2JU2A

Minimized mean solution structure of the acyl carrier protein domain from module 2 of 6-deoxyerythronolide b synthase (debs)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
GSHMLRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPFKELGFDSLAAVRLRNLLNAATGLRLPSTLVFDHPNASAVAGFLDAELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and proposed domain domain recognition interface of an acyl carrier protein domain from a modular polyketide synthase.
pubmed doi rcsb
source organism Saccharopolyspora erythraea
molecule tags Transferase
molecule keywords Erythronolide synthase
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 2.3.1.94: 6-deoxyerythronolide-B synthase.
pdb deposition date 2007-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ju2A00
2KOOA 2FQ2A 1DV5A 2M5RA 3GZMA 4PXHB 2KOPA 2FHSC 1HQBA 2MY5A 2GDYA 2L9FA 3RG2A 2ROQA 3CE7A 2XZ1C 4BPGA 2KGAA 2FVFA 2N6ZA 2QNWA 2L0QA 5HVCA 2N6YA 4H2WC 2LTEA 2FADA 2FVAA 2N5HA 2CG5B 2KGCA 2FQ1A 2MF4A 3EJEA 2N5IA 2LIUA 4MRTC 2LPKA 1AF8A 2EHTA 1F80D 2VSQA 4CA3A 2DNWA 2LKIA 3EJDA 2KGEA 2FAEA 2L22A 4PWVB 1KLPA 2FACA 2K92A 2LL8A 2KGDA 2JU2A 2GDXA 2KW2A 2KOQA 2K94A 4BPHA 1DNYA 2AFDA 5EJDA 2FVEA 4BPFA 1T8KA 2K93A 1ACPA 3GZLA 2KG6A 2MD9A 4H2XC 2JQ4A 2KOSA 2LMLA 2L4BA 2GDWA 2MVVA 2CQ8A 4R0MA 4DG9A 2KG9A 2FQ0A 1VKUA 2AVAA 4IZ6A 3LMOA 2AFEA 2K2QA 4HKGA 2JU1A 2MR7A 2KG8A 4H2YC 2KWLA 2JGPA 2CNRA 5HV8A 2N50A 1L0IA 2K0YA 1NQ4A 1OR5A 1HY8A 2MR8A 4NEOA 2PNGA 5CZDB 3EJBA 2KORA 2X2BA 2KR5A 2K0XA 2EHSA 2CGQA 2N98A 2MVUA 3NY7B 2LIWA 5KP8B 2XZ0D 1L0HA 1X3OA 5KP6B 2LOLA 5KP7B 2AF8A
chains in the Genus database with same CATH superfamily
1EMVA 2KOOA 2FQ2A 3CD6P 2M5RA 1HQBA 2MY5A 2GDYA 1VQOP 3RG2A 2ROQA 2PENA 2OTLP 3G6EP 2K0DX 3OW2O 5HVCA 3G1IA 2FVAA 2N5HA 1VQ9P 4XFXA 3EJEA 2GZIA 1E6JP 2LIUA 4MRTC 2LPKA 2L6EA 4CA3A 1VQ4P 3EJDA 1MZ8A 3G71P 4PWVB 2FACA 2K92A 2JO0A 1CEIA 3HYBA 2JU2A 2KOQA 3DS5A 1M74A 5F2NA 1KD1Q 1ACPA 5HGNA 1IUQA 2JQ4A 2L4BA 2JBGA 1VQ7P 2JAZA 3GKLC 2VLQA 1VKUA 4IZ6A 4M0IA 2ERHA 3G0VA 2JU1A 2MR7A 3CC4P 4COCA 2KG8A 2JGPA 2CNRA 2WPTA 1M6EX 1L0IA 2EG5A 4U0CA 2QEXP 3Q20A 1VQ5P 1W2BO 3G28A 2VLOA 2XXMA 3DS3A 2CGQA 2XZ0D 1Q7YQ 2PEQA 5HGMA 1L0HA 1Q82Q 1X3OA 2GYKA 4QKOA 3GZMA 1YITP 2BHVA 4PXHB 2DGYA 2KOPA 2FHSC 1GPJA 2XZ1C 4XFYA 2JYLA 2KGAA 3CCUP 1VQLP 3CCJP 1A8OA 3NTEA 2FADA 5BS2A 2CG5B 3U43A 2KGCA 2PEKA 1UJZA 2EFJA 1YJ9P 2VSQA 1F80D 2DNWA 1QRJA 4U0BA 2FAEA 2L22A 1VQNP 2LL8A 3H0DA 1M6NA 2GDXA 2GZGA 2KW2A 2K94A 1DNYA 4GR6A 1BXIA 2FVEA 3CC7P 3GZLA 1VQPP 3CC2P 2Z45A 1BAJA 1YJWP 4R0MA 1ZNVA 2PY8A 1Q86Q 3CXCO 2PEJA 3B4QA 3LMOA 3WBHA 2M8LA 2AFEA 2K2QA 2EIAA 5I4TG 4U0EA 3DPHA 3DS0A 2N50A 1K8AQ 2K0YA 1HY8A 2GZFA 2JYGA 3G1GA 4QNBA 2K5XA 3H4EA 2N98A 2MVUA 2OTJP 3CMAP 4XRQA 1DV5A 3G29A 3G26A 2NO8A 2ONTA 3CCQP 1KQSO 1AYIA 2VLNA 2L9FA 5HGLA 2XV6A 4PH0A 1YIJP 3CCMP 1A43A 2GZEA 4IPYA 1GXGA 2L0QA 1K9MQ 2LTEA 4XROA 2OARA 2FQ1A 2MF4A 3CCLP 1AF8A 2EHTA 2LKIA 2KGEA 4WYMA 1KLPA 2LF4A 1AUMA 1M90Q 2XT1A 4BPHA 5EJDA 1VQMP 3DS2A 3RG6C 1T8KA 1S72P 2K93A 1QVGO 1K73Q 4H2XC 2JB0A 2KOSA 4GR2A 5JPAA 5DCKA 3GJNA 3VRLC 3M1MA 2CQ8A 3E2DA 3H47A 1GXHA 1E0HA 4XFZA 4H2YC 3CCEP 1UNKA 2Z44A 4UHPB 2MR8A 4NEOA 2PNGA 3CMEP 3EJBA 4U0FA 3CCSP 2KORA 1ZMBA 2K0XA 2EHSA 3CCVP 3G4SP 2LIWA 5KP8B 5KP6B 2AF8A 3MGEA 1M1KQ 1RO0A 1VQKP 2M8NA 1YJNP 2VLPA 7CEIA 1N8RQ 1FR2A 2PEOA 3CE7A 1JJ2O 3DS1A 4BPGA 2FVFA 2N6ZA 2QNWA 2E1MA 1IMPA 1D1DA 2N6YA 3DS4A 5EW5E 1QVFO 4H2WC 4COPA 1VQ8P 1Q81Q 2N5IA 5F2OA 3CPWO 2CWOA 1VHNA 3I55P 3CCRP 3G21A 1IMQA 5BS1A 2GZJA 2KGDA 1Z6MA 1EIAA 2AFDA 4F37A 4BPFA 2PEMA 2KG6A 3HZQA 2QA4P 2MD9A 5F2KA 1RO2A 3DTJA 2LMLA 2GDWA 4U0DA 2MVVA 1EOQA 4DG9A 2KG9A 3P05A 2M8PA 2FQ0A 1YI2P 2AVAA 1RNIA 1NJIQ 4HKGA 1K30A 2PEIA 4U0AA 2KWLA 3LRYA 1YHQP 1KC8Q 3B5IA 5HV8A 2P9XA 1NQ4A 1OR5A 3I56P 5CZDB 2BUOA 2X2BA 2KR5A 2KODA 5HGOA 3NY7B 2Z46A 4PH1A 2LOLA 5KP7B 1VQ6P
chains in the Genus database with same CATH topology
2KOOA 2FQ2A 1DV5A 2M5RA 3GZMA 4PXHB 2KOPA 2FHSC 1HQBA 2MY5A 2GDYA 2L9FA 3RG2A 2ROQA 3CE7A 2XZ1C 4BPGA 2KGAA 2FVFA 2N6ZA 2QNWA 2L0QA 5HVCA 2N6YA 4H2WC 2LTEA 2FADA 2FVAA 2N5HA 2CG5B 2KGCA 2FQ1A 2MF4A 3EJEA 2N5IA 2LIUA 4MRTC 2LPKA 1AF8A 2EHTA 1F80D 2VSQA 4CA3A 2DNWA 2LKIA 3EJDA 2KGEA 2FAEA 2L22A 4PWVB 1KLPA 2FACA 2K92A 2LL8A 2KGDA 2JU2A 2GDXA 2KW2A 2KOQA 2K94A 4BPHA 1DNYA 2AFDA 5EJDA 2FVEA 4BPFA 1T8KA 2K93A 1ACPA 3GZLA 2KG6A 2MD9A 4H2XC 2JQ4A 2KOSA 2LMLA 2L4BA 2GDWA 2MVVA 2CQ8A 4R0MA 4DG9A 2KG9A 2FQ0A 1VKUA 2AVAA 4IZ6A 3LMOA 2AFEA 2K2QA 4HKGA 2JU1A 2MR7A 2KG8A 4H2YC 2KWLA 2JGPA 2CNRA 5HV8A 2N50A 1L0IA 2K0YA 1NQ4A 1OR5A 1HY8A 2MR8A 4NEOA 2PNGA 5CZDB 3EJBA 2KORA 2X2BA 2KR5A 2K0XA 2EHSA 2CGQA 2N98A 2MVUA 3NY7B 2LIWA 5KP8B 2XZ0D 1L0HA 1X3OA 5KP6B 2LOLA 5KP7B 2AF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOO A;  2FQ2 A;  1DV5 A;  2M5R A;  3GZM A;  4PXH B;  2KOP A;  2FHS C;  1HQB A;  2MY5 A;  2GDY A;  2L9F A;  3RG2 A;  2ROQ A;  3CE7 A;  2XZ1 C;  4BPG A;  2KGA A;  2FVF A;  2N6Z A;  2QNW A;  2L0Q A;  5HVC A;  2N6Y A;  4H2W C;  2LTE A;  2FAD A;  2FVA A;  2N5H A;  2CG5 B;  2KGC A;  2FQ1 A;  2MF4 A;  3EJE A;  2N5I A;  2LIU A;  4MRT C;  2LPK A;  1AF8 A;  2EHT A;  1F80 D;  2VSQ A;  4CA3 A;  2DNW A;  2LKI A;  3EJD A;  2KGE A;  2FAE A;  2L22 A;  4PWV B;  1KLP A;  2FAC A;  2K92 A;  2LL8 A;  2KGD A;  2JU2 A;  2GDX A;  2KW2 A;  2KOQ A;  2K94 A;  4BPH A;  1DNY A;  2AFD A;  5EJD A;  2FVE A;  4BPF A;  1T8K A;  2K93 A;  1ACP A;  3GZL A;  2KG6 A;  2MD9 A;  4H2X C;  2JQ4 A;  2KOS A;  2LML A;  2L4B A;  2GDW A;  2MVV A;  2CQ8 A;  4R0M A;  4DG9 A;  2KG9 A;  2FQ0 A;  1VKU A;  2AVA A;  4IZ6 A;  3LMO A;  2AFE A;  2K2Q A;  4HKG A;  2JU1 A;  2MR7 A;  2KG8 A;  4H2Y C;  2KWL A;  2JGP A;  2CNR A;  5HV8 A;  2N50 A;  1L0I A;  2K0Y A;  1NQ4 A;  1OR5 A;  1HY8 A;  2MR8 A;  4NEO A;  2PNG A;  5CZD B;  3EJB A;  2KOR A;  2X2B A;  2KR5 A;  2K0X A;  2EHS A;  2CGQ A;  2N98 A;  2MVU A;  3NY7 B;  2LIW A;  5KP8 B;  2XZ0 D;  1L0H A;  1X3O A;  5KP6 B;  2LOL A;  5KP7 B;  2AF8 A; 
#chains in the Genus database with same CATH topology
 1EMV A;  2KOO A;  2FQ2 A;  3CD6 P;  2M5R A;  1HQB A;  2MY5 A;  2GDY A;  1VQO P;  3RG2 A;  2ROQ A;  2PEN A;  2OTL P;  3G6E P;  2K0D X;  3OW2 O;  5HVC A;  3G1I A;  2FVA A;  2N5H A;  1VQ9 P;  4XFX A;  3EJE A;  2GZI A;  1E6J P;  2LIU A;  4MRT C;  2LPK A;  2L6E A;  4CA3 A;  1VQ4 P;  3EJD A;  1MZ8 A;  3G71 P;  4PWV B;  2FAC A;  2K92 A;  2JO0 A;  1CEI A;  3HYB A;  2JU2 A;  2KOQ A;  3DS5 A;  1M74 A;  5F2N A;  1KD1 Q;  1ACP A;  5HGN A;  1IUQ A;  2JQ4 A;  2L4B A;  2JBG A;  1VQ7 P;  2JAZ A;  3GKL C;  2VLQ A;  1VKU A;  4IZ6 A;  4M0I A;  2ERH A;  3G0V A;  2JU1 A;  2MR7 A;  3CC4 P;  4COC A;  2KG8 A;  2JGP A;  2CNR A;  2WPT A;  1M6E X;  1L0I A;  2EG5 A;  4U0C A;  2QEX P;  3Q20 A;  1VQ5 P;  1W2B O;  3G28 A;  2VLO A;  2XXM A;  3DS3 A;  2CGQ A;  2XZ0 D;  1Q7Y Q;  2PEQ A;  5HGM A;  1L0H A;  1Q82 Q;  1X3O A;  2GYK A;  4QKO A;  3GZM A;  1YIT P;  2BHV A;  4PXH B;  2DGY A;  2KOP A;  2FHS C;  1GPJ A;  2XZ1 C;  4XFY A;  2JYL A;  2KGA A;  3CCU P;  1VQL P;  3CCJ P;  1A8O A;  3NTE A;  2FAD A;  5BS2 A;  2CG5 B;  3U43 A;  2KGC A;  2PEK A;  1UJZ A;  2EFJ A;  1YJ9 P;  2VSQ A;  1F80 D;  2DNW A;  1QRJ A;  4U0B A;  2FAE A;  2L22 A;  1VQN P;  2LL8 A;  3H0D A;  1M6N A;  2GDX A;  2GZG A;  2KW2 A;  2K94 A;  1DNY A;  4GR6 A;  1BXI A;  2FVE A;  3CC7 P;  3GZL A;  1VQP P;  3CC2 P;  2Z45 A;  1BAJ A;  1YJW P;  4R0M A;  1ZNV A;  2PY8 A;  1Q86 Q;  3CXC O;  2PEJ A;  3B4Q A;  3LMO A;  3WBH A;  2M8L A;  2AFE A;  2K2Q A;  2EIA A;  5I4T G;  4U0E A;  3DPH A;  3DS0 A;  2N50 A;  1K8A Q;  2K0Y A;  1HY8 A;  2GZF A;  2JYG A;  3G1G A;  4QNB A;  2K5X A;  3H4E A;  2N98 A;  2MVU A;  2OTJ P;  3CMA P;  4XRQ A;  1DV5 A;  3G29 A;  3G26 A;  2NO8 A;  2ONT A;  3CCQ P;  1KQS O;  1AYI A;  2VLN A;  2L9F A;  5HGL A;  2XV6 A;  4PH0 A;  1YIJ P;  3CCM P;  1A43 A;  2GZE A;  4IPY A;  1GXG A;  2L0Q A;  1K9M Q;  2LTE A;  4XRO A;  2OAR A;  2FQ1 A;  2MF4 A;  3CCL P;  1AF8 A;  2EHT A;  2LKI A;  2KGE A;  4WYM A;  1KLP A;  2LF4 A;  1AUM A;  1M90 Q;  2XT1 A;  4BPH A;  5EJD A;  1VQM P;  3DS2 A;  3RG6 C;  1T8K A;  1S72 P;  2K93 A;  1QVG O;  1K73 Q;  4H2X C;  2JB0 A;  2KOS A;  4GR2 A;  5JPA A;  5DCK A;  3GJN A;  3VRL C;  3M1M A;  2CQ8 A;  3E2D A;  3H47 A;  1GXH A;  1E0H A;  4XFZ A;  4H2Y C;  3CCE P;  1UNK A;  2Z44 A;  4UHP B;  2MR8 A;  4NEO A;  2PNG A;  3CME P;  3EJB A;  4U0F A;  3CCS P;  2KOR A;  1ZMB A;  2K0X A;  2EHS A;  3CCV P;  3G4S P;  2LIW A;  5KP8 B;  5KP6 B;  2AF8 A;  3MGE A;  1M1K Q;  1RO0 A;  1VQK P;  2M8N A;  1YJN P;  2VLP A;  7CEI A;  1N8R Q;  1FR2 A;  2PEO A;  3CE7 A;  1JJ2 O;  3DS1 A;  4BPG A;  2FVF A;  2N6Z A;  2QNW A;  2E1M A;  1IMP A;  1D1D A;  2N6Y A;  3DS4 A;  5EW5 E;  1QVF O;  4H2W C;  4COP A;  1VQ8 P;  1Q81 Q;  2N5I A;  5F2O A;  3CPW O;  2CWO A;  1VHN A;  3I55 P;  3CCR P;  3G21 A;  1IMQ A;  5BS1 A;  2GZJ A;  2KGD A;  1Z6M A;  1EIA A;  2AFD A;  4F37 A;  4BPF A;  2PEM A;  2KG6 A;  3HZQ A;  2QA4 P;  2MD9 A;  5F2K A;  1RO2 A;  3DTJ A;  2LML A;  2GDW A;  4U0D A;  2MVV A;  1EOQ A;  4DG9 A;  2KG9 A;  3P05 A;  2M8P A;  2FQ0 A;  1YI2 P;  2AVA A;  1RNI A;  1NJI Q;  4HKG A;  1K30 A;  2PEI A;  4U0A A;  2KWL A;  3LRY A;  1YHQ P;  1KC8 Q;  3B5I A;  5HV8 A;  2P9X A;  1NQ4 A;  1OR5 A;  3I56 P;  5CZD B;  2BUO A;  2X2B A;  2KR5 A;  2KOD A;  5HGO A;  3NY7 B;  2Z46 A;  4PH1 A;  2LOL A;  5KP7 B;  1VQ6 P; 
#chains in the Genus database with same CATH homology
 2KOO A;  2FQ2 A;  1DV5 A;  2M5R A;  3GZM A;  4PXH B;  2KOP A;  2FHS C;  1HQB A;  2MY5 A;  2GDY A;  2L9F A;  3RG2 A;  2ROQ A;  3CE7 A;  2XZ1 C;  4BPG A;  2KGA A;  2FVF A;  2N6Z A;  2QNW A;  2L0Q A;  5HVC A;  2N6Y A;  4H2W C;  2LTE A;  2FAD A;  2FVA A;  2N5H A;  2CG5 B;  2KGC A;  2FQ1 A;  2MF4 A;  3EJE A;  2N5I A;  2LIU A;  4MRT C;  2LPK A;  1AF8 A;  2EHT A;  1F80 D;  2VSQ A;  4CA3 A;  2DNW A;  2LKI A;  3EJD A;  2KGE A;  2FAE A;  2L22 A;  4PWV B;  1KLP A;  2FAC A;  2K92 A;  2LL8 A;  2KGD A;  2JU2 A;  2GDX A;  2KW2 A;  2KOQ A;  2K94 A;  4BPH A;  1DNY A;  2AFD A;  5EJD A;  2FVE A;  4BPF A;  1T8K A;  2K93 A;  1ACP A;  3GZL A;  2KG6 A;  2MD9 A;  4H2X C;  2JQ4 A;  2KOS A;  2LML A;  2L4B A;  2GDW A;  2MVV A;  2CQ8 A;  4R0M A;  4DG9 A;  2KG9 A;  2FQ0 A;  1VKU A;  2AVA A;  4IZ6 A;  3LMO A;  2AFE A;  2K2Q A;  4HKG A;  2JU1 A;  2MR7 A;  2KG8 A;  4H2Y C;  2KWL A;  2JGP A;  2CNR A;  5HV8 A;  2N50 A;  1L0I A;  2K0Y A;  1NQ4 A;  1OR5 A;  1HY8 A;  2MR8 A;  4NEO A;  2PNG A;  5CZD B;  3EJB A;  2KOR A;  2X2B A;  2KR5 A;  2K0X A;  2EHS A;  2CGQ A;  2N98 A;  2MVU A;  3NY7 B;  2LIW A;  5KP8 B;  2XZ0 D;  1L0H A;  1X3O A;  5KP6 B;  2LOL A;  5KP7 B;  2AF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...