2XXMA

Crystal structure of the hiv-1 capsid protein c-terminal domain in complex with a camelid vhh and the cai peptide.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting HIV-1 Virion Formation with Nanobodies -Implications for the Design of Assembly Inhibitors
rcsb
source organism Human immunodeficiency virus
molecule tags Immune system/peptide
molecule keywords CAPSID PROTEIN P24
total genus 25
structure length 73
sequence length 73
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2xxmA00
2JYGA 4COPA 3NTEA 4XFYA 5HGMA 3G0VA 4COCA 3VRLC 4XRQA 5HGOA 5HGLA 1D1DA 5JPAA 4IPYA 1BAJA 4XFZA 1EIAA 2JYLA 3DS5A 4PH0A 5I4TG 4M0IA 4U0FA 1AUMA 3DS3A 3DS2A 3DTJA 3G29A 3H4EA 4PH1A 4U0EA 2L6EA 3DS4A 1E6JP 2JO0A 2M8NA 1QRJA 2BUOA 3P05A 4U0CA 4XROA 2KODA 3MGEA 3DPHA 4XFXA 2M8PA 2M8LA 1EOQA 2XXMA 3LRYA 2XV6A 5HGNA 4U0AA 4U0BA 4QNBA 4WYMA 2ONTA 2LF4A 3G28A 3G26A 3G1GA 1A8OA 3DS0A 4U0DA 3G1IA 2XT1A 3H47A 1A43A 2EIAA 5DCKA 3G21A 3DS1A
chains in the Genus database with same CATH superfamily
2JAZA 2KOQA 2BHVA 1EIAA 3CC7P 2GDWA 5F2KA 1M6NA 1E6JP 1HQBA 2M8NA 3CCMP 3MGEA 1GXHA 2KR5A 2LIWA 2XV6A 1ZMBA 5EJDA 2K93A 2MR7A 3CCLP 4QNBA 5KP6B 3G1GA 2PEOA 5KP7B 4XFYA 4IZ6A 5HGOA 2NO8A 1VHNA 1YJNP 3CMEP 3DS3A 2FVEA 2GZGA 2N5HA 3I55P 2KGDA 2DGYA 2GDXA 1A43A 3GZMA 4HKGA 2LTEA 2GDYA 2AFDA 2FQ1A 2MVVA 2OARA 1VQ6P 5BS1A 1N8RQ 1HY8A 2M8LA 2GZJA 2JQ4A 2LF4A 3CCVP 1K9MQ 3GJNA 2PEJA 1IMPA 2FADA 1AF8A 1K8AQ 1DNYA 2KG9A 2ROQA 1YJ9P 2PNGA 3CCEP 1W2BO 3Q20A 2KOPA 4CA3A 3HYBA 4WYMA 1K30A 4U0DA 1VQ8P 2OTJP 5HGMA 4COCA 3VRLC 2N5IA 4F37A 2VLOA 4PH0A 1AUMA 3I56P 3G71P 2Z46A 2EFJA 2XXMA 2LKIA 2EIAA 1YIJP 3G0VA 1IUQA 3GKLC 3CPWO 2L0QA 3LMOA 5HGLA 1NQ4A 2K0YA 2L6EA 2K2QA 2GYKA 4GR2A 2L4BA 1VQKP 1GPJA 2FQ2A 4UHPB 2VSQA 3CC4P 1M6EX 2PEKA 3EJDA 2N98A 2K5XA 1BAJA 2AVAA 3DS5A 5I4TG 3EJEA 3CXCO 2PY8A 4DG9A 1Q7YQ 2CQ8A 2QNWA 1L0IA 4U0AA 2KGCA 4PWVB 1VQNP 3G1IA 3CCSP 1VKUA 2WPTA 1RO2A 2P9XA 3CC2P 2Z44A 3G29A 1ACPA 2XZ0D 3DS4A 3G4SP 5HV8A 2ERHA 2CG5B 2EG5A 2M8PA 2FAEA 1Q86Q 2FHSC 4PXHB 1Q82Q 2QEXP 2CWOA 2JU1A 1QVFO 1EMVA 2QA4P 2KG6A 1JJ2O 3DS2A 3U43A 3M1MA 2KGAA 5KP8B 2L9FA 2MR8A 2VLPA 5F2OA 2DNWA 1M90Q 2PENA 4H2WC 5HVCA 1NJIQ 1DV5A 3RG6C 2XT1A 3H47A 2N6YA 3NTEA 1KLPA 1GXGA 5JPAA 4XFZA 3CCRP 2JB0A 3P05A 4U0CA 3EJBA 3DPHA 2VLNA 1S72P 1UNKA 3NY7B 3WBHA 2FQ0A 1IMQA 1FR2A 1KC8Q 3CD6P 2LOLA 3B5IA 3H4EA 2LPKA 2BUOA 1X3OA 1E0HA 2KODA 3GZLA 2FACA 4XFXA 2OTLP 1K73Q 1EOQA 5HGNA 2MVUA 1VQ9P 2CNRA 2KGEA 2KOOA 3G28A 5EW5E 1M1KQ 5CZDB 2GZEA 2MF4A 2FVFA 2LL8A 1L0HA 2N6ZA 1QVGO 4XROA 1QRJA 2GZIA 2KORA 2JU2A 1RO0A 1YI2P 2AF8A 3DS0A 2MY5A 1CEIA 2K0DX 1YJWP 3G6EP 4COPA 2L22A 1RNIA 2JYLA 4U0FA 4U0EA 3H0DA 2M5RA 4GR6A 2LIUA 3LRYA 1VQLP 2PEMA 4U0BA 5BS2A 2FVAA 2JGPA 2EHTA 2JYGA 2GZFA 4BPFA 4XRQA 1M74A 3CCJP 2VLQA 1Z6MA 3E2DA 4M0IA 1ZNVA 3DTJA 4H2YC 2JO0A 2KG8A 2K92A 4NEOA 2JBGA 1VQ4P 1Q81Q 2MD9A 1YHQP 2X2BA 2N50A 3B4QA 2ONTA 7CEIA 5DCKA 4H2XC 1VQ5P 1F80D 2KWLA 4BPHA 2K0XA 4IPYA 1AYIA 1VQ7P 2E1MA 3RG2A 1UJZA 2AFEA 2LMLA 1VQPP 1VQMP 3OW2O 1BXIA 2Z45A 4MRTC 2XZ1C 2EHSA 1VQOP 1KQSO 1KD1Q 3G21A 1D1DA 4R0MA 2PEIA 3CE7A 3CCQP 4PH1A 4QKOA 3CCUP 5F2NA 1YITP 2CGQA 4BPGA 1MZ8A 3CMAP 3G26A 3HZQA 1OR5A 2KW2A 1T8KA 1A8OA 2PEQA 2K94A 2KOSA 3DS1A
chains in the Genus database with same CATH topology
3G6EP 4COPA 2CWOA 5HGMA 4COCA 3VRLC 1QVFO 1RNIA 2BHVA 4PH0A 1EIAA 2JYLA 2QA4P 4U0FA 1AUMA 3DS2A 3I56P 5F2KA 3G71P 1JJ2O 4U0EA 3CC7P 3H0DA 1M6NA 1E6JP 2M8NA 2Z46A 3CCMP 3M1MA 3MGEA 2EFJA 4GR6A 2XXMA 3LRYA 2XV6A 1ZMBA 1VQLP 3CCLP 2PEMA 4U0BA 4QNBA 5BS2A 5F2OA 1M90Q 2PENA 3G1GA 1NJIQ 3RG6C 2XT1A 3H47A 2EIAA 2PEOA 2JYGA 3NTEA 1YIJP 4XFYA 3G0VA 1IUQA 4XRQA 1M74A 5HGOA 5HGLA 3CPWO 3CCJP 5JPAA 3E2DA 4XFZA 1YJNP 3CMEP 4M0IA 3CCRP 3DS3A 3DTJA 2L6EA 3P05A 2JO0A 4U0CA 3DPHA 1VQ4P 1S72P 1Q81Q 1YHQP 3I55P 4GR2A 3WBHA 2ONTA 1VQKP 2DGYA 1KC8Q 3CC4P 1A43A 5DCKA 2PEKA 1M6EX 1VQ5P 2OTJP 3CD6P 3B5IA 4IPYA 1BAJA 3DS5A 5I4TG 2E1MA 1VQ7P 2OARA 3H4EA 3CXCO 1VQ6P 2BUOA 5BS1A 2KODA 2PY8A 1VQPP 4XFXA 1Q7YQ 1VQMP 1N8RQ 2OTLP 1K73Q 2M8LA 1EOQA 3OW2O 5HGNA 1VQ9P 4U0AA 2Z45A 3G28A 2LF4A 3CCVP 1VQNP 1M1KQ 1K9MQ 1VQOP 3G1IA 1KQSO 2PEJA 1KD1Q 3CCSP 3G21A 1K8AQ 1D1DA 2QEXP 1RO2A 2P9XA 2PEIA 3CCQP 1YJ9P 3CC2P 2Z44A 3G29A 4PH1A 3CCEP 1QVGO 3DS4A 3G4SP 4XROA 1QRJA 3CCUP 1W2BO 1RO0A 5F2NA 1YI2P 1YITP 2EG5A 2M8PA 3Q20A 3CMAP 3HYBA 4WYMA 1K30A 1Q86Q 3G26A 3HZQA 1A8OA 3DS0A 4U0DA 1VQ8P 2PEQA 1Q82Q 3DS1A 1YJWP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JYG A;  4COP A;  3NTE A;  4XFY A;  5HGM A;  3G0V A;  4COC A;  3VRL C;  4XRQ A;  5HGO A;  5HGL A;  1D1D A;  5JPA A;  4IPY A;  1BAJ A;  4XFZ A;  1EIA A;  2JYL A;  3DS5 A;  4PH0 A;  5I4T G;  4M0I A;  4U0F A;  1AUM A;  3DS3 A;  3DS2 A;  3DTJ A;  3G29 A;  3H4E A;  4PH1 A;  4U0E A;  2L6E A;  3DS4 A;  1E6J P;  2JO0 A;  2M8N A;  1QRJ A;  2BUO A;  3P05 A;  4U0C A;  4XRO A;  2KOD A;  3MGE A;  3DPH A;  4XFX A;  2M8P A;  2M8L A;  1EOQ A;  2XXM A;  3LRY A;  2XV6 A;  5HGN A;  4U0A A;  4U0B A;  4QNB A;  4WYM A;  2ONT A;  2LF4 A;  3G28 A;  3G26 A;  3G1G A;  1A8O A;  3DS0 A;  4U0D A;  3G1I A;  2XT1 A;  3H47 A;  1A43 A;  2EIA A;  5DCK A;  3G21 A;  3DS1 A; 
#chains in the Genus database with same CATH topology
 2JAZ A;  2KOQ A;  2BHV A;  1EIA A;  3CC7 P;  2GDW A;  5F2K A;  1M6N A;  1E6J P;  1HQB A;  2M8N A;  3CCM P;  3MGE A;  1GXH A;  2KR5 A;  2LIW A;  2XV6 A;  1ZMB A;  5EJD A;  2K93 A;  2MR7 A;  3CCL P;  4QNB A;  5KP6 B;  3G1G A;  2PEO A;  5KP7 B;  4XFY A;  4IZ6 A;  5HGO A;  2NO8 A;  1VHN A;  1YJN P;  3CME P;  3DS3 A;  2FVE A;  2GZG A;  2N5H A;  3I55 P;  2KGD A;  2DGY A;  2GDX A;  1A43 A;  3GZM A;  4HKG A;  2LTE A;  2GDY A;  2AFD A;  2FQ1 A;  2MVV A;  2OAR A;  1VQ6 P;  5BS1 A;  1N8R Q;  1HY8 A;  2M8L A;  2GZJ A;  2JQ4 A;  2LF4 A;  3CCV P;  1K9M Q;  3GJN A;  2PEJ A;  1IMP A;  2FAD A;  1AF8 A;  1K8A Q;  1DNY A;  2KG9 A;  2ROQ A;  1YJ9 P;  2PNG A;  3CCE P;  1W2B O;  3Q20 A;  2KOP A;  4CA3 A;  3HYB A;  4WYM A;  1K30 A;  4U0D A;  1VQ8 P;  2OTJ P;  5HGM A;  4COC A;  3VRL C;  2N5I A;  4F37 A;  2VLO A;  4PH0 A;  1AUM A;  3I56 P;  3G71 P;  2Z46 A;  2EFJ A;  2XXM A;  2LKI A;  2EIA A;  1YIJ P;  3G0V A;  1IUQ A;  3GKL C;  3CPW O;  2L0Q A;  3LMO A;  5HGL A;  1NQ4 A;  2K0Y A;  2L6E A;  2K2Q A;  2GYK A;  4GR2 A;  2L4B A;  1VQK P;  1GPJ A;  2FQ2 A;  4UHP B;  2VSQ A;  3CC4 P;  1M6E X;  2PEK A;  3EJD A;  2N98 A;  2K5X A;  1BAJ A;  2AVA A;  3DS5 A;  5I4T G;  3EJE A;  3CXC O;  2PY8 A;  4DG9 A;  1Q7Y Q;  2CQ8 A;  2QNW A;  1L0I A;  4U0A A;  2KGC A;  4PWV B;  1VQN P;  3G1I A;  3CCS P;  1VKU A;  2WPT A;  1RO2 A;  2P9X A;  3CC2 P;  2Z44 A;  3G29 A;  1ACP A;  2XZ0 D;  3DS4 A;  3G4S P;  5HV8 A;  2ERH A;  2CG5 B;  2EG5 A;  2M8P A;  2FAE A;  1Q86 Q;  2FHS C;  4PXH B;  1Q82 Q;  2QEX P;  2CWO A;  2JU1 A;  1QVF O;  1EMV A;  2QA4 P;  2KG6 A;  1JJ2 O;  3DS2 A;  3U43 A;  3M1M A;  2KGA A;  5KP8 B;  2L9F A;  2MR8 A;  2VLP A;  5F2O A;  2DNW A;  1M90 Q;  2PEN A;  4H2W C;  5HVC A;  1NJI Q;  1DV5 A;  3RG6 C;  2XT1 A;  3H47 A;  2N6Y A;  3NTE A;  1KLP A;  1GXG A;  5JPA A;  4XFZ A;  3CCR P;  2JB0 A;  3P05 A;  4U0C A;  3EJB A;  3DPH A;  2VLN A;  1S72 P;  1UNK A;  3NY7 B;  3WBH A;  2FQ0 A;  1IMQ A;  1FR2 A;  1KC8 Q;  3CD6 P;  2LOL A;  3B5I A;  3H4E A;  2LPK A;  2BUO A;  1X3O A;  1E0H A;  2KOD A;  3GZL A;  2FAC A;  4XFX A;  2OTL P;  1K73 Q;  1EOQ A;  5HGN A;  2MVU A;  1VQ9 P;  2CNR A;  2KGE A;  2KOO A;  3G28 A;  5EW5 E;  1M1K Q;  5CZD B;  2GZE A;  2MF4 A;  2FVF A;  2LL8 A;  1L0H A;  2N6Z A;  1QVG O;  4XRO A;  1QRJ A;  2GZI A;  2KOR A;  2JU2 A;  1RO0 A;  1YI2 P;  2AF8 A;  3DS0 A;  2MY5 A;  1CEI A;  2K0D X;  1YJW P;  3G6E P;  4COP A;  2L22 A;  1RNI A;  2JYL A;  4U0F A;  4U0E A;  3H0D A;  2M5R A;  4GR6 A;  2LIU A;  3LRY A;  1VQL P;  2PEM A;  4U0B A;  5BS2 A;  2FVA A;  2JGP A;  2EHT A;  2JYG A;  2GZF A;  4BPF A;  4XRQ A;  1M74 A;  3CCJ P;  2VLQ A;  1Z6M A;  3E2D A;  4M0I A;  1ZNV A;  3DTJ A;  4H2Y C;  2JO0 A;  2KG8 A;  2K92 A;  4NEO A;  2JBG A;  1VQ4 P;  1Q81 Q;  2MD9 A;  1YHQ P;  2X2B A;  2N50 A;  3B4Q A;  2ONT A;  7CEI A;  5DCK A;  4H2X C;  1VQ5 P;  1F80 D;  2KWL A;  4BPH A;  2K0X A;  4IPY A;  1AYI A;  1VQ7 P;  2E1M A;  3RG2 A;  1UJZ A;  2AFE A;  2LML A;  1VQP P;  1VQM P;  3OW2 O;  1BXI A;  2Z45 A;  4MRT C;  2XZ1 C;  2EHS A;  1VQO P;  1KQS O;  1KD1 Q;  3G21 A;  1D1D A;  4R0M A;  2PEI A;  3CE7 A;  3CCQ P;  4PH1 A;  4QKO A;  3CCU P;  5F2N A;  1YIT P;  2CGQ A;  4BPG A;  1MZ8 A;  3CMA P;  3G26 A;  3HZQ A;  1OR5 A;  2KW2 A;  1T8K A;  1A8O A;  2PEQ A;  2K94 A;  2KOS A;  3DS1 A; 
#chains in the Genus database with same CATH homology
 3G6E P;  4COP A;  2CWO A;  5HGM A;  4COC A;  3VRL C;  1QVF O;  1RNI A;  2BHV A;  4PH0 A;  1EIA A;  2JYL A;  2QA4 P;  4U0F A;  1AUM A;  3DS2 A;  3I56 P;  5F2K A;  3G71 P;  1JJ2 O;  4U0E A;  3CC7 P;  3H0D A;  1M6N A;  1E6J P;  2M8N A;  2Z46 A;  3CCM P;  3M1M A;  3MGE A;  2EFJ A;  4GR6 A;  2XXM A;  3LRY A;  2XV6 A;  1ZMB A;  1VQL P;  3CCL P;  2PEM A;  4U0B A;  4QNB A;  5BS2 A;  5F2O A;  1M90 Q;  2PEN A;  3G1G A;  1NJI Q;  3RG6 C;  2XT1 A;  3H47 A;  2EIA A;  2PEO A;  2JYG A;  3NTE A;  1YIJ P;  4XFY A;  3G0V A;  1IUQ A;  4XRQ A;  1M74 A;  5HGO A;  5HGL A;  3CPW O;  3CCJ P;  5JPA A;  3E2D A;  4XFZ A;  1YJN P;  3CME P;  4M0I A;  3CCR P;  3DS3 A;  3DTJ A;  2L6E A;  3P05 A;  2JO0 A;  4U0C A;  3DPH A;  1VQ4 P;  1S72 P;  1Q81 Q;  1YHQ P;  3I55 P;  4GR2 A;  3WBH A;  2ONT A;  1VQK P;  2DGY A;  1KC8 Q;  3CC4 P;  1A43 A;  5DCK A;  2PEK A;  1M6E X;  1VQ5 P;  2OTJ P;  3CD6 P;  3B5I A;  4IPY A;  1BAJ A;  3DS5 A;  5I4T G;  2E1M A;  1VQ7 P;  2OAR A;  3H4E A;  3CXC O;  1VQ6 P;  2BUO A;  5BS1 A;  2KOD A;  2PY8 A;  1VQP P;  4XFX A;  1Q7Y Q;  1VQM P;  1N8R Q;  2OTL P;  1K73 Q;  2M8L A;  1EOQ A;  3OW2 O;  5HGN A;  1VQ9 P;  4U0A A;  2Z45 A;  3G28 A;  2LF4 A;  3CCV P;  1VQN P;  1M1K Q;  1K9M Q;  1VQO P;  3G1I A;  1KQS O;  2PEJ A;  1KD1 Q;  3CCS P;  3G21 A;  1K8A Q;  1D1D A;  2QEX P;  1RO2 A;  2P9X A;  2PEI A;  3CCQ P;  1YJ9 P;  3CC2 P;  2Z44 A;  3G29 A;  4PH1 A;  3CCE P;  1QVG O;  3DS4 A;  3G4S P;  4XRO A;  1QRJ A;  3CCU P;  1W2B O;  1RO0 A;  5F2N A;  1YI2 P;  1YIT P;  2EG5 A;  2M8P A;  3Q20 A;  3CMA P;  3HYB A;  4WYM A;  1K30 A;  1Q86 Q;  3G26 A;  3HZQ A;  1A8O A;  3DS0 A;  4U0D A;  1VQ8 P;  2PEQ A;  1Q82 Q;  3DS1 A;  1YJW P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...