2JU2A

Minimized mean solution structure of the acyl carrier protein domain from module 2 of 6-deoxyerythronolide b synthase (debs)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
GSHMLRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPFKELGFDSLAAVRLRNLLNAATGLRLPSTLVFDHPNASAVAGFLDAELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythronolide synthase
publication title Solution structure and proposed domain domain recognition interface of an acyl carrier protein domain from a modular polyketide synthase.
pubmed doi rcsb
source organism Saccharopolyspora erythraea
molecule tags Transferase
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 2.3.1.94: 6-deoxyerythronolide-B synthase.
pdb deposition date 2007-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ju2A00
2L4BA 4CA3A 2LTEA 2N6ZA 2KW2A 2JGPA 2EHTA 1DV5A 1OR5A 2FQ1A 2KG8A 2KR5A 2EHSA 1HQBA 4BPFA 1F80D 1HY8A 2KGDA 2N5HA 3LMOA 2MF4A 1KLPA 2KOOA 3EJEA 5KP8B 2DNWA 4H2YC 2K94A 2ROQA 5KP7B 2MD9A 2KOQA 2N98A 4PXHB 4NEOA 2KGAA 2KG6A 2CQ8A 2CG5B 2LIWA 2XZ1C 2CGQA 3CE7A 5CZDB 3RG2A 4BPHA 2N5IA 1T8KA 1L0IA 2FVAA 2KG9A 2LOLA 2X2BA 2JU2A 1DNYA 2QNWA 2FAEA 2GDWA 3GZMA 4R0MA 2MR7A 2GDXA 2JQ4A 2LIUA 2N50A 2K0YA 2XZ0D 2FQ0A 2KOPA 2KOSA 2AVAA 2MVVA 4H2XC 2AFDA 2FACA 2JU1A 4IZ6A 2FVFA 2AFEA 2FVEA 2L22A 4MRTC 1ACPA 2K2QA 1L0HA 3NY7B 3EJDA 2FHSC 2MR8A 1VKUA 2K93A 4DG9A 3EJBA 2PNGA 2KORA 1NQ4A 2L9FA 4BPGA 2KGEA 4PWVB 2CNRA 2LPKA 2VSQA 3GZLA 4H2WC 2KGCA 2FQ2A 2N6YA 2K92A 5EJDA 2FADA 2M5RA 2AF8A 2GDYA 2L0QA 2MY5A 2LL8A 2KWLA 2MVUA 4HKGA 5HV8A 2LMLA 5KP6B 5HVCA 1X3OA 2K0XA 1AF8A 2LKIA
chains in the Genus database with same CATH superfamily
3I55P 4U0FA 2L4BA 2Z44A 2LTEA 3H47A 4COPA 2KW2A 5BS2A 1M6NA 2E1MA 2EHTA 2EG5A 1DV5A 2EHSA 1KQSO 2BHVA 2K5XA 2N5HA 3U43A 3LMOA 1UNKA 3EJEA 4H2YC 3G1GA 1K30A 3LRYA 3CMAP 2K0DX 5EW5E 3GKLC 1YI2P 1A43A 2KODA 2XXMA 2CWOA 3DS1A 4QNBA 1VQ5P 2P9XA 5HGNA 2N5IA 3CMEP 2FVAA 2KG9A 2WPTA 2JU2A 5DCKA 2JYGA 4U0AA 2JQ4A 2LIUA 2XZ0D 2FQ0A 2KOPA 1YHQP 3CD6P 2JU1A 2FVEA 2QA4P 4MRTC 2K2QA 1NJIQ 1YJWP 2VLOA 1CEIA 3EJDA 2FHSC 3G29A 4DG9A 3G71P 3DTJA 5JPAA 4BPGA 1W2BO 2GZJA 2VSQA 3DS0A 3CC4P 2N6YA 1BXIA 5EJDA 1FR2A 2GDYA 3CCJP 2L0QA 2LF4A 4HKGA 3DPHA 3DS5A 1X3OA 3E2DA 5I4TG 4U0BA 4CA3A 3M1MA 3NTEA 3MGEA 4M0IA 2N6ZA 2JBGA 3G0VA 1VQ4P 1OR5A 2KG8A 2KR5A 1F80D 2GZEA 1HY8A 4IPYA 3CCQP 2KOOA 3CC7P 5KP8B 2ROQA 2KOQA 2N98A 2CG5B 3DS3A 2CGQA 5CZDB 1VQKP 3RG2A 3H4EA 2PEOA 3B5IA 1L0IA 1RO2A 2BUOA 1EIAA 2FAEA 2GZFA 2PENA 1IMQA 3G6EP 3GZMA 1K8AQ 4PH0A 3H0DA 2GZIA 2OTLP 1M90Q 2MVVA 4H2XC 1VHNA 4XFXA 2FACA 2FVFA 1EMVA 2L22A 2EFJA 1ACPA 1KD1Q 3DS4A 1GPJA 1YJ9P 3DS2A 1VKUA 3OW2O 3EJBA 1M1KQ 2KGEA 4PWVB 3GZLA 2PEJA 2M5RA 1AYIA 3P05A 1A8OA 2LL8A 1EOQA 2MVUA 3B4QA 1VQPP 2VLNA 2LMLA 7CEIA 5KP6B 4XROA 1AF8A 3CCRP 2ERHA 2ONTA 1IMPA 2XT1A 2JGPA 4U0EA 2XV6A 2VLPA 2FQ1A 1M6EX 1HQBA 4BPFA 5F2KA 2DNWA 5KP7B 3G21A 2M8NA 4GR6A 4WYMA 4PXHB 4NEOA 2QEXP 2KGAA 3HZQA 2LIWA 1VQLP 4U0DA 1VQ9P 5HGOA 3WBHA 1VQ7P 2GDWA 4R0MA 5BS1A 2JYLA 2MR7A 2GDXA 3G4SP 2NO8A 2N50A 3G28A 1VQMP 2L6EA 3G26A 2KOSA 4COCA 1Q7YQ 2AFDA 2OARA 2PEIA 1VQ8P 3VRLC 1K9MQ 2PY8A 1YIJP 1ZMBA 3GJNA 3CCVP 1UJZA 2DGYA 3NY7B 1RO0A 2PEKA 2MR8A 1QRJA 1Q82Q 2PNGA 2CNRA 2LPKA 2OTJP 3G1IA 2FADA 4XFZA 2MY5A 1JJ2O 2KWLA 2VLQA 5F2OA 1YJNP 1Q86Q 2K0XA 2LKIA 3HYBA 2PEQA 1VQOP 1K73Q 1ZNVA 3CC2P 2Z45A 1S72P 2M8PA 3CCSP 2GYKA 2KGDA 4XRQA 2MF4A 1KLPA 1Z6MA 1VQ6P 2M8LA 2K94A 2MD9A 4GR2A 2KG6A 2CQ8A 1D1DA 2JB0A 1M74A 1RNIA 5F2NA 2XZ1C 3CE7A 4BPHA 1T8KA 2LOLA 2X2BA 2GZGA 1BAJA 3I56P 2QNWA 1DNYA 1QVGO 4U0CA 4QKOA 2K0YA 1KC8Q 1E0HA 2Z46A 3CPWO 2AVAA 5HGLA 1IUQA 4IZ6A 3CCLP 3CXCO 2AFEA 2JAZA 3CCUP 3RG6C 1GXHA 3CCMP 2PEMA 1L0HA 1YITP 3Q20A 4F37A 3CCEP 1VQNP 2K93A 4PH1A 2KORA 5HGMA 1NQ4A 2L9FA 1AUMA 4XFYA 4H2WC 2KGCA 2FQ2A 1E6JP 2K92A 1QVFO 4UHPB 2AF8A 2JO0A 1GXGA 2EIAA 5HV8A 1Q81Q 1N8RQ 5HVCA 1MZ8A
chains in the Genus database with same CATH topology
2L4BA 4CA3A 2LTEA 2N6ZA 2KW2A 2JGPA 2EHTA 1DV5A 1OR5A 2FQ1A 2KG8A 2KR5A 2EHSA 1HQBA 4BPFA 1F80D 1HY8A 2KGDA 2N5HA 3LMOA 2MF4A 1KLPA 2KOOA 3EJEA 5KP8B 2DNWA 4H2YC 2K94A 2ROQA 5KP7B 2MD9A 2KOQA 2N98A 4PXHB 4NEOA 2KGAA 2KG6A 2CQ8A 2CG5B 2LIWA 2XZ1C 2CGQA 3CE7A 5CZDB 3RG2A 4BPHA 2N5IA 1T8KA 1L0IA 2FVAA 2KG9A 2LOLA 2X2BA 2JU2A 1DNYA 2QNWA 2FAEA 2GDWA 3GZMA 4R0MA 2MR7A 2GDXA 2JQ4A 2LIUA 2N50A 2K0YA 2XZ0D 2FQ0A 2KOPA 2KOSA 2AVAA 2MVVA 4H2XC 2AFDA 2FACA 2JU1A 4IZ6A 2FVFA 2AFEA 2FVEA 2L22A 4MRTC 1ACPA 2K2QA 1L0HA 3NY7B 3EJDA 2FHSC 2MR8A 1VKUA 2K93A 4DG9A 3EJBA 2PNGA 2KORA 1NQ4A 2L9FA 4BPGA 2KGEA 4PWVB 2CNRA 2LPKA 2VSQA 3GZLA 4H2WC 2KGCA 2FQ2A 2N6YA 2K92A 5EJDA 2FADA 2M5RA 2AF8A 2GDYA 2L0QA 2MY5A 2LL8A 2KWLA 2MVUA 4HKGA 5HV8A 2LMLA 5KP6B 5HVCA 1X3OA 2K0XA 1AF8A 2LKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4B A;  4CA3 A;  2LTE A;  2N6Z A;  2KW2 A;  2JGP A;  2EHT A;  1DV5 A;  1OR5 A;  2FQ1 A;  2KG8 A;  2KR5 A;  2EHS A;  1HQB A;  4BPF A;  1F80 D;  1HY8 A;  2KGD A;  2N5H A;  3LMO A;  2MF4 A;  1KLP A;  2KOO A;  3EJE A;  5KP8 B;  2DNW A;  4H2Y C;  2K94 A;  2ROQ A;  5KP7 B;  2MD9 A;  2KOQ A;  2N98 A;  4PXH B;  4NEO A;  2KGA A;  2KG6 A;  2CQ8 A;  2CG5 B;  2LIW A;  2XZ1 C;  2CGQ A;  3CE7 A;  5CZD B;  3RG2 A;  4BPH A;  2N5I A;  1T8K A;  1L0I A;  2FVA A;  2KG9 A;  2LOL A;  2X2B A;  2JU2 A;  1DNY A;  2QNW A;  2FAE A;  2GDW A;  3GZM A;  4R0M A;  2MR7 A;  2GDX A;  2JQ4 A;  2LIU A;  2N50 A;  2K0Y A;  2XZ0 D;  2FQ0 A;  2KOP A;  2KOS A;  2AVA A;  2MVV A;  4H2X C;  2AFD A;  2FAC A;  2JU1 A;  4IZ6 A;  2FVF A;  2AFE A;  2FVE A;  2L22 A;  4MRT C;  1ACP A;  2K2Q A;  1L0H A;  3NY7 B;  3EJD A;  2FHS C;  2MR8 A;  1VKU A;  2K93 A;  4DG9 A;  3EJB A;  2PNG A;  2KOR A;  1NQ4 A;  2L9F A;  4BPG A;  2KGE A;  4PWV B;  2CNR A;  2LPK A;  2VSQ A;  3GZL A;  4H2W C;  2KGC A;  2FQ2 A;  2N6Y A;  2K92 A;  5EJD A;  2FAD A;  2M5R A;  2AF8 A;  2GDY A;  2L0Q A;  2MY5 A;  2LL8 A;  2KWL A;  2MVU A;  4HKG A;  5HV8 A;  2LML A;  5KP6 B;  5HVC A;  1X3O A;  2K0X A;  1AF8 A;  2LKI A; 
#chains in the Genus database with same CATH topology
 3I55 P;  4U0F A;  2L4B A;  2Z44 A;  2LTE A;  3H47 A;  4COP A;  2KW2 A;  5BS2 A;  1M6N A;  2E1M A;  2EHT A;  2EG5 A;  1DV5 A;  2EHS A;  1KQS O;  2BHV A;  2K5X A;  2N5H A;  3U43 A;  3LMO A;  1UNK A;  3EJE A;  4H2Y C;  3G1G A;  1K30 A;  3LRY A;  3CMA P;  2K0D X;  5EW5 E;  3GKL C;  1YI2 P;  1A43 A;  2KOD A;  2XXM A;  2CWO A;  3DS1 A;  4QNB A;  1VQ5 P;  2P9X A;  5HGN A;  2N5I A;  3CME P;  2FVA A;  2KG9 A;  2WPT A;  2JU2 A;  5DCK A;  2JYG A;  4U0A A;  2JQ4 A;  2LIU A;  2XZ0 D;  2FQ0 A;  2KOP A;  1YHQ P;  3CD6 P;  2JU1 A;  2FVE A;  2QA4 P;  4MRT C;  2K2Q A;  1NJI Q;  1YJW P;  2VLO A;  1CEI A;  3EJD A;  2FHS C;  3G29 A;  4DG9 A;  3G71 P;  3DTJ A;  5JPA A;  4BPG A;  1W2B O;  2GZJ A;  2VSQ A;  3DS0 A;  3CC4 P;  2N6Y A;  1BXI A;  5EJD A;  1FR2 A;  2GDY A;  3CCJ P;  2L0Q A;  2LF4 A;  4HKG A;  3DPH A;  3DS5 A;  1X3O A;  3E2D A;  5I4T G;  4U0B A;  4CA3 A;  3M1M A;  3NTE A;  3MGE A;  4M0I A;  2N6Z A;  2JBG A;  3G0V A;  1VQ4 P;  1OR5 A;  2KG8 A;  2KR5 A;  1F80 D;  2GZE A;  1HY8 A;  4IPY A;  3CCQ P;  2KOO A;  3CC7 P;  5KP8 B;  2ROQ A;  2KOQ A;  2N98 A;  2CG5 B;  3DS3 A;  2CGQ A;  5CZD B;  1VQK P;  3RG2 A;  3H4E A;  2PEO A;  3B5I A;  1L0I A;  1RO2 A;  2BUO A;  1EIA A;  2FAE A;  2GZF A;  2PEN A;  1IMQ A;  3G6E P;  3GZM A;  1K8A Q;  4PH0 A;  3H0D A;  2GZI A;  2OTL P;  1M90 Q;  2MVV A;  4H2X C;  1VHN A;  4XFX A;  2FAC A;  2FVF A;  1EMV A;  2L22 A;  2EFJ A;  1ACP A;  1KD1 Q;  3DS4 A;  1GPJ A;  1YJ9 P;  3DS2 A;  1VKU A;  3OW2 O;  3EJB A;  1M1K Q;  2KGE A;  4PWV B;  3GZL A;  2PEJ A;  2M5R A;  1AYI A;  3P05 A;  1A8O A;  2LL8 A;  1EOQ A;  2MVU A;  3B4Q A;  1VQP P;  2VLN A;  2LML A;  7CEI A;  5KP6 B;  4XRO A;  1AF8 A;  3CCR P;  2ERH A;  2ONT A;  1IMP A;  2XT1 A;  2JGP A;  4U0E A;  2XV6 A;  2VLP A;  2FQ1 A;  1M6E X;  1HQB A;  4BPF A;  5F2K A;  2DNW A;  5KP7 B;  3G21 A;  2M8N A;  4GR6 A;  4WYM A;  4PXH B;  4NEO A;  2QEX P;  2KGA A;  3HZQ A;  2LIW A;  1VQL P;  4U0D A;  1VQ9 P;  5HGO A;  3WBH A;  1VQ7 P;  2GDW A;  4R0M A;  5BS1 A;  2JYL A;  2MR7 A;  2GDX A;  3G4S P;  2NO8 A;  2N50 A;  3G28 A;  1VQM P;  2L6E A;  3G26 A;  2KOS A;  4COC A;  1Q7Y Q;  2AFD A;  2OAR A;  2PEI A;  1VQ8 P;  3VRL C;  1K9M Q;  2PY8 A;  1YIJ P;  1ZMB A;  3GJN A;  3CCV P;  1UJZ A;  2DGY A;  3NY7 B;  1RO0 A;  2PEK A;  2MR8 A;  1QRJ A;  1Q82 Q;  2PNG A;  2CNR A;  2LPK A;  2OTJ P;  3G1I A;  2FAD A;  4XFZ A;  2MY5 A;  1JJ2 O;  2KWL A;  2VLQ A;  5F2O A;  1YJN P;  1Q86 Q;  2K0X A;  2LKI A;  3HYB A;  2PEQ A;  1VQO P;  1K73 Q;  1ZNV A;  3CC2 P;  2Z45 A;  1S72 P;  2M8P A;  3CCS P;  2GYK A;  2KGD A;  4XRQ A;  2MF4 A;  1KLP A;  1Z6M A;  1VQ6 P;  2M8L A;  2K94 A;  2MD9 A;  4GR2 A;  2KG6 A;  2CQ8 A;  1D1D A;  2JB0 A;  1M74 A;  1RNI A;  5F2N A;  2XZ1 C;  3CE7 A;  4BPH A;  1T8K A;  2LOL A;  2X2B A;  2GZG A;  1BAJ A;  3I56 P;  2QNW A;  1DNY A;  1QVG O;  4U0C A;  4QKO A;  2K0Y A;  1KC8 Q;  1E0H A;  2Z46 A;  3CPW O;  2AVA A;  5HGL A;  1IUQ A;  4IZ6 A;  3CCL P;  3CXC O;  2AFE A;  2JAZ A;  3CCU P;  3RG6 C;  1GXH A;  3CCM P;  2PEM A;  1L0H A;  1YIT P;  3Q20 A;  4F37 A;  3CCE P;  1VQN P;  2K93 A;  4PH1 A;  2KOR A;  5HGM A;  1NQ4 A;  2L9F A;  1AUM A;  4XFY A;  4H2W C;  2KGC A;  2FQ2 A;  1E6J P;  2K92 A;  1QVF O;  4UHP B;  2AF8 A;  2JO0 A;  1GXG A;  2EIA A;  5HV8 A;  1Q81 Q;  1N8R Q;  5HVC A;  1MZ8 A; 
#chains in the Genus database with same CATH homology
 2L4B A;  4CA3 A;  2LTE A;  2N6Z A;  2KW2 A;  2JGP A;  2EHT A;  1DV5 A;  1OR5 A;  2FQ1 A;  2KG8 A;  2KR5 A;  2EHS A;  1HQB A;  4BPF A;  1F80 D;  1HY8 A;  2KGD A;  2N5H A;  3LMO A;  2MF4 A;  1KLP A;  2KOO A;  3EJE A;  5KP8 B;  2DNW A;  4H2Y C;  2K94 A;  2ROQ A;  5KP7 B;  2MD9 A;  2KOQ A;  2N98 A;  4PXH B;  4NEO A;  2KGA A;  2KG6 A;  2CQ8 A;  2CG5 B;  2LIW A;  2XZ1 C;  2CGQ A;  3CE7 A;  5CZD B;  3RG2 A;  4BPH A;  2N5I A;  1T8K A;  1L0I A;  2FVA A;  2KG9 A;  2LOL A;  2X2B A;  2JU2 A;  1DNY A;  2QNW A;  2FAE A;  2GDW A;  3GZM A;  4R0M A;  2MR7 A;  2GDX A;  2JQ4 A;  2LIU A;  2N50 A;  2K0Y A;  2XZ0 D;  2FQ0 A;  2KOP A;  2KOS A;  2AVA A;  2MVV A;  4H2X C;  2AFD A;  2FAC A;  2JU1 A;  4IZ6 A;  2FVF A;  2AFE A;  2FVE A;  2L22 A;  4MRT C;  1ACP A;  2K2Q A;  1L0H A;  3NY7 B;  3EJD A;  2FHS C;  2MR8 A;  1VKU A;  2K93 A;  4DG9 A;  3EJB A;  2PNG A;  2KOR A;  1NQ4 A;  2L9F A;  4BPG A;  2KGE A;  4PWV B;  2CNR A;  2LPK A;  2VSQ A;  3GZL A;  4H2W C;  2KGC A;  2FQ2 A;  2N6Y A;  2K92 A;  5EJD A;  2FAD A;  2M5R A;  2AF8 A;  2GDY A;  2L0Q A;  2MY5 A;  2LL8 A;  2KWL A;  2MVU A;  4HKG A;  5HV8 A;  2LML A;  5KP6 B;  5HVC A;  1X3O A;  2K0X A;  1AF8 A;  2LKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...