2XXMA

Crystal structure of the hiv-1 capsid protein c-terminal domain in complex with a camelid vhh and the cai peptide.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide
molecule keywords CAPSID PROTEIN P24
publication title Targeting HIV-1 Virion Formation with Nanobodies -Implications for the Design of Assembly Inhibitors
rcsb
source organism Human immunodeficiency virus
total genus 25
structure length 73
sequence length 73
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2xxmA00
4XFXA 2XT1A 4XFYA 1BAJA 2KODA 1E6JP 2M8NA 3H47A 4U0DA 2L6EA 2XXMA 4PH0A 4U0AA 2M8LA 3DS0A 3H4EA 2JYGA 2LF4A 3G1IA 3MGEA 1AUMA 3DS3A 3DS2A 5HGNA 2ONTA 3G26A 4COPA 3G28A 4U0FA 1EOQA 4M0IA 2JYLA 3DTJA 4U0CA 4U0EA 1QRJA 2XV6A 4XFZA 5DCKA 3VRLC 5HGOA 3DS1A 3LRYA 3NTEA 3DPHA 1D1DA 3G29A 3DS5A 3G1GA 4IPYA 1EIAA 4XRQA 5HGMA 1A43A 5JPAA 3G0VA 3DS4A 2BUOA 4QNBA 4U0BA 1A8OA 5HGLA 5I4TG 3G21A 4WYMA 4XROA 4COCA 2M8PA 2JO0A 3P05A 2EIAA 4PH1A
chains in the Genus database with same CATH superfamily
4XFXA 2MR7A 2LMLA 4R0MA 2KOQA 2KGCA 1UJZA 1QVGO 2FAEA 3I55P 2PEMA 4BPFA 4U0EA 1QRJA 2PEKA 5HV8A 1DNYA 2MY5A 2CG5B 3NTEA 3RG2A 3G1GA 1IMQA 1N8RQ 3CC2P 4XROA 1Q81Q 4COCA 2M8PA 1RNIA 3P05A 2KOSA 2GYKA 2EIAA 2DGYA 2VLPA 2KODA 2OTJP 4PH0A 3OW2O 1VQOP 3CMEP 2MF4A 3MGEA 2FVAA 3E2DA 2PEQA 1EOQA 4XFZA 1GPJA 1VQ5P 1M90Q 2JGPA 4QNBA 1Q82Q 4BPGA 1OR5A 5F2NA 3CD6P 2KOOA 3RG6C 3G1IA 5HVCA 2N98A 2LL8A 4COPA 1YI2P 2XV6A 5EJDA 3CXCO 1FR2A 4F37A 2XZ0D 2E1MA 1GXHA 3CE7A 5EW5E 3B5IA 2JBGA 1HY8A 2CWOA 3CCVP 4U0DA 4H2YC 4U0AA 1Q7YQ 1L0IA 1AF8A 1MZ8A 2MVUA 2KGAA 1K9MQ 2LPKA 4U0FA 4NEOA 3CC7P 2AFEA 3DS5A 1VQ6P 1EIAA 2N6YA 1NJIQ 3G21A 2KW2A 3CCJP 1CEIA 1ZNVA 2KG9A 3H4EA 2FACA 2KOPA 5HGNA 3CC4P 2MD9A 2KGEA 1K73Q 2GDWA 1M74A 3DTJA 3U43A 2PNGA 3DS1A 5HGMA 5JPAA 3GKLC 4WYMA 2N5HA 2KR5A 1M6EX 1BAJA 2GZEA 2K93A 2FVEA 1VQLP 3DS3A 1YHQP 3CCUP 2JYLA 2CNRA 2MR8A 2ROQA 1DV5A 2AF8A 2VLQA 1A43A 3DS4A 2M5RA 3HZQA 1KQSO 2CQ8A 2EG5A 1KD1Q 2LTEA 2QEXP 1BXIA 3CPWO 3DS2A 3EJBA 3LRYA 2L9FA 2KGDA 1Q86Q 2PEJA 1S72P 1IMPA 2BHVA 2VSQA 2L0QA 2K92A 3CCLP 2FHSC 3CCQP 3G4SP 2OARA 1YJNP 2KWLA 7CEIA 2EHTA 5HGOA 3DPHA 2ERHA 1ZMBA 1YJWP 2Z44A 5KP6B 2BUOA 4QKOA 3CCEP 2K0XA 1VQ9P 2GZFA 3EJEA 4UHPB 1W2BO 2KG6A 4CA3A 1VQPP 5KP8B 2FVFA 3G71P 2AVAA 4IPYA 4XRQA 2K0DX 2P9XA 2AFDA 2L22A 4GR2A 1KC8Q 4XFYA 2GZIA 2WPTA 4PWVB 1GXGA 2VLNA 2JU2A 1T8KA 1JJ2O 1VQMP 2VLOA 1F80D 3I56P 3GZLA 3LMOA 5F2KA 2XXMA 1VQ8P 3G6EP 1VKUA 1AUMA 1IUQA 4M0IA 2NO8A 3CCRP 1QVFO 1X3OA 1K8AQ 2EHSA 2FQ0A 4PH1A 3NY7B 4MRTC 2FQ2A 5BS2A 4GR6A 5DCKA 2N5IA 4DG9A 1HQBA 3Q20A 5F2OA 3CCSP 3M1MA 2DNWA 5HGLA 2KORA 4BPHA 2Z45A 2N50A 2JAZA 2M8NA 3H47A 1ACPA 2EFJA 2QA4P 2LF4A 2QNWA 3GZMA 3G26A 4PXHB 5BS1A 3G28A 1VHNA 4U0CA 2LKIA 1VQNP 1RO2A 1VQKP 2GZGA 3HYBA 1RO0A 4H2XC 5I4TG 4H2WC 2FADA 2N6ZA 1M1KQ 1UNKA 3CMAP 2JO0A 2K0YA 1K30A 2CGQA 2GDYA 2M8LA 1Z6MA 1KLPA 2ONTA 2FQ1A 1AYIA 2L4BA 3WBHA 2KG8A 3G0VA 1YITP 2PEIA 2XT1A 2JQ4A 3EJDA 1E6JP 1NQ4A 2L6EA 5KP7B 2LIWA 2Z46A 1E0HA 4IZ6A 3CCMP 2K2QA 1VQ4P 1EMVA 2OTLP 3H0DA 2GZJA 1D1DA 4HKGA 3G29A 2K5XA 4U0BA 1L0HA 1M6NA 2PY8A 3GJNA 2LOLA 3DS0A 2JYGA 5CZDB 2JU1A 1VQ7P 1YIJP 3B4QA 3VRLC 2XZ1C 2MVVA 2PEOA 2X2BA 2JB0A 2PENA 1YJ9P 1A8OA 2LIUA 2K94A 2GDXA
chains in the Genus database with same CATH topology
4XFXA 2Z45A 2M8NA 3H47A 3CCJP 1VQ9P 2EFJA 2QA4P 3H4EA 1QVGO 2LF4A 5HGNA 1W2BO 3I55P 2PEMA 3G26A 5BS1A 3CC4P 3G28A 1K73Q 4U0CA 1M74A 3DTJA 4U0EA 1QRJA 2PEKA 1VQPP 3G71P 3DS1A 3NTEA 1VQNP 1RO2A 3G1GA 4IPYA 4XRQA 1N8RQ 1VQKP 3HYBA 5HGMA 1RO0A 5JPAA 5I4TG 3CC2P 1M1KQ 4WYMA 4XROA 1Q81Q 4COCA 2P9XA 2M8PA 3CMAP 2JO0A 1RNIA 3P05A 2EIAA 4GR2A 2DGYA 1K30A 1M6EX 4XFYA 1BAJA 2KODA 1KC8Q 2OTJP 4PH0A 2M8LA 3OW2O 1VQOP 1VQLP 3CMEP 3MGEA 3DS3A 2ONTA 3E2DA 1YHQP 3CCUP 2PEQA 1EOQA 2JYLA 4XFZA 1VQ5P 1M90Q 1JJ2O 1A43A 3WBHA 3G0VA 3DS4A 1VQMP 4QNBA 1Q82Q 3HZQA 1YITP 1KQSO 2PEIA 2XT1A 3I56P 1E6JP 5F2NA 5F2KA 2EG5A 1KD1Q 2L6EA 2XXMA 1VQ8P 3CD6P 2QEXP 3RG6C 3G6EP 2Z46A 3G1IA 3CPWO 1AUMA 3DS2A 4COPA 3CCMP 1IUQA 4M0IA 1YI2P 2XV6A 1VQ4P 3CXCO 3LRYA 3CCRP 2OTLP 3H0DA 1D1DA 2E1MA 3G29A 1QVFO 4U0BA 1Q86Q 2PEJA 1K8AQ 1S72P 3B5IA 1M6NA 2BHVA 4PH1A 2PY8A 2CWOA 3CCVP 4U0DA 4U0AA 1Q7YQ 3DS0A 3CCLP 2JYGA 5BS2A 3CCQP 1VQ7P 1YIJP 3G4SP 1K9MQ 4U0FA 2OARA 1YJNP 4GR6A 5DCKA 3VRLC 3Q20A 5F2OA 5HGOA 2PEOA 3CC7P 3CCSP 3DPHA 3DS5A 1ZMBA 3M1MA 1VQ6P 1EIAA 2Z44A 1YJWP 5HGLA 1YJ9P 2BUOA 2PENA 1A8OA 1NJIQ 3G21A 3CCEP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XFX A;  2XT1 A;  4XFY A;  1BAJ A;  2KOD A;  1E6J P;  2M8N A;  3H47 A;  4U0D A;  2L6E A;  2XXM A;  4PH0 A;  4U0A A;  2M8L A;  3DS0 A;  3H4E A;  2JYG A;  2LF4 A;  3G1I A;  3MGE A;  1AUM A;  3DS3 A;  3DS2 A;  5HGN A;  2ONT A;  3G26 A;  4COP A;  3G28 A;  4U0F A;  1EOQ A;  4M0I A;  2JYL A;  3DTJ A;  4U0C A;  4U0E A;  1QRJ A;  2XV6 A;  4XFZ A;  5DCK A;  3VRL C;  5HGO A;  3DS1 A;  3LRY A;  3NTE A;  3DPH A;  1D1D A;  3G29 A;  3DS5 A;  3G1G A;  4IPY A;  1EIA A;  4XRQ A;  5HGM A;  1A43 A;  5JPA A;  3G0V A;  3DS4 A;  2BUO A;  4QNB A;  4U0B A;  1A8O A;  5HGL A;  5I4T G;  3G21 A;  4WYM A;  4XRO A;  4COC A;  2M8P A;  2JO0 A;  3P05 A;  2EIA A;  4PH1 A; 
#chains in the Genus database with same CATH topology
 4XFX A;  2MR7 A;  2LML A;  4R0M A;  2KOQ A;  2KGC A;  1UJZ A;  1QVG O;  2FAE A;  3I55 P;  2PEM A;  4BPF A;  4U0E A;  1QRJ A;  2PEK A;  5HV8 A;  1DNY A;  2MY5 A;  2CG5 B;  3NTE A;  3RG2 A;  3G1G A;  1IMQ A;  1N8R Q;  3CC2 P;  4XRO A;  1Q81 Q;  4COC A;  2M8P A;  1RNI A;  3P05 A;  2KOS A;  2GYK A;  2EIA A;  2DGY A;  2VLP A;  2KOD A;  2OTJ P;  4PH0 A;  3OW2 O;  1VQO P;  3CME P;  2MF4 A;  3MGE A;  2FVA A;  3E2D A;  2PEQ A;  1EOQ A;  4XFZ A;  1GPJ A;  1VQ5 P;  1M90 Q;  2JGP A;  4QNB A;  1Q82 Q;  4BPG A;  1OR5 A;  5F2N A;  3CD6 P;  2KOO A;  3RG6 C;  3G1I A;  5HVC A;  2N98 A;  2LL8 A;  4COP A;  1YI2 P;  2XV6 A;  5EJD A;  3CXC O;  1FR2 A;  4F37 A;  2XZ0 D;  2E1M A;  1GXH A;  3CE7 A;  5EW5 E;  3B5I A;  2JBG A;  1HY8 A;  2CWO A;  3CCV P;  4U0D A;  4H2Y C;  4U0A A;  1Q7Y Q;  1L0I A;  1AF8 A;  1MZ8 A;  2MVU A;  2KGA A;  1K9M Q;  2LPK A;  4U0F A;  4NEO A;  3CC7 P;  2AFE A;  3DS5 A;  1VQ6 P;  1EIA A;  2N6Y A;  1NJI Q;  3G21 A;  2KW2 A;  3CCJ P;  1CEI A;  1ZNV A;  2KG9 A;  3H4E A;  2FAC A;  2KOP A;  5HGN A;  3CC4 P;  2MD9 A;  2KGE A;  1K73 Q;  2GDW A;  1M74 A;  3DTJ A;  3U43 A;  2PNG A;  3DS1 A;  5HGM A;  5JPA A;  3GKL C;  4WYM A;  2N5H A;  2KR5 A;  1M6E X;  1BAJ A;  2GZE A;  2K93 A;  2FVE A;  1VQL P;  3DS3 A;  1YHQ P;  3CCU P;  2JYL A;  2CNR A;  2MR8 A;  2ROQ A;  1DV5 A;  2AF8 A;  2VLQ A;  1A43 A;  3DS4 A;  2M5R A;  3HZQ A;  1KQS O;  2CQ8 A;  2EG5 A;  1KD1 Q;  2LTE A;  2QEX P;  1BXI A;  3CPW O;  3DS2 A;  3EJB A;  3LRY A;  2L9F A;  2KGD A;  1Q86 Q;  2PEJ A;  1S72 P;  1IMP A;  2BHV A;  2VSQ A;  2L0Q A;  2K92 A;  3CCL P;  2FHS C;  3CCQ P;  3G4S P;  2OAR A;  1YJN P;  2KWL A;  7CEI A;  2EHT A;  5HGO A;  3DPH A;  2ERH A;  1ZMB A;  1YJW P;  2Z44 A;  5KP6 B;  2BUO A;  4QKO A;  3CCE P;  2K0X A;  1VQ9 P;  2GZF A;  3EJE A;  4UHP B;  1W2B O;  2KG6 A;  4CA3 A;  1VQP P;  5KP8 B;  2FVF A;  3G71 P;  2AVA A;  4IPY A;  4XRQ A;  2K0D X;  2P9X A;  2AFD A;  2L22 A;  4GR2 A;  1KC8 Q;  4XFY A;  2GZI A;  2WPT A;  4PWV B;  1GXG A;  2VLN A;  2JU2 A;  1T8K A;  1JJ2 O;  1VQM P;  2VLO A;  1F80 D;  3I56 P;  3GZL A;  3LMO A;  5F2K A;  2XXM A;  1VQ8 P;  3G6E P;  1VKU A;  1AUM A;  1IUQ A;  4M0I A;  2NO8 A;  3CCR P;  1QVF O;  1X3O A;  1K8A Q;  2EHS A;  2FQ0 A;  4PH1 A;  3NY7 B;  4MRT C;  2FQ2 A;  5BS2 A;  4GR6 A;  5DCK A;  2N5I A;  4DG9 A;  1HQB A;  3Q20 A;  5F2O A;  3CCS P;  3M1M A;  2DNW A;  5HGL A;  2KOR A;  4BPH A;  2Z45 A;  2N50 A;  2JAZ A;  2M8N A;  3H47 A;  1ACP A;  2EFJ A;  2QA4 P;  2LF4 A;  2QNW A;  3GZM A;  3G26 A;  4PXH B;  5BS1 A;  3G28 A;  1VHN A;  4U0C A;  2LKI A;  1VQN P;  1RO2 A;  1VQK P;  2GZG A;  3HYB A;  1RO0 A;  4H2X C;  5I4T G;  4H2W C;  2FAD A;  2N6Z A;  1M1K Q;  1UNK A;  3CMA P;  2JO0 A;  2K0Y A;  1K30 A;  2CGQ A;  2GDY A;  2M8L A;  1Z6M A;  1KLP A;  2ONT A;  2FQ1 A;  1AYI A;  2L4B A;  3WBH A;  2KG8 A;  3G0V A;  1YIT P;  2PEI A;  2XT1 A;  2JQ4 A;  3EJD A;  1E6J P;  1NQ4 A;  2L6E A;  5KP7 B;  2LIW A;  2Z46 A;  1E0H A;  4IZ6 A;  3CCM P;  2K2Q A;  1VQ4 P;  1EMV A;  2OTL P;  3H0D A;  2GZJ A;  1D1D A;  4HKG A;  3G29 A;  2K5X A;  4U0B A;  1L0H A;  1M6N A;  2PY8 A;  3GJN A;  2LOL A;  3DS0 A;  2JYG A;  5CZD B;  2JU1 A;  1VQ7 P;  1YIJ P;  3B4Q A;  3VRL C;  2XZ1 C;  2MVV A;  2PEO A;  2X2B A;  2JB0 A;  2PEN A;  1YJ9 P;  1A8O A;  2LIU A;  2K94 A;  2GDX A; 
#chains in the Genus database with same CATH homology
 4XFX A;  2Z45 A;  2M8N A;  3H47 A;  3CCJ P;  1VQ9 P;  2EFJ A;  2QA4 P;  3H4E A;  1QVG O;  2LF4 A;  5HGN A;  1W2B O;  3I55 P;  2PEM A;  3G26 A;  5BS1 A;  3CC4 P;  3G28 A;  1K73 Q;  4U0C A;  1M74 A;  3DTJ A;  4U0E A;  1QRJ A;  2PEK A;  1VQP P;  3G71 P;  3DS1 A;  3NTE A;  1VQN P;  1RO2 A;  3G1G A;  4IPY A;  4XRQ A;  1N8R Q;  1VQK P;  3HYB A;  5HGM A;  1RO0 A;  5JPA A;  5I4T G;  3CC2 P;  1M1K Q;  4WYM A;  4XRO A;  1Q81 Q;  4COC A;  2P9X A;  2M8P A;  3CMA P;  2JO0 A;  1RNI A;  3P05 A;  2EIA A;  4GR2 A;  2DGY A;  1K30 A;  1M6E X;  4XFY A;  1BAJ A;  2KOD A;  1KC8 Q;  2OTJ P;  4PH0 A;  2M8L A;  3OW2 O;  1VQO P;  1VQL P;  3CME P;  3MGE A;  3DS3 A;  2ONT A;  3E2D A;  1YHQ P;  3CCU P;  2PEQ A;  1EOQ A;  2JYL A;  4XFZ A;  1VQ5 P;  1M90 Q;  1JJ2 O;  1A43 A;  3WBH A;  3G0V A;  3DS4 A;  1VQM P;  4QNB A;  1Q82 Q;  3HZQ A;  1YIT P;  1KQS O;  2PEI A;  2XT1 A;  3I56 P;  1E6J P;  5F2N A;  5F2K A;  2EG5 A;  1KD1 Q;  2L6E A;  2XXM A;  1VQ8 P;  3CD6 P;  2QEX P;  3RG6 C;  3G6E P;  2Z46 A;  3G1I A;  3CPW O;  1AUM A;  3DS2 A;  4COP A;  3CCM P;  1IUQ A;  4M0I A;  1YI2 P;  2XV6 A;  1VQ4 P;  3CXC O;  3LRY A;  3CCR P;  2OTL P;  3H0D A;  1D1D A;  2E1M A;  3G29 A;  1QVF O;  4U0B A;  1Q86 Q;  2PEJ A;  1K8A Q;  1S72 P;  3B5I A;  1M6N A;  2BHV A;  4PH1 A;  2PY8 A;  2CWO A;  3CCV P;  4U0D A;  4U0A A;  1Q7Y Q;  3DS0 A;  3CCL P;  2JYG A;  5BS2 A;  3CCQ P;  1VQ7 P;  1YIJ P;  3G4S P;  1K9M Q;  4U0F A;  2OAR A;  1YJN P;  4GR6 A;  5DCK A;  3VRL C;  3Q20 A;  5F2O A;  5HGO A;  2PEO A;  3CC7 P;  3CCS P;  3DPH A;  3DS5 A;  1ZMB A;  3M1M A;  1VQ6 P;  1EIA A;  2Z44 A;  1YJW P;  5HGL A;  1YJ9 P;  2BUO A;  2PEN A;  1A8O A;  1NJI Q;  3G21 A;  3CCE P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...