2JU2A

Minimized mean solution structure of the acyl carrier protein domain from module 2 of 6-deoxyerythronolide b synthase (debs)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
GSHMLRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPFKELGFDSLAAVRLRNLLNAATGLRLPSTLVFDHPNASAVAGFLDAELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythronolide synthase
publication title Solution structure and proposed domain domain recognition interface of an acyl carrier protein domain from a modular polyketide synthase.
pubmed doi rcsb
source organism Saccharopolyspora erythraea
molecule tags Transferase
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 2.3.1.94: 6-deoxyerythronolide-B synthase.
pdb deposition date 2007-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ju2A00
1L0HA 2N5HA 2KG9A 3EJDA 2MF4A 1VKUA 2KOQA 4IZ6A 1X3OA 2CG5B 2KGCA 2MR7A 2KG8A 4HKGA 1L0IA 3EJEA 2GDXA 2AVAA 2MD9A 2N98A 4NEOA 2KW2A 2M5RA 2MVUA 2GDYA 1DNYA 2FAEA 2ROQA 2FADA 2CNRA 2FQ2A 2PNGA 4CA3A 4R0MA 2MR8A 2LIUA 1F80D 5HVCA 2K93A 2L9FA 2FVFA 3RG2A 2KWLA 2XZ0D 2MVVA 2QNWA 1ACPA 2KOSA 2LOLA 2K0YA 2XZ1C 1HQBA 2JU1A 2LL8A 2N6ZA 4H2XC 1HY8A 5KP7B 2KGEA 2LTEA 2AFEA 2JQ4A 2KR5A 2EHTA 2L0QA 3LMOA 2KOOA 2KGAA 4H2WC 2CQ8A 2EHSA 5EJDA 3GZLA 2L4BA 2L22A 2AFDA 4BPGA 2DNWA 4PXHB 1OR5A 1AF8A 5CZDB 5HV8A 2KGDA 2K2QA 5KP8B 4MRTC 1NQ4A 2LKIA 4DG9A 3EJBA 2CGQA 2GDWA 2N5IA 2LPKA 2FVEA 2N6YA 2KG6A 2MY5A 3GZMA 2LIWA 2N50A 2JU2A 2VSQA 2X2BA 2K92A 2JGPA 1KLPA 2K94A 3NY7B 2FQ1A 2AF8A 2FACA 4BPFA 1DV5A 2K0XA 4H2YC 4PWVB 3CE7A 4BPHA 2FHSC 2KOPA 2FVAA 2FQ0A 5KP6B 2KORA 1T8KA 2LMLA
chains in the Genus database with same CATH superfamily
1L0HA 2KG9A 1IMPA 2Z46A 2XT1A 3CD6P 2CG5B 2KGCA 1VQ4P 4HKGA 1L0IA 2GDXA 2XV6A 3CPWO 1VQ7P 2Z44A 4F37A 2PEIA 2ROQA 1Q86Q 2CNRA 2PNGA 4CA3A 1Q7YQ 1KD1Q 1M1KQ 2L9FA 3CCEP 3DTJA 1M6EX 1Q81Q 2K0YA 2GYKA 2XZ1C 2JU1A 2LL8A 1BAJA 3H0DA 5EW5E 2KR5A 4QNBA 1K30A 2KOOA 4H2WC 1YI2P 1AUMA 2CQ8A 2L4BA 2L22A 2E1MA 2GZFA 2KGDA 5KP8B 4MRTC 1NQ4A 4DG9A 4U0CA 3Q20A 4COCA 2EG5A 1K8AQ 2N5IA 1EMVA 2Z45A 3I55P 3P05A 3G6EP 2KG6A 2MY5A 1VQOP 2N50A 2JU2A 3CCSP 1N8RQ 1KLPA 2JYGA 2K94A 4QKOA 2AF8A 1VQMP 2FACA 1YHQP 4U0FA 2VLPA 4XFZA 4XROA 3CCQP 3G4SP 1BXIA 3CC2P 2K0DX 3G1IA 5HGNA 2JBGA 2KOQA 2QEXP 2N98A 4NEOA 1Z6MA 2KW2A 1VQLP 3DS2A 2FAEA 3RG6C 2PEKA 3MGEA 2MR8A 3H47A 1VQ9P 3H4EA 1K9MQ 5BS1A 2K93A 3GKLC 2FVFA 3RG2A 2KWLA 2XZ0D 2QNWA 2GZEA 2EFJA 1HY8A 1YITP 2M8PA 2KGEA 3CCMP 3OW2O 5HGLA 3HYBA 2BUOA 3CC7P 3LMOA 3DS3A 3GZLA 1VQ5P 4BPGA 1QRJA 2DNWA 1OR5A 1AF8A 1A43A 2JYLA 2LKIA 3CMEP 5HGOA 1RNIA 1EOQA 3DS0A 2LIWA 2CWOA 1IMQA 3U43A 4BPFA 2K0XA 3B5IA 5F2OA 2ONTA 3CE7A 2LF4A 1VQ6P 1VHNA 2KOPA 1KC8Q 2FVAA 3DS1A 3NTEA 2PY8A 5KP6B 2P9XA 2KORA 4PH0A 2LMLA 2KODA 2N5HA 1M74A 2MF4A 1VKUA 2KG8A 5F2NA 3EJEA 1VQ8P 1GXGA 2AVAA 2MD9A 2M5RA 2GDYA 2FADA 2FQ2A 4GR2A 2LIUA 1F80D 3LRYA 2OARA 1ZMBA 3E2DA 3DPHA 2MVVA 1E6JP 3CCLP 1GPJA 2KOSA 2QA4P 4U0AA 1IUQA 3G21A 5JPAA 3HZQA 1YJWP 2K5XA 3M1MA 5EJDA 1D1DA 3CCRP 2AFDA 1VQKP 1KQSO 1VQPP 4XFXA 1A8OA 3WBHA 1JJ2O 2GDWA 1AYIA 2M8LA 2LPKA 2FVEA 3VRLC 2N6YA 1UNKA 3GZMA 3G1GA 4XRQA 2PEJA 1W2BO 2JGPA 2VLQA 3GJNA 1CEIA 3G0VA 3NY7B 2FQ1A 1M6NA 4H2YC 4WYMA 1YJNP 1RO2A 2NO8A 3DS5A 1QVFO 4BPHA 2FHSC 1UJZA 4IPYA 4GR6A 4U0DA 4M0IA 3EJDA 2PEOA 3CCVP 4IZ6A 1X3OA 5I4TG 2XXMA 2MR7A 1Q82Q 1M90Q 2JO0A 1NJIQ 2MVUA 1DNYA 2PEMA 1E0HA 4U0BA 4R0MA 3CXCO 1FR2A 2DGYA 3CMAP 5HVCA 4XFYA 4U0EA 2VLNA 2PENA 3I56P 2GZIA 2GZJA 1YIJP 1ACPA 2LOLA 1HQBA 1RO0A 2N6ZA 4H2XC 1MZ8A 2JB0A 5KP7B 2LTEA 2AFEA 3CCUP 2JQ4A 2EHTA 2EIAA 2L0QA 2M8NA 2KGAA 2WPTA 2EHSA 4PXHB 5CZDB 5HV8A 2K2QA 7CEIA 2GZGA 3B4QA 2PEQA 2BHVA 3EJBA 2CGQA 3G71P 1YJ9P 2VLOA 2L6EA 1GXHA 3G29A 2OTJP 3G26A 5BS2A 1VQNP 1S72P 4PH1A 3CC4P 2VSQA 3G28A 2X2BA 2K92A 1QVGO 3DS4A 2ERHA 1EIAA 1ZNVA 5HGMA 1K73Q 2OTLP 1DV5A 5DCKA 4PWVB 4UHPB 3CCJP 2JAZA 2FQ0A 4COPA 1T8KA 5F2KA
chains in the Genus database with same CATH topology
1L0HA 2N5HA 2KG9A 3EJDA 2MF4A 1VKUA 2KOQA 4IZ6A 1X3OA 2CG5B 2KGCA 2MR7A 2KG8A 4HKGA 1L0IA 3EJEA 2GDXA 2AVAA 2MD9A 2N98A 4NEOA 2KW2A 2M5RA 2MVUA 2GDYA 1DNYA 2FAEA 2ROQA 2FADA 2CNRA 2FQ2A 2PNGA 4CA3A 4R0MA 2MR8A 2LIUA 1F80D 5HVCA 2K93A 2L9FA 2FVFA 3RG2A 2KWLA 2XZ0D 2MVVA 2QNWA 1ACPA 2KOSA 2LOLA 2K0YA 2XZ1C 1HQBA 2JU1A 2LL8A 2N6ZA 4H2XC 1HY8A 5KP7B 2KGEA 2LTEA 2AFEA 2JQ4A 2KR5A 2EHTA 2L0QA 3LMOA 2KOOA 2KGAA 4H2WC 2CQ8A 2EHSA 5EJDA 3GZLA 2L4BA 2L22A 2AFDA 4BPGA 2DNWA 4PXHB 1OR5A 1AF8A 5CZDB 5HV8A 2KGDA 2K2QA 5KP8B 4MRTC 1NQ4A 2LKIA 4DG9A 3EJBA 2CGQA 2GDWA 2N5IA 2LPKA 2FVEA 2N6YA 2KG6A 2MY5A 3GZMA 2LIWA 2N50A 2JU2A 2VSQA 2X2BA 2K92A 2JGPA 1KLPA 2K94A 3NY7B 2FQ1A 2AF8A 2FACA 4BPFA 1DV5A 2K0XA 4H2YC 4PWVB 3CE7A 4BPHA 2FHSC 2KOPA 2FVAA 2FQ0A 5KP6B 2KORA 1T8KA 2LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0H A;  2N5H A;  2KG9 A;  3EJD A;  2MF4 A;  1VKU A;  2KOQ A;  4IZ6 A;  1X3O A;  2CG5 B;  2KGC A;  2MR7 A;  2KG8 A;  4HKG A;  1L0I A;  3EJE A;  2GDX A;  2AVA A;  2MD9 A;  2N98 A;  4NEO A;  2KW2 A;  2M5R A;  2MVU A;  2GDY A;  1DNY A;  2FAE A;  2ROQ A;  2FAD A;  2CNR A;  2FQ2 A;  2PNG A;  4CA3 A;  4R0M A;  2MR8 A;  2LIU A;  1F80 D;  5HVC A;  2K93 A;  2L9F A;  2FVF A;  3RG2 A;  2KWL A;  2XZ0 D;  2MVV A;  2QNW A;  1ACP A;  2KOS A;  2LOL A;  2K0Y A;  2XZ1 C;  1HQB A;  2JU1 A;  2LL8 A;  2N6Z A;  4H2X C;  1HY8 A;  5KP7 B;  2KGE A;  2LTE A;  2AFE A;  2JQ4 A;  2KR5 A;  2EHT A;  2L0Q A;  3LMO A;  2KOO A;  2KGA A;  4H2W C;  2CQ8 A;  2EHS A;  5EJD A;  3GZL A;  2L4B A;  2L22 A;  2AFD A;  4BPG A;  2DNW A;  4PXH B;  1OR5 A;  1AF8 A;  5CZD B;  5HV8 A;  2KGD A;  2K2Q A;  5KP8 B;  4MRT C;  1NQ4 A;  2LKI A;  4DG9 A;  3EJB A;  2CGQ A;  2GDW A;  2N5I A;  2LPK A;  2FVE A;  2N6Y A;  2KG6 A;  2MY5 A;  3GZM A;  2LIW A;  2N50 A;  2JU2 A;  2VSQ A;  2X2B A;  2K92 A;  2JGP A;  1KLP A;  2K94 A;  3NY7 B;  2FQ1 A;  2AF8 A;  2FAC A;  4BPF A;  1DV5 A;  2K0X A;  4H2Y C;  4PWV B;  3CE7 A;  4BPH A;  2FHS C;  2KOP A;  2FVA A;  2FQ0 A;  5KP6 B;  2KOR A;  1T8K A;  2LML A; 
#chains in the Genus database with same CATH topology
 1L0H A;  2KG9 A;  1IMP A;  2Z46 A;  2XT1 A;  3CD6 P;  2CG5 B;  2KGC A;  1VQ4 P;  4HKG A;  1L0I A;  2GDX A;  2XV6 A;  3CPW O;  1VQ7 P;  2Z44 A;  4F37 A;  2PEI A;  2ROQ A;  1Q86 Q;  2CNR A;  2PNG A;  4CA3 A;  1Q7Y Q;  1KD1 Q;  1M1K Q;  2L9F A;  3CCE P;  3DTJ A;  1M6E X;  1Q81 Q;  2K0Y A;  2GYK A;  2XZ1 C;  2JU1 A;  2LL8 A;  1BAJ A;  3H0D A;  5EW5 E;  2KR5 A;  4QNB A;  1K30 A;  2KOO A;  4H2W C;  1YI2 P;  1AUM A;  2CQ8 A;  2L4B A;  2L22 A;  2E1M A;  2GZF A;  2KGD A;  5KP8 B;  4MRT C;  1NQ4 A;  4DG9 A;  4U0C A;  3Q20 A;  4COC A;  2EG5 A;  1K8A Q;  2N5I A;  1EMV A;  2Z45 A;  3I55 P;  3P05 A;  3G6E P;  2KG6 A;  2MY5 A;  1VQO P;  2N50 A;  2JU2 A;  3CCS P;  1N8R Q;  1KLP A;  2JYG A;  2K94 A;  4QKO A;  2AF8 A;  1VQM P;  2FAC A;  1YHQ P;  4U0F A;  2VLP A;  4XFZ A;  4XRO A;  3CCQ P;  3G4S P;  1BXI A;  3CC2 P;  2K0D X;  3G1I A;  5HGN A;  2JBG A;  2KOQ A;  2QEX P;  2N98 A;  4NEO A;  1Z6M A;  2KW2 A;  1VQL P;  3DS2 A;  2FAE A;  3RG6 C;  2PEK A;  3MGE A;  2MR8 A;  3H47 A;  1VQ9 P;  3H4E A;  1K9M Q;  5BS1 A;  2K93 A;  3GKL C;  2FVF A;  3RG2 A;  2KWL A;  2XZ0 D;  2QNW A;  2GZE A;  2EFJ A;  1HY8 A;  1YIT P;  2M8P A;  2KGE A;  3CCM P;  3OW2 O;  5HGL A;  3HYB A;  2BUO A;  3CC7 P;  3LMO A;  3DS3 A;  3GZL A;  1VQ5 P;  4BPG A;  1QRJ A;  2DNW A;  1OR5 A;  1AF8 A;  1A43 A;  2JYL A;  2LKI A;  3CME P;  5HGO A;  1RNI A;  1EOQ A;  3DS0 A;  2LIW A;  2CWO A;  1IMQ A;  3U43 A;  4BPF A;  2K0X A;  3B5I A;  5F2O A;  2ONT A;  3CE7 A;  2LF4 A;  1VQ6 P;  1VHN A;  2KOP A;  1KC8 Q;  2FVA A;  3DS1 A;  3NTE A;  2PY8 A;  5KP6 B;  2P9X A;  2KOR A;  4PH0 A;  2LML A;  2KOD A;  2N5H A;  1M74 A;  2MF4 A;  1VKU A;  2KG8 A;  5F2N A;  3EJE A;  1VQ8 P;  1GXG A;  2AVA A;  2MD9 A;  2M5R A;  2GDY A;  2FAD A;  2FQ2 A;  4GR2 A;  2LIU A;  1F80 D;  3LRY A;  2OAR A;  1ZMB A;  3E2D A;  3DPH A;  2MVV A;  1E6J P;  3CCL P;  1GPJ A;  2KOS A;  2QA4 P;  4U0A A;  1IUQ A;  3G21 A;  5JPA A;  3HZQ A;  1YJW P;  2K5X A;  3M1M A;  5EJD A;  1D1D A;  3CCR P;  2AFD A;  1VQK P;  1KQS O;  1VQP P;  4XFX A;  1A8O A;  3WBH A;  1JJ2 O;  2GDW A;  1AYI A;  2M8L A;  2LPK A;  2FVE A;  3VRL C;  2N6Y A;  1UNK A;  3GZM A;  3G1G A;  4XRQ A;  2PEJ A;  1W2B O;  2JGP A;  2VLQ A;  3GJN A;  1CEI A;  3G0V A;  3NY7 B;  2FQ1 A;  1M6N A;  4H2Y C;  4WYM A;  1YJN P;  1RO2 A;  2NO8 A;  3DS5 A;  1QVF O;  4BPH A;  2FHS C;  1UJZ A;  4IPY A;  4GR6 A;  4U0D A;  4M0I A;  3EJD A;  2PEO A;  3CCV P;  4IZ6 A;  1X3O A;  5I4T G;  2XXM A;  2MR7 A;  1Q82 Q;  1M90 Q;  2JO0 A;  1NJI Q;  2MVU A;  1DNY A;  2PEM A;  1E0H A;  4U0B A;  4R0M A;  3CXC O;  1FR2 A;  2DGY A;  3CMA P;  5HVC A;  4XFY A;  4U0E A;  2VLN A;  2PEN A;  3I56 P;  2GZI A;  2GZJ A;  1YIJ P;  1ACP A;  2LOL A;  1HQB A;  1RO0 A;  2N6Z A;  4H2X C;  1MZ8 A;  2JB0 A;  5KP7 B;  2LTE A;  2AFE A;  3CCU P;  2JQ4 A;  2EHT A;  2EIA A;  2L0Q A;  2M8N A;  2KGA A;  2WPT A;  2EHS A;  4PXH B;  5CZD B;  5HV8 A;  2K2Q A;  7CEI A;  2GZG A;  3B4Q A;  2PEQ A;  2BHV A;  3EJB A;  2CGQ A;  3G71 P;  1YJ9 P;  2VLO A;  2L6E A;  1GXH A;  3G29 A;  2OTJ P;  3G26 A;  5BS2 A;  1VQN P;  1S72 P;  4PH1 A;  3CC4 P;  2VSQ A;  3G28 A;  2X2B A;  2K92 A;  1QVG O;  3DS4 A;  2ERH A;  1EIA A;  1ZNV A;  5HGM A;  1K73 Q;  2OTL P;  1DV5 A;  5DCK A;  4PWV B;  4UHP B;  3CCJ P;  2JAZ A;  2FQ0 A;  4COP A;  1T8K A;  5F2K A; 
#chains in the Genus database with same CATH homology
 1L0H A;  2N5H A;  2KG9 A;  3EJD A;  2MF4 A;  1VKU A;  2KOQ A;  4IZ6 A;  1X3O A;  2CG5 B;  2KGC A;  2MR7 A;  2KG8 A;  4HKG A;  1L0I A;  3EJE A;  2GDX A;  2AVA A;  2MD9 A;  2N98 A;  4NEO A;  2KW2 A;  2M5R A;  2MVU A;  2GDY A;  1DNY A;  2FAE A;  2ROQ A;  2FAD A;  2CNR A;  2FQ2 A;  2PNG A;  4CA3 A;  4R0M A;  2MR8 A;  2LIU A;  1F80 D;  5HVC A;  2K93 A;  2L9F A;  2FVF A;  3RG2 A;  2KWL A;  2XZ0 D;  2MVV A;  2QNW A;  1ACP A;  2KOS A;  2LOL A;  2K0Y A;  2XZ1 C;  1HQB A;  2JU1 A;  2LL8 A;  2N6Z A;  4H2X C;  1HY8 A;  5KP7 B;  2KGE A;  2LTE A;  2AFE A;  2JQ4 A;  2KR5 A;  2EHT A;  2L0Q A;  3LMO A;  2KOO A;  2KGA A;  4H2W C;  2CQ8 A;  2EHS A;  5EJD A;  3GZL A;  2L4B A;  2L22 A;  2AFD A;  4BPG A;  2DNW A;  4PXH B;  1OR5 A;  1AF8 A;  5CZD B;  5HV8 A;  2KGD A;  2K2Q A;  5KP8 B;  4MRT C;  1NQ4 A;  2LKI A;  4DG9 A;  3EJB A;  2CGQ A;  2GDW A;  2N5I A;  2LPK A;  2FVE A;  2N6Y A;  2KG6 A;  2MY5 A;  3GZM A;  2LIW A;  2N50 A;  2JU2 A;  2VSQ A;  2X2B A;  2K92 A;  2JGP A;  1KLP A;  2K94 A;  3NY7 B;  2FQ1 A;  2AF8 A;  2FAC A;  4BPF A;  1DV5 A;  2K0X A;  4H2Y C;  4PWV B;  3CE7 A;  4BPH A;  2FHS C;  2KOP A;  2FVA A;  2FQ0 A;  5KP6 B;  2KOR A;  1T8K A;  2LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...