG9 A;  2CGQ A;  2LKI A;  2FVA A;  2CQ8 A;  2KWL A;  2KW2 A;  2KGE A;  2QNW A;  2JU2 A;  1OR5 A;  1DV5 A;  2N6Z A;  2N98 A;  3NY7 B;  2AVA A;  2XZ1 C;  2VSQ A;  2K94 A;  1VKU A;  1KLP A;  2MD9 A;  1NQ4 A;  4BPF A;  2MR8 A;  1X3O A;  2DNW A;  2KGC A;  2KR5 A;  4IZ6 A;  2FQ0 A;  1HQB A;  2JQ4 A;  2X2B A;  4BPH A;  2KG8 A;  2N50 A;  2AFD A;  3LMO A;  5KP6 B;  1L0H A;  2KGA A;  2LL8 A;  5EJD A;  4H2Y C;  2L0Q A;  1AF8 A;  2EHT A;  2FHS C;  2CG5 B;  4HKG A;  2LIW A;  2ROQ A;  4BPG A;  2LOL A;  2FAE A;  1L0I A;  2LML A;  2FQ1 A;  4NEO A;  2N5I A;  4PWV B;  2KOP A;  2K0Y A;  2XZ0 D;  4CA3 A;  2PNG A;  2L9F A;  2FAD A;  3RG2 A;  2N5H A;  2FAC A;  2LPK A;  3CE7 A;  1DNY A;  2AFE A;  4R0M A;  2GDX A;  2KG9 A;  4H2W C;  2MY5 A;  2K0X A;  3GZM A;  1ACP A;  2MR7 A;  5HV8 A;  5KP8 B;  2GDY A;  2K93 A;  3EJD A;  2AF8 A;  3GZL A;  5KP7 B;  5CZD B;  2KG6 A;  3EJB A;  2LTE A;  1T8K A;  2MF4 A;  2KOS A;  5HVC A;  2FVE A;  2KOQ A;  1HY8 A;  2GDW A;  2KGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...