2XXMA

Crystal structure of the hiv-1 capsid protein c-terminal domain in complex with a camelid vhh and the cai peptide.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting HIV-1 Virion Formation with Nanobodies -Implications for the Design of Assembly Inhibitors
rcsb
source organism Human immunodeficiency virus
molecule tags Immune system/peptide
molecule keywords CAPSID PROTEIN P24
total genus 25
structure length 73
sequence length 73
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2xxmA00
3G0VA 3H47A 3NTEA 1D1DA 4QNBA 1E6JP 4PH1A 5HGMA 4U0EA 3VRLC 2XT1A 4XROA 4XRQA 3G26A 4M0IA 5I4TG 3MGEA 3DPHA 4U0AA 3DS3A 5HGNA 3LRYA 3DS4A 2BUOA 2M8PA 1BAJA 2M8LA 2JYGA 3H4EA 3DS2A 1AUMA 1A43A 4XFYA 4PH0A 5HGOA 4XFZA 4IPYA 3G1IA 2ONTA 3G28A 4COCA 4U0FA 4U0BA 4WYMA 5HGLA 2JYLA 2KODA 2LF4A 4COPA 4U0DA 1A8OA 2M8NA 3DS0A 2L6EA 4XFXA 5DCKA 2EIAA 3DTJA 2XXMA 3G1GA 1QRJA 1EIAA 5JPAA 3P05A 2JO0A 1EOQA 4U0CA 3DS1A 3G29A 3G21A 2XV6A 3DS5A
chains in the Genus database with same CATH superfamily
1YJ9P 2GYKA 2KWLA 5HGNA 1QVFO 1UNKA 1VQMP 5CZDB 2Z45A 4XFYA 1AUMA 1A43A 3CCRP 2KORA 1W2BO 5HGLA 2JYLA 2KODA 1K30A 4H2XC 1MZ8A 4PWVB 3DTJA 5JPAA 1VQ9P 3CD6P 5BS2A 3H47A 2JU1A 4PH1A 2N5HA 3DS3A 1ACPA 2M8LA 3G1IA 2CQ8A 2N6YA 2VLNA 2PEOA 2L0QA 4WYMA 1VQNP 2KOPA 2LPKA 3LMOA 4HKGA 4U0CA 2GDWA 3RG6C 4QNBA 1T8KA 5F2KA 3G26A 4M0IA 2OARA 1L0HA 2ROQA 2LMLA 1M6EX 2VSQA 4H2YC 2NO8A 2GDYA 3CCVP 1IMQA 1DNYA 2P9XA 7CEIA 3DS5A 2LIWA 2OTLP 2GZEA 1GXHA 5EJDA 2QA4P 1HY8A 2BHVA 2WPTA 3DPHA 1E0HA 5KP8B 1AF8A 4XFZA 3G4SP 1YHQP 2DGYA 2LF4A 2LKIA 1L0IA 2XXMA 1YIJP 5KP6B 2FQ2A 5F2NA 3DS1A 3NY7B 4CA3A 3G0VA 1E6JP 2K0XA 1YITP 2K2QA 3CXCO 2FAEA 2GZJA 2FADA 2LL8A 5HGOA 3H0DA 2FQ1A 2ONTA 1BXIA 1Q82Q 2K92A 4DG9A 1VQ7P 2EIAA 1IMPA 1ZMBA 2PEQA 2KG9A 2FVAA 1RNIA 1VQ8P 2EHTA 1Q86Q 2JAZA 2MR8A 1FR2A 2LIUA 3MGEA 1RO2A 2PEIA 1YJNP 4UHPB 2M8PA 2GDXA 2OTJP 1CEIA 2JU2A 2KW2A 2FVFA 1X3OA 1M90Q 2VLPA 3M1MA 2EG5A 2KOOA 2CGQA 1RO0A 1HQBA 2PEJA 5F2OA 2QNWA 3LRYA 2PEKA 3EJDA 4GR6A 1VKUA 2K0YA 1OR5A 2KG6A 2FACA 3Q20A 2Z46A 3P05A 3CCSP 3DS2A 2CG5B 2LOLA 5I4TG 1NJIQ 2KGDA 2KG8A 3EJEA 2JQ4A 2N5IA 2L9FA 4U0DA 2M8NA 3CCLP 3CMEP 1M1KQ 4NEOA 2FHSC 2JBGA 2N98A 2MVVA 2FVEA 2JB0A 1K8AQ 5HGMA 1VQPP 3OW2O 4GR2A 3E2DA 3G6EP 3DS4A 4F37A 4IPYA 1S72P 3B4QA 4U0FA 2DNWA 2KGAA 3CMAP 3CC2P 2JO0A 2PY8A 3G29A 1IUQA 3GKLC 1Z6MA 2AFEA 2EHSA 2XT1A 2K93A 5KP7B 3G71P 3GJNA 2K0DX 3B5IA 2N50A 1BAJA 1VQOP 2Z44A 1JJ2O 2KOQA 1A8OA 3DS0A 2X2BA 3GZMA 2K5XA 4H2WC 4QKOA 3G21A 1K9MQ 3RG2A 2PENA 4XROA 1YJWP 2M5RA 1VHNA 1QVGO 3CE7A 4U0AA 1Q81Q 2EFJA 4PH0A 1KQSO 2GZGA 4U0BA 2GZFA 3CC7P 5HVCA 4XFXA 1N8RQ 1Q7YQ 3CCJP 5EW5E 2N6ZA 3U43A 3NTEA 2KR5A 4U0EA 3WBHA 2BUOA 1M74A 2KOSA 2MD9A 3CC4P 2VLOA 1VQ5P 3HYBA 1YI2P 2MVUA 2JGPA 1GXGA 1K73Q 2MF4A 1ZNVA 2FQ0A 3GZLA 2PEMA 3H4EA 2MY5A 1GPJA 5BS1A 3CCUP 5DCKA 1M6NA 2L4BA 1EOQA 4PXHB 2XZ1C 3CCQP 1VQKP 4XRQA 2GZIA 4BPFA 3CCEP 2E1MA 4BPGA 1UJZA 2CWOA 3G1GA 1QRJA 1EIAA 3I55P 1VQ6P 1NQ4A 1D1DA 3CCMP 1EMVA 4R0MA 3CPWO 5HV8A 1VQLP 2VLQA 4BPHA 1AYIA 3I56P 1KD1Q 2KGEA 4MRTC 4IZ6A 2XV6A 2PNGA 3HZQA 2XZ0D 1F80D 2CNRA 2LTEA 2MR7A 3VRLC 1KLPA 2JYGA 3G28A 4COCA 1KC8Q 2AFDA 2AF8A 3EJBA 4COPA 2QEXP 2L6EA 2AVAA 2L22A 2KGCA 2ERHA 1VQ4P 2K94A 1DV5A
chains in the Genus database with same CATH topology
3G0VA 1YJ9P 1E6JP 1YITP 1K8AQ 5HGMA 3CXCO 1VQPP 3OW2O 4GR2A 1K73Q 3E2DA 5HGNA 3G6EP 1QVFO 3DS4A 2PEMA 1VQMP 3H4EA 2Z45A 4XFYA 1AUMA 1A43A 5HGOA 3H0DA 4IPYA 3CCRP 1S72P 2ONTA 4U0FA 1Q82Q 1W2BO 5HGLA 2JYLA 2KODA 5BS1A 3CCUP 1K30A 5DCKA 1VQ7P 2EIAA 3DTJA 5JPAA 1M6NA 3CMAP 3CC2P 2JO0A 1EOQA 1ZMBA 2PY8A 3G29A 2PEQA 1IUQA 1VQ9P 3CD6P 5BS2A 3CCQP 1VQKP 3H47A 1RNIA 4PH1A 1VQ8P 1Q86Q 2XT1A 4XRQA 3G71P 3MGEA 1RO2A 3DS3A 2PEIA 3B5IA 1YJNP 2M8PA 1BAJA 2M8LA 3CCEP 1VQOP 2E1MA 3G1IA 2PEOA 2Z44A 1JJ2O 2OTJP 4WYMA 1VQNP 2CWOA 1A8OA 3DS0A 3G1GA 1QRJA 1EIAA 3I55P 4U0CA 1VQ6P 3G21A 1M90Q 1K9MQ 3M1MA 2PENA 2EG5A 1D1DA 3RG6C 1RO0A 4QNBA 3CCMP 4XROA 2PEJA 5F2KA 1YJWP 1QVGO 3G26A 4M0IA 2OARA 3CPWO 5F2OA 4U0AA 1Q81Q 1VQLP 3LRYA 1M6EX 2EFJA 2PEKA 4PH0A 3I56P 1KQSO 4U0BA 1KD1Q 4GR6A 3CCVP 3CC7P 4XFXA 3Q20A 1N8RQ 2Z46A 2P9XA 3P05A 1Q7YQ 3CCJP 3CCSP 2XV6A 3HZQA 3DS2A 3DS5A 2OTLP 3NTEA 2QA4P 4U0EA 3VRLC 3WBHA 2BHVA 5I4TG 1NJIQ 3DPHA 2BUOA 2JYGA 4XFZA 3G4SP 3G28A 2DGYA 4COCA 1YHQP 1KC8Q 1M74A 2LF4A 4COPA 4U0DA 3CC4P 2QEXP 2M8NA 3CCLP 2L6EA 3CMEP 2XXMA 1VQ5P 1YIJP 5F2NA 1M1KQ 3DS1A 1VQ4P 3HYBA 1YI2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G0V A;  3H47 A;  3NTE A;  1D1D A;  4QNB A;  1E6J P;  4PH1 A;  5HGM A;  4U0E A;  3VRL C;  2XT1 A;  4XRO A;  4XRQ A;  3G26 A;  4M0I A;  5I4T G;  3MGE A;  3DPH A;  4U0A A;  3DS3 A;  5HGN A;  3LRY A;  3DS4 A;  2BUO A;  2M8P A;  1BAJ A;  2M8L A;  2JYG A;  3H4E A;  3DS2 A;  1AUM A;  1A43 A;  4XFY A;  4PH0 A;  5HGO A;  4XFZ A;  4IPY A;  3G1I A;  2ONT A;  3G28 A;  4COC A;  4U0F A;  4U0B A;  4WYM A;  5HGL A;  2JYL A;  2KOD A;  2LF4 A;  4COP A;  4U0D A;  1A8O A;  2M8N A;  3DS0 A;  2L6E A;  4XFX A;  5DCK A;  2EIA A;  3DTJ A;  2XXM A;  3G1G A;  1QRJ A;  1EIA A;  5JPA A;  3P05 A;  2JO0 A;  1EOQ A;  4U0C A;  3DS1 A;  3G29 A;  3G21 A;  2XV6 A;  3DS5 A; 
#chains in the Genus database with same CATH topology
 1YJ9 P;  2GYK A;  2KWL A;  5HGN A;  1QVF O;  1UNK A;  1VQM P;  5CZD B;  2Z45 A;  4XFY A;  1AUM A;  1A43 A;  3CCR P;  2KOR A;  1W2B O;  5HGL A;  2JYL A;  2KOD A;  1K30 A;  4H2X C;  1MZ8 A;  4PWV B;  3DTJ A;  5JPA A;  1VQ9 P;  3CD6 P;  5BS2 A;  3H47 A;  2JU1 A;  4PH1 A;  2N5H A;  3DS3 A;  1ACP A;  2M8L A;  3G1I A;  2CQ8 A;  2N6Y A;  2VLN A;  2PEO A;  2L0Q A;  4WYM A;  1VQN P;  2KOP A;  2LPK A;  3LMO A;  4HKG A;  4U0C A;  2GDW A;  3RG6 C;  4QNB A;  1T8K A;  5F2K A;  3G26 A;  4M0I A;  2OAR A;  1L0H A;  2ROQ A;  2LML A;  1M6E X;  2VSQ A;  4H2Y C;  2NO8 A;  2GDY A;  3CCV P;  1IMQ A;  1DNY A;  2P9X A;  7CEI A;  3DS5 A;  2LIW A;  2OTL P;  2GZE A;  1GXH A;  5EJD A;  2QA4 P;  1HY8 A;  2BHV A;  2WPT A;  3DPH A;  1E0H A;  5KP8 B;  1AF8 A;  4XFZ A;  3G4S P;  1YHQ P;  2DGY A;  2LF4 A;  2LKI A;  1L0I A;  2XXM A;  1YIJ P;  5KP6 B;  2FQ2 A;  5F2N A;  3DS1 A;  3NY7 B;  4CA3 A;  3G0V A;  1E6J P;  2K0X A;  1YIT P;  2K2Q A;  3CXC O;  2FAE A;  2GZJ A;  2FAD A;  2LL8 A;  5HGO A;  3H0D A;  2FQ1 A;  2ONT A;  1BXI A;  1Q82 Q;  2K92 A;  4DG9 A;  1VQ7 P;  2EIA A;  1IMP A;  1ZMB A;  2PEQ A;  2KG9 A;  2FVA A;  1RNI A;  1VQ8 P;  2EHT A;  1Q86 Q;  2JAZ A;  2MR8 A;  1FR2 A;  2LIU A;  3MGE A;  1RO2 A;  2PEI A;  1YJN P;  4UHP B;  2M8P A;  2GDX A;  2OTJ P;  1CEI A;  2JU2 A;  2KW2 A;  2FVF A;  1X3O A;  1M90 Q;  2VLP A;  3M1M A;  2EG5 A;  2KOO A;  2CGQ A;  1RO0 A;  1HQB A;  2PEJ A;  5F2O A;  2QNW A;  3LRY A;  2PEK A;  3EJD A;  4GR6 A;  1VKU A;  2K0Y A;  1OR5 A;  2KG6 A;  2FAC A;  3Q20 A;  2Z46 A;  3P05 A;  3CCS P;  3DS2 A;  2CG5 B;  2LOL A;  5I4T G;  1NJI Q;  2KGD A;  2KG8 A;  3EJE A;  2JQ4 A;  2N5I A;  2L9F A;  4U0D A;  2M8N A;  3CCL P;  3CME P;  1M1K Q;  4NEO A;  2FHS C;  2JBG A;  2N98 A;  2MVV A;  2FVE A;  2JB0 A;  1K8A Q;  5HGM A;  1VQP P;  3OW2 O;  4GR2 A;  3E2D A;  3G6E P;  3DS4 A;  4F37 A;  4IPY A;  1S72 P;  3B4Q A;  4U0F A;  2DNW A;  2KGA A;  3CMA P;  3CC2 P;  2JO0 A;  2PY8 A;  3G29 A;  1IUQ A;  3GKL C;  1Z6M A;  2AFE A;  2EHS A;  2XT1 A;  2K93 A;  5KP7 B;  3G71 P;  3GJN A;  2K0D X;  3B5I A;  2N50 A;  1BAJ A;  1VQO P;  2Z44 A;  1JJ2 O;  2KOQ A;  1A8O A;  3DS0 A;  2X2B A;  3GZM A;  2K5X A;  4H2W C;  4QKO A;  3G21 A;  1K9M Q;  3RG2 A;  2PEN A;  4XRO A;  1YJW P;  2M5R A;  1VHN A;  1QVG O;  3CE7 A;  4U0A A;  1Q81 Q;  2EFJ A;  4PH0 A;  1KQS O;  2GZG A;  4U0B A;  2GZF A;  3CC7 P;  5HVC A;  4XFX A;  1N8R Q;  1Q7Y Q;  3CCJ P;  5EW5 E;  2N6Z A;  3U43 A;  3NTE A;  2KR5 A;  4U0E A;  3WBH A;  2BUO A;  1M74 A;  2KOS A;  2MD9 A;  3CC4 P;  2VLO A;  1VQ5 P;  3HYB A;  1YI2 P;  2MVU A;  2JGP A;  1GXG A;  1K73 Q;  2MF4 A;  1ZNV A;  2FQ0 A;  3GZL A;  2PEM A;  3H4E A;  2MY5 A;  1GPJ A;  5BS1 A;  3CCU P;  5DCK A;  1M6N A;  2L4B A;  1EOQ A;  4PXH B;  2XZ1 C;  3CCQ P;  1VQK P;  4XRQ A;  2GZI A;  4BPF A;  3CCE P;  2E1M A;  4BPG A;  1UJZ A;  2CWO A;  3G1G A;  1QRJ A;  1EIA A;  3I55 P;  1VQ6 P;  1NQ4 A;  1D1D A;  3CCM P;  1EMV A;  4R0M A;  3CPW O;  5HV8 A;  1VQL P;  2VLQ A;  4BPH A;  1AYI A;  3I56 P;  1KD1 Q;  2KGE A;  4MRT C;  4IZ6 A;  2XV6 A;  2PNG A;  3HZQ A;  2XZ0 D;  1F80 D;  2CNR A;  2LTE A;  2MR7 A;  3VRL C;  1KLP A;  2JYG A;  3G28 A;  4COC A;  1KC8 Q;  2AFD A;  2AF8 A;  3EJB A;  4COP A;  2QEX P;  2L6E A;  2AVA A;  2L22 A;  2KGC A;  2ERH A;  1VQ4 P;  2K94 A;  1DV5 A; 
#chains in the Genus database with same CATH homology
 3G0V A;  1YJ9 P;  1E6J P;  1YIT P;  1K8A Q;  5HGM A;  3CXC O;  1VQP P;  3OW2 O;  4GR2 A;  1K73 Q;  3E2D A;  5HGN A;  3G6E P;  1QVF O;  3DS4 A;  2PEM A;  1VQM P;  3H4E A;  2Z45 A;  4XFY A;  1AUM A;  1A43 A;  5HGO A;  3H0D A;  4IPY A;  3CCR P;  1S72 P;  2ONT A;  4U0F A;  1Q82 Q;  1W2B O;  5HGL A;  2JYL A;  2KOD A;  5BS1 A;  3CCU P;  1K30 A;  5DCK A;  1VQ7 P;  2EIA A;  3DTJ A;  5JPA A;  1M6N A;  3CMA P;  3CC2 P;  2JO0 A;  1EOQ A;  1ZMB A;  2PY8 A;  3G29 A;  2PEQ A;  1IUQ A;  1VQ9 P;  3CD6 P;  5BS2 A;  3CCQ P;  1VQK P;  3H47 A;  1RNI A;  4PH1 A;  1VQ8 P;  1Q86 Q;  2XT1 A;  4XRQ A;  3G71 P;  3MGE A;  1RO2 A;  3DS3 A;  2PEI A;  3B5I A;  1YJN P;  2M8P A;  1BAJ A;  2M8L A;  3CCE P;  1VQO P;  2E1M A;  3G1I A;  2PEO A;  2Z44 A;  1JJ2 O;  2OTJ P;  4WYM A;  1VQN P;  2CWO A;  1A8O A;  3DS0 A;  3G1G A;  1QRJ A;  1EIA A;  3I55 P;  4U0C A;  1VQ6 P;  3G21 A;  1M90 Q;  1K9M Q;  3M1M A;  2PEN A;  2EG5 A;  1D1D A;  3RG6 C;  1RO0 A;  4QNB A;  3CCM P;  4XRO A;  2PEJ A;  5F2K A;  1YJW P;  1QVG O;  3G26 A;  4M0I A;  2OAR A;  3CPW O;  5F2O A;  4U0A A;  1Q81 Q;  1VQL P;  3LRY A;  1M6E X;  2EFJ A;  2PEK A;  4PH0 A;  3I56 P;  1KQS O;  4U0B A;  1KD1 Q;  4GR6 A;  3CCV P;  3CC7 P;  4XFX A;  3Q20 A;  1N8R Q;  2Z46 A;  2P9X A;  3P05 A;  1Q7Y Q;  3CCJ P;  3CCS P;  2XV6 A;  3HZQ A;  3DS2 A;  3DS5 A;  2OTL P;  3NTE A;  2QA4 P;  4U0E A;  3VRL C;  3WBH A;  2BHV A;  5I4T G;  1NJI Q;  3DPH A;  2BUO A;  2JYG A;  4XFZ A;  3G4S P;  3G28 A;  2DGY A;  4COC A;  1YHQ P;  1KC8 Q;  1M74 A;  2LF4 A;  4COP A;  4U0D A;  3CC4 P;  2QEX P;  2M8N A;  3CCL P;  2L6E A;  3CME P;  2XXM A;  1VQ5 P;  1YIJ P;  5F2N A;  1M1K Q;  3DS1 A;  1VQ4 P;  3HYB A;  1YI2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...