1DNYA

Solution structure of pcp, a prototype for the peptidyl carrier domains of modular peptide synthetases
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
76
structure length
76
Chain Sequence
YVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords NON-RIBOSOMAL PEPTIDE SYNTHETASE PEPTIDYL CARRIER PROTEIN
publication title Solution structure of PCP, a prototype for the peptidyl carrier domains of modular peptide synthetases.
pubmed doi rcsb
source organism Brevibacillus brevis
total genus 19
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 1999-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 1dnyA00
2FVFA 2LL8A 2XZ1C 3GZLA 2AFDA 1L0HA 2LPKA 2KGCA 2GDWA 4MRTC 4PWVB 2CNRA 1NQ4A 2VSQA 1T8KA 1KLPA 2XZ0D 2CG5B 2EHSA 2KORA 2L0QA 3NY7B 2GDXA 2K2QA 2MF4A 2LKIA 2KOOA 4IZ6A 2K93A 3LMOA 4PXHB 2MR7A 2KW2A 2K0XA 2N50A 2L22A 2K0YA 5KP8B 4H2YC 4NEOA 5EJDA 2MR8A 2KGEA 1OR5A 2LMLA 5CZDB 2KG9A 2QNWA 2KG8A 2LTEA 3EJBA 2FQ1A 2LOLA 2JGPA 2CQ8A 3CE7A 4CA3A 2EHTA 1ACPA 2AVAA 4H2XC 1HQBA 2LIUA 2X2BA 2FVAA 4H2WC 5HVCA 2KOQA 2KOPA 2ROQA 2FVEA 2FADA 1AF8A 4HKGA 1F80D 2JU2A 2KGAA 2FHSC 1VKUA 4BPFA 2FACA 3EJDA 2N6ZA 1HY8A 5HV8A 4DG9A 2KGDA 2MVVA 2MD9A 2FQ0A 2KWLA 4BPHA 3EJEA 1X3OA 2N98A 2MVUA 4R0MA 1DNYA 2KG6A 2N5HA 2PNGA 2AF8A 2LIWA 2N6YA 3RG2A 1L0IA 5KP6B 2L4BA 1DV5A 2N5IA 2AFEA 2M5RA 2KOSA 2KR5A 2L9FA 5KP7B 2K94A 2GDYA 3GZMA 2CGQA 4BPGA 2MY5A 2FAEA 2DNWA 2K92A 2JQ4A 2FQ2A 2JU1A
chains in the Genus database with same CATH superfamily
1VQNP 3CCMP 1L0HA 3CPWO 4COPA 1VQ7P 1BAJA 2KGCA 2GDWA 3G28A 5BS1A 1VQMP 1KD1Q 1EMVA 1W2BO 2JYLA 2L22A 2Z44A 5EJDA 5HGOA 4QNBA 2GYKA 2LMLA 5CZDB 2KG9A 5F2NA 3DS4A 2EG5A 4U0DA 1RNIA 1IMQA 2FQ1A 2GZEA 2JGPA 1IUQA 4CA3A 3P05A 1ACPA 4H2XC 1HQBA 5HVCA 1VQKP 2FVEA 1E0HA 1M6NA 1Q86Q 1F80D 1A8OA 1YHQP 2FACA 1ZMBA 3DS3A 1VQ6P 1HY8A 5HGLA 1M1KQ 5HV8A 2KGDA 2ONTA 2MD9A 4IPYA 2K0DX 2M8PA 4BPHA 4XRQA 1JJ2O 2DGYA 1YITP 1QVFO 2MVUA 3CMAP 2Z46A 2N5HA 3G1GA 4COCA 2QA4P 2OARA 2N6YA 4U0BA 5HGMA 1N8RQ 1Q7YQ 1VQ8P 4GR2A 2XXMA 1VQ5P 2JYGA 2PENA 2JQ4A 1AYIA 2FQ2A 1VHNA 2GZGA 2AFDA 1Q81Q 4QKOA 1NQ4A 2VSQA 4PH1A 2GZJA 2PEQA 5F2OA 2CG5B 5BS2A 3CXCO 2KORA 1K30A 3G29A 4WYMA 2L0QA 2KOOA 5I4TG 1AUMA 2K93A 2MR7A 2KW2A 1BXIA 2K0XA 2K0YA 4H2YC 3DS5A 1RO0A 1OR5A 2VLQA 4PH0A 2KG8A 3H0DA 3H47A 3CCUP 4U0FA 2AVAA 1GXGA 3VRLC 3CC2P 4H2WC 2KOPA 3MGEA 2ROQA 1GXHA 4HKGA 2BUOA 3CCJP 3EJDA 1EOQA 1QRJA 2PEOA 3G6EP 2N6ZA 3G4SP 1YJWP 1KC8Q 3CC4P 2FQ0A 1D1DA 1VQ4P 2NO8A 1YI2P 1YJNP 1X3OA 2PY8A 4R0MA 3HZQA 1VQ9P 2AF8A 5HGNA 1MZ8A 2WPTA 1DV5A 2L4BA 1GPJA 1M74A 2M5RA 3CMEP 2M8NA 2K94A 1VQOP 3DTJA 3DS2A 3GZMA 4U0EA 2MY5A 3M1MA 2EFJA 2PEKA 2FVFA 2LL8A 4U0CA 3DS0A 2LPKA 2PEIA 3H4EA 4MRTC 2CNRA 1T8KA 1KLPA 1NJIQ 2XZ0D 2EHSA 4GR6A 1A43A 2GZIA 3NY7B 2GDXA 2K2QA 4XFXA 2MF4A 4PXHB 3LMOA 2N50A 4NEOA 3CCLP 4F37A 1QVGO 3CCVP 3I55P 2JBGA 3EJBA 2CQ8A 1CEIA 2EHTA 3B4QA 1M90Q 2JAZA 4U0AA 1YJ9P 2LF4A 3G1IA 2Z45A 1AF8A 2JU2A 2FHSC 5DCKA 1VKUA 4BPFA 1K9MQ 2JB0A 3WBHA 3CCSP 1M6EX 3Q20A 3CD6P 3DS1A 1UNKA 4DG9A 2KWLA 1Q82Q 3EJEA 2XT1A 2M8LA 2N98A 2KG6A 2PNGA 2PEJA 2VLPA 1UJZA 5EW5E 3U43A 2N5IA 2AFEA 3CC7P 2KOSA 2KR5A 3G26A 5KP7B 3E2DA 2GDYA 4BPGA 3LRYA 3G71P 3G21A 3HYBA 1E6JP 2K92A 2KODA 2ERHA 2XZ1C 3GZLA 3G0VA 3I56P 2GZFA 5F2KA 1YIJP 2PEMA 4PWVB 2OTJP 1S72P 4XFYA 3CCEP 1EIAA 2LKIA 4XFZA 4IZ6A 3GJNA 5KP8B 2MR8A 2KGEA 2VLOA 2QNWA 2E1MA 7CEIA 1Z6MA 2LTEA 1IMPA 3DPHA 2LOLA 1FR2A 1K73Q 1ZNVA 3CE7A 2L6EA 2LIUA 2X2BA 2FVAA 2OTLP 2KOQA 3OW2O 3B5IA 2FADA 1RO2A 2KGAA 5JPAA 1K8AQ 2K5XA 3CCRP 2CWOA 2MVVA 2VLNA 2XV6A 3GKLC 4M0IA 2QEXP 1DNYA 2EIAA 1VQLP 2LIWA 2P9XA 1KQSO 4UHPB 3RG2A 1L0IA 5KP6B 2BHVA 4XROA 3CCQP 2L9FA 2CGQA 3RG6C 1VQPP 3NTEA 2FAEA 2DNWA 2JO0A 2JU1A
chains in the Genus database with same CATH topology
2FVFA 2LL8A 2XZ1C 3GZLA 2AFDA 1L0HA 2LPKA 2KGCA 2GDWA 4MRTC 4PWVB 2CNRA 1NQ4A 2VSQA 1T8KA 1KLPA 2XZ0D 2CG5B 2EHSA 2KORA 2L0QA 3NY7B 2GDXA 2K2QA 2MF4A 2LKIA 2KOOA 4IZ6A 2K93A 3LMOA 4PXHB 2MR7A 2KW2A 2K0XA 2N50A 2L22A 2K0YA 5KP8B 4H2YC 4NEOA 5EJDA 2MR8A 2KGEA 1OR5A 2LMLA 5CZDB 2KG9A 2QNWA 2KG8A 2LTEA 3EJBA 2FQ1A 2LOLA 2JGPA 2CQ8A 3CE7A 4CA3A 2EHTA 1ACPA 2AVAA 4H2XC 1HQBA 2LIUA 2X2BA 2FVAA 4H2WC 5HVCA 2KOQA 2KOPA 2ROQA 2FVEA 2FADA 1AF8A 4HKGA 1F80D 2JU2A 2KGAA 2FHSC 1VKUA 4BPFA 2FACA 3EJDA 2N6ZA 1HY8A 5HV8A 4DG9A 2KGDA 2MVVA 2MD9A 2FQ0A 2KWLA 4BPHA 3EJEA 1X3OA 2N98A 2MVUA 4R0MA 1DNYA 2KG6A 2N5HA 2PNGA 2AF8A 2LIWA 2N6YA 3RG2A 1L0IA 5KP6B 2L4BA 1DV5A 2N5IA 2AFEA 2M5RA 2KOSA 2KR5A 2L9FA 5KP7B 2K94A 2GDYA 3GZMA 2CGQA 4BPGA 2MY5A 2FAEA 2DNWA 2K92A 2JQ4A 2FQ2A 2JU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FVF A;  2LL8 A;  2XZ1 C;  3GZL A;  2AFD A;  1L0H A;  2LPK A;  2KGC A;  2GDW A;  4MRT C;  4PWV B;  2CNR A;  1NQ4 A;  2VSQ A;  1T8K A;  1KLP A;  2XZ0 D;  2CG5 B;  2EHS A;  2KOR A;  2L0Q A;  3NY7 B;  2GDX A;  2K2Q A;  2MF4 A;  2LKI A;  2KOO A;  4IZ6 A;  2K93 A;  3LMO A;  4PXH B;  2MR7 A;  2KW2 A;  2K0X A;  2N50 A;  2L22 A;  2K0Y A;  5KP8 B;  4H2Y C;  4NEO A;  5EJD A;  2MR8 A;  2KGE A;  1OR5 A;  2LML A;  5CZD B;  2KG9 A;  2QNW A;  2KG8 A;  2LTE A;  3EJB A;  2FQ1 A;  2LOL A;  2JGP A;  2CQ8 A;  3CE7 A;  4CA3 A;  2EHT A;  1ACP A;  2AVA A;  4H2X C;  1HQB A;  2LIU A;  2X2B A;  2FVA A;  4H2W C;  5HVC A;  2KOQ A;  2KOP A;  2ROQ A;  2FVE A;  2FAD A;  1AF8 A;  4HKG A;  1F80 D;  2JU2 A;  2KGA A;  2FHS C;  1VKU A;  4BPF A;  2FAC A;  3EJD A;  2N6Z A;  1HY8 A;  5HV8 A;  4DG9 A;  2KGD A;  2MVV A;  2MD9 A;  2FQ0 A;  2KWL A;  4BPH A;  3EJE A;  1X3O A;  2N98 A;  2MVU A;  4R0M A;  1DNY A;  2KG6 A;  2N5H A;  2PNG A;  2AF8 A;  2LIW A;  2N6Y A;  3RG2 A;  1L0I A;  5KP6 B;  2L4B A;  1DV5 A;  2N5I A;  2AFE A;  2M5R A;  2KOS A;  2KR5 A;  2L9F A;  5KP7 B;  2K94 A;  2GDY A;  3GZM A;  2CGQ A;  4BPG A;  2MY5 A;  2FAE A;  2DNW A;  2K92 A;  2JQ4 A;  2FQ2 A;  2JU1 A; 
#chains in the Genus database with same CATH topology
 1VQN P;  3CCM P;  1L0H A;  3CPW O;  4COP A;  1VQ7 P;  1BAJ A;  2KGC A;  2GDW A;  3G28 A;  5BS1 A;  1VQM P;  1KD1 Q;  1EMV A;  1W2B O;  2JYL A;  2L22 A;  2Z44 A;  5EJD A;  5HGO A;  4QNB A;  2GYK A;  2LML A;  5CZD B;  2KG9 A;  5F2N A;  3DS4 A;  2EG5 A;  4U0D A;  1RNI A;  1IMQ A;  2FQ1 A;  2GZE A;  2JGP A;  1IUQ A;  4CA3 A;  3P05 A;  1ACP A;  4H2X C;  1HQB A;  5HVC A;  1VQK P;  2FVE A;  1E0H A;  1M6N A;  1Q86 Q;  1F80 D;  1A8O A;  1YHQ P;  2FAC A;  1ZMB A;  3DS3 A;  1VQ6 P;  1HY8 A;  5HGL A;  1M1K Q;  5HV8 A;  2KGD A;  2ONT A;  2MD9 A;  4IPY A;  2K0D X;  2M8P A;  4BPH A;  4XRQ A;  1JJ2 O;  2DGY A;  1YIT P;  1QVF O;  2MVU A;  3CMA P;  2Z46 A;  2N5H A;  3G1G A;  4COC A;  2QA4 P;  2OAR A;  2N6Y A;  4U0B A;  5HGM A;  1N8R Q;  1Q7Y Q;  1VQ8 P;  4GR2 A;  2XXM A;  1VQ5 P;  2JYG A;  2PEN A;  2JQ4 A;  1AYI A;  2FQ2 A;  1VHN A;  2GZG A;  2AFD A;  1Q81 Q;  4QKO A;  1NQ4 A;  2VSQ A;  4PH1 A;  2GZJ A;  2PEQ A;  5F2O A;  2CG5 B;  5BS2 A;  3CXC O;  2KOR A;  1K30 A;  3G29 A;  4WYM A;  2L0Q A;  2KOO A;  5I4T G;  1AUM A;  2K93 A;  2MR7 A;  2KW2 A;  1BXI A;  2K0X A;  2K0Y A;  4H2Y C;  3DS5 A;  1RO0 A;  1OR5 A;  2VLQ A;  4PH0 A;  2KG8 A;  3H0D A;  3H47 A;  3CCU P;  4U0F A;  2AVA A;  1GXG A;  3VRL C;  3CC2 P;  4H2W C;  2KOP A;  3MGE A;  2ROQ A;  1GXH A;  4HKG A;  2BUO A;  3CCJ P;  3EJD A;  1EOQ A;  1QRJ A;  2PEO A;  3G6E P;  2N6Z A;  3G4S P;  1YJW P;  1KC8 Q;  3CC4 P;  2FQ0 A;  1D1D A;  1VQ4 P;  2NO8 A;  1YI2 P;  1YJN P;  1X3O A;  2PY8 A;  4R0M A;  3HZQ A;  1VQ9 P;  2AF8 A;  5HGN A;  1MZ8 A;  2WPT A;  1DV5 A;  2L4B A;  1GPJ A;  1M74 A;  2M5R A;  3CME P;  2M8N A;  2K94 A;  1VQO P;  3DTJ A;  3DS2 A;  3GZM A;  4U0E A;  2MY5 A;  3M1M A;  2EFJ A;  2PEK A;  2FVF A;  2LL8 A;  4U0C A;  3DS0 A;  2LPK A;  2PEI A;  3H4E A;  4MRT C;  2CNR A;  1T8K A;  1KLP A;  1NJI Q;  2XZ0 D;  2EHS A;  4GR6 A;  1A43 A;  2GZI A;  3NY7 B;  2GDX A;  2K2Q A;  4XFX A;  2MF4 A;  4PXH B;  3LMO A;  2N50 A;  4NEO A;  3CCL P;  4F37 A;  1QVG O;  3CCV P;  3I55 P;  2JBG A;  3EJB A;  2CQ8 A;  1CEI A;  2EHT A;  3B4Q A;  1M90 Q;  2JAZ A;  4U0A A;  1YJ9 P;  2LF4 A;  3G1I A;  2Z45 A;  1AF8 A;  2JU2 A;  2FHS C;  5DCK A;  1VKU A;  4BPF A;  1K9M Q;  2JB0 A;  3WBH A;  3CCS P;  1M6E X;  3Q20 A;  3CD6 P;  3DS1 A;  1UNK A;  4DG9 A;  2KWL A;  1Q82 Q;  3EJE A;  2XT1 A;  2M8L A;  2N98 A;  2KG6 A;  2PNG A;  2PEJ A;  2VLP A;  1UJZ A;  5EW5 E;  3U43 A;  2N5I A;  2AFE A;  3CC7 P;  2KOS A;  2KR5 A;  3G26 A;  5KP7 B;  3E2D A;  2GDY A;  4BPG A;  3LRY A;  3G71 P;  3G21 A;  3HYB A;  1E6J P;  2K92 A;  2KOD A;  2ERH A;  2XZ1 C;  3GZL A;  3G0V A;  3I56 P;  2GZF A;  5F2K A;  1YIJ P;  2PEM A;  4PWV B;  2OTJ P;  1S72 P;  4XFY A;  3CCE P;  1EIA A;  2LKI A;  4XFZ A;  4IZ6 A;  3GJN A;  5KP8 B;  2MR8 A;  2KGE A;  2VLO A;  2QNW A;  2E1M A;  7CEI A;  1Z6M A;  2LTE A;  1IMP A;  3DPH A;  2LOL A;  1FR2 A;  1K73 Q;  1ZNV A;  3CE7 A;  2L6E A;  2LIU A;  2X2B A;  2FVA A;  2OTL P;  2KOQ A;  3OW2 O;  3B5I A;  2FAD A;  1RO2 A;  2KGA A;  5JPA A;  1K8A Q;  2K5X A;  3CCR P;  2CWO A;  2MVV A;  2VLN A;  2XV6 A;  3GKL C;  4M0I A;  2QEX P;  1DNY A;  2EIA A;  1VQL P;  2LIW A;  2P9X A;  1KQS O;  4UHP B;  3RG2 A;  1L0I A;  5KP6 B;  2BHV A;  4XRO A;  3CCQ P;  2L9F A;  2CGQ A;  3RG6 C;  1VQP P;  3NTE A;  2FAE A;  2DNW A;  2JO0 A;  2JU1 A; 
#chains in the Genus database with same CATH homology
 2FVF A;  2LL8 A;  2XZ1 C;  3GZL A;  2AFD A;  1L0H A;  2LPK A;  2KGC A;  2GDW A;  4MRT C;  4PWV B;  2CNR A;  1NQ4 A;  2VSQ A;  1T8K A;  1KLP A;  2XZ0 D;  2CG5 B;  2EHS A;  2KOR A;  2L0Q A;  3NY7 B;  2GDX A;  2K2Q A;  2MF4 A;  2LKI A;  2KOO A;  4IZ6 A;  2K93 A;  3LMO A;  4PXH B;  2MR7 A;  2KW2 A;  2K0X A;  2N50 A;  2L22 A;  2K0Y A;  5KP8 B;  4H2Y C;  4NEO A;  5EJD A;  2MR8 A;  2KGE A;  1OR5 A;  2LML A;  5CZD B;  2KG9 A;  2QNW A;  2KG8 A;  2LTE A;  3EJB A;  2FQ1 A;  2LOL A;  2JGP A;  2CQ8 A;  3CE7 A;  4CA3 A;  2EHT A;  1ACP A;  2AVA A;  4H2X C;  1HQB A;  2LIU A;  2X2B A;  2FVA A;  4H2W C;  5HVC A;  2KOQ A;  2KOP A;  2ROQ A;  2FVE A;  2FAD A;  1AF8 A;  4HKG A;  1F80 D;  2JU2 A;  2KGA A;  2FHS C;  1VKU A;  4BPF A;  2FAC A;  3EJD A;  2N6Z A;  1HY8 A;  5HV8 A;  4DG9 A;  2KGD A;  2MVV A;  2MD9 A;  2FQ0 A;  2KWL A;  4BPH A;  3EJE A;  1X3O A;  2N98 A;  2MVU A;  4R0M A;  1DNY A;  2KG6 A;  2N5H A;  2PNG A;  2AF8 A;  2LIW A;  2N6Y A;  3RG2 A;  1L0I A;  5KP6 B;  2L4B A;  1DV5 A;  2N5I A;  2AFE A;  2M5R A;  2KOS A;  2KR5 A;  2L9F A;  5KP7 B;  2K94 A;  2GDY A;  3GZM A;  2CGQ A;  4BPG A;  2MY5 A;  2FAE A;  2DNW A;  2K92 A;  2JQ4 A;  2FQ2 A;  2JU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...