2JU2A

Minimized mean solution structure of the acyl carrier protein domain from module 2 of 6-deoxyerythronolide b synthase (debs)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
b'GSHMLRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPFKELGFDSLAAVRLRNLLNAATGLRLPSTLVFDHPNASAVAGFLDAELG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Erythronolide synthase
publication title Solution structure and proposed domain domain recognition interface of an acyl carrier protein domain from a modular polyketide synthase.
pubmed doi rcsb
source organism Saccharopolyspora erythraea
molecule tags Transferase
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 2.3.1.94: 6-deoxyerythronolide-B synthase.
pdb deposition date 2007-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ju2A00
2LOLA 2QNWA 4DG9A 2DNWA 3EJEA 2GDXA 2K0XA 2KG8A 4PXHB 2LMLA 1L0IA 4NEOA 2CG5B 2KORA 2KOQA 3EJDA 2AFDA 2JU1A 2XZ0D 5HVCA 2MD9A 1VKUA 4HKGA 2EHTA 2JGPA 2MF4A 1DNYA 2FQ2A 2CNRA 1NQ4A 1X3OA 5KP8B 2N5IA 1OR5A 2GDWA 2LKIA 1HY8A 2MY5A 2KGAA 2M5RA 1T8KA 3GZMA 2KOOA 2AF8A 4CA3A 2FQ1A 2LL8A 2ROQA 2FVEA 2CQ8A 2L9FA 5HV8A 2FQ0A 2EHSA 2K0YA 4BPHA 2N98A 2MVUA 2K2QA 2GDYA 2AVAA 2JU2A 1HQBA 5CZDB 2MVVA 4H2WC 2KG6A 1KLPA 4R0MA 3CE7A 4MRTC 2KOPA 5KP7B 2KOSA 2KGCA 2XZ1C 2LIUA 2KR5A 1L0HA 1ACPA 3EJBA 2JQ4A 2LTEA 2MR8A 2N6ZA 2FAEA 3RG2A 4PWVB 2KW2A 2K92A 2FVAA 2AFEA 2L22A 2VSQA 2PNGA 2X2BA 2LPKA 3LMOA 2KGEA 2KGDA 4H2XC 2L0QA 2N5HA 4BPFA 2CGQA 2N50A 2FHSC 1DV5A 2N6YA 3GZLA 2FADA 1F80D 5EJDA 2K93A 2FACA 2KWLA 1AF8A 4BPGA 2LIWA 2KG9A 2FVFA 4IZ6A 3NY7B 2L4BA 2K94A 5KP6B 4H2YC 2MR7A
chains in the Genus database with same CATH superfamily
4DG9A 2DNWA 4COPA 2Z44A 2GYKA 1YJ9P 2K0XA 2KG8A 3U43A 1K73Q 3G4SP 4NEOA 2KOQA 2GZJA 2DGYA 2MD9A 1VKUA 2EHTA 2PEKA 1VQOP 3B4QA 1NQ4A 2OTJP 3G21A 3CD6P 1EOQA 2MY5A 3DS3A 3Q20A 2M5RA 1T8KA 3GZMA 2VLQA 2BHVA 1YJWP 2CQ8A 1KC8Q 2L9FA 1CEIA 1FR2A 4BPHA 2N98A 2MVUA 3CXCO 1M6EX 5F2NA 2AVAA 2LF4A 3I56P 1S72P 3G28A 2WPTA 3NTEA 3DS1A 4MRTC 2KOPA 2PEJA 5KP7B 3CC2P 2KGCA 1VQ5P 2KR5A 3CCLP 1VHNA 2KW2A 5HGLA 2L22A 5F2OA 5DCKA 2PNGA 2X2BA 2LPKA 2NO8A 3LMOA 3H0DA 3RG6C 3G0VA 1BXIA 2CGQA 1QVFO 1DV5A 2N6YA 2FADA 3CC7P 2KWLA 1K9MQ 2XT1A 2KG9A 1VQ4P 2FVFA 1RNIA 3CCVP 4H2YC 3CCUP 2M8PA 3G26A 1ZMBA 1UNKA 2OTLP 2GZEA 2GDXA 4PXHB 1VQ6P 2L6EA 4U0DA 1L0IA 2JB0A 1E6JP 2XZ0D 1VQPP 1EIAA 1IMQA 2GZIA 1Q7YQ 2JYLA 2M8NA 1DNYA 1VQ9P 1X3OA 2ONTA 4UHPB 2LKIA 3I55P 2KGAA 3CMAP 3E2DA 4CA3A 1YITP 1VQ7P 2PENA 1IUQA 3MGEA 4QKOA 2K2QA 2JU2A 1KQSO 2Z45A 3G29A 3G6EP 3CMEP 2ERHA 2Z46A 4XFZA 1A43A 1L0HA 1YI2P 4XRQA 2N6ZA 2FAEA 1N8RQ 4XFYA 1GXHA 1Z6MA 3RG2A 2PEQA 4M0IA 3GJNA 2EFJA 1EMVA 4H2XC 3GZLA 4GR6A 1D1DA 2K93A 4IZ6A 3DS0A 3NY7B 3DS4A 3GKLC 3DS2A 1ZNVA 4XFXA 2K94A 5HGNA 1GPJA 5HGOA 3G1IA 4XROA 1AYIA 2OARA 4U0EA 2JU1A 2GZGA 3CCQP 1M74A 1RO2A 3B5IA 5KP8B 2N5IA 1VQMP 2K0DX 5BS2A 2AF8A 3CCRP 2FVEA 3CCSP 2CWOA 2FQ0A 1AUMA 4PH0A 1M1KQ 1K8AQ 5F2KA 3CPWO 2JAZA 1M6NA 3G1GA 5CZDB 2MVVA 1YHQP 4H2WC 2KG6A 4R0MA 2KOSA 3CC4P 1M90Q 2PEMA 3HZQA 4F37A 3EJBA 5EW5E 2JQ4A 2LTEA 4PWVB 2K92A 2FVAA 1JJ2O 2E1MA 2VSQA 7CEIA 5BS1A 4U0BA 1E0HA 2KGEA 2KGDA 2L0QA 2N5HA 4U0AA 1YJNP 2N50A 2FHSC 1Q82Q 2XXMA 3LRYA 2VLOA 3H4EA 2PEOA 2FACA 2QA4P 1BAJA 4U0FA 2LIWA 3WBHA 2K5XA 1YIJP 5KP6B 2VLPA 1VQNP 2LOLA 2QNWA 5HGMA 3EJEA 2LMLA 2EIAA 2CG5B 2KORA 3DS5A 3EJDA 1IMPA 2AFDA 3G71P 2GZFA 5HVCA 2JYGA 4HKGA 4IPYA 2M8LA 1VQ8P 2JGPA 3DPHA 5I4TG 2MF4A 1KD1Q 2XV6A 2FQ2A 2CNRA 2PEIA 1OR5A 2GDWA 1HY8A 4QNBA 2KOOA 5JPAA 2FQ1A 2LL8A 1QVGO 2ROQA 1GXGA 5HV8A 2K0YA 2EHSA 2JO0A 1Q81Q 3CCJP 2KODA 1RO0A 3M1MA 1W2BO 2QEXP 2GDYA 1MZ8A 1HQBA 1KLPA 3CCMP 3CE7A 4GR2A 1UJZA 2XZ1C 2LIUA 1ACPA 2EG5A 2MR8A 4U0CA 2BUOA 3DTJA 3P05A 3CCEP 3H47A 2AFEA 2VLNA 3VRLC 2JBGA 2PY8A 1VQLP 1QRJA 3HYBA 4WYMA 4BPFA 1A8OA 4COCA 1NJIQ 1Q86Q 1VQKP 1F80D 5EJDA 1AF8A 4BPGA 3OW2O 2L4BA 1K30A 2P9XA 2MR7A 4PH1A
chains in the Genus database with same CATH topology
2LOLA 2QNWA 4DG9A 2DNWA 3EJEA 2GDXA 2K0XA 2KG8A 4PXHB 2LMLA 1L0IA 4NEOA 2CG5B 2KORA 2KOQA 3EJDA 2AFDA 2JU1A 2XZ0D 5HVCA 2MD9A 1VKUA 4HKGA 2EHTA 2JGPA 2MF4A 1DNYA 2FQ2A 2CNRA 1NQ4A 1X3OA 5KP8B 2N5IA 1OR5A 2GDWA 2LKIA 1HY8A 2MY5A 2KGAA 2M5RA 1T8KA 3GZMA 2KOOA 2AF8A 4CA3A 2FQ1A 2LL8A 2ROQA 2FVEA 2CQ8A 2L9FA 5HV8A 2FQ0A 2EHSA 2K0YA 4BPHA 2N98A 2MVUA 2K2QA 2GDYA 2AVAA 2JU2A 1HQBA 5CZDB 2MVVA 4H2WC 2KG6A 1KLPA 4R0MA 3CE7A 4MRTC 2KOPA 5KP7B 2KOSA 2KGCA 2XZ1C 2LIUA 2KR5A 1L0HA 1ACPA 3EJBA 2JQ4A 2LTEA 2MR8A 2N6ZA 2FAEA 3RG2A 4PWVB 2KW2A 2K92A 2FVAA 2AFEA 2L22A 2VSQA 2PNGA 2X2BA 2LPKA 3LMOA 2KGEA 2KGDA 4H2XC 2L0QA 2N5HA 4BPFA 2CGQA 2N50A 2FHSC 1DV5A 2N6YA 3GZLA 2FADA 1F80D 5EJDA 2K93A 2FACA 2KWLA 1AF8A 4BPGA 2LIWA 2KG9A 2FVFA 4IZ6A 3NY7B 2L4BA 2K94A 5KP6B 4H2YC 2MR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LOL A;  2QNW A;  4DG9 A;  2DNW A;  3EJE A;  2GDX A;  2K0X A;  2KG8 A;  4PXH B;  2LML A;  1L0I A;  4NEO A;  2CG5 B;  2KOR A;  2KOQ A;  3EJD A;  2AFD A;  2JU1 A;  2XZ0 D;  5HVC A;  2MD9 A;  1VKU A;  4HKG A;  2EHT A;  2JGP A;  2MF4 A;  1DNY A;  2FQ2 A;  2CNR A;  1NQ4 A;  1X3O A;  5KP8 B;  2N5I A;  1OR5 A;  2GDW A;  2LKI A;  1HY8 A;  2MY5 A;  2KGA A;  2M5R A;  1T8K A;  3GZM A;  2KOO A;  2AF8 A;  4CA3 A;  2FQ1 A;  2LL8 A;  2ROQ A;  2FVE A;  2CQ8 A;  2L9F A;  5HV8 A;  2FQ0 A;  2EHS A;  2K0Y A;  4BPH A;  2N98 A;  2MVU A;  2K2Q A;  2GDY A;  2AVA A;  2JU2 A;  1HQB A;  5CZD B;  2MVV A;  4H2W C;  2KG6 A;  1KLP A;  4R0M A;  3CE7 A;  4MRT C;  2KOP A;  5KP7 B;  2KOS A;  2KGC A;  2XZ1 C;  2LIU A;  2KR5 A;  1L0H A;  1ACP A;  3EJB A;  2JQ4 A;  2LTE A;  2MR8 A;  2N6Z A;  2FAE A;  3RG2 A;  4PWV B;  2KW2 A;  2K92 A;  2FVA A;  2AFE A;  2L22 A;  2VSQ A;  2PNG A;  2X2B A;  2LPK A;  3LMO A;  2KGE A;  2KGD A;  4H2X C;  2L0Q A;  2N5H A;  4BPF A;  2CGQ A;  2N50 A;  2FHS C;  1DV5 A;  2N6Y A;  3GZL A;  2FAD A;  1F80 D;  5EJD A;  2K93 A;  2FAC A;  2KWL A;  1AF8 A;  4BPG A;  2LIW A;  2KG9 A;  2FVF A;  4IZ6 A;  3NY7 B;  2L4B A;  2K94 A;  5KP6 B;  4H2Y C;  2MR7 A; 
#chains in the Genus database with same CATH topology
 4DG9 A;  2DNW A;  4COP A;  2Z44 A;  2GYK A;  1YJ9 P;  2K0X A;  2KG8 A;  3U43 A;  1K73 Q;  3G4S P;  4NEO A;  2KOQ A;  2GZJ A;  2DGY A;  2MD9 A;  1VKU A;  2EHT A;  2PEK A;  1VQO P;  3B4Q A;  1NQ4 A;  2OTJ P;  3G21 A;  3CD6 P;  1EOQ A;  2MY5 A;  3DS3 A;  3Q20 A;  2M5R A;  1T8K A;  3GZM A;  2VLQ A;  2BHV A;  1YJW P;  2CQ8 A;  1KC8 Q;  2L9F A;  1CEI A;  1FR2 A;  4BPH A;  2N98 A;  2MVU A;  3CXC O;  1M6E X;  5F2N A;  2AVA A;  2LF4 A;  3I56 P;  1S72 P;  3G28 A;  2WPT A;  3NTE A;  3DS1 A;  4MRT C;  2KOP A;  2PEJ A;  5KP7 B;  3CC2 P;  2KGC A;  1VQ5 P;  2KR5 A;  3CCL P;  1VHN A;  2KW2 A;  5HGL A;  2L22 A;  5F2O A;  5DCK A;  2PNG A;  2X2B A;  2LPK A;  2NO8 A;  3LMO A;  3H0D A;  3RG6 C;  3G0V A;  1BXI A;  2CGQ A;  1QVF O;  1DV5 A;  2N6Y A;  2FAD A;  3CC7 P;  2KWL A;  1K9M Q;  2XT1 A;  2KG9 A;  1VQ4 P;  2FVF A;  1RNI A;  3CCV P;  4H2Y C;  3CCU P;  2M8P A;  3G26 A;  1ZMB A;  1UNK A;  2OTL P;  2GZE A;  2GDX A;  4PXH B;  1VQ6 P;  2L6E A;  4U0D A;  1L0I A;  2JB0 A;  1E6J P;  2XZ0 D;  1VQP P;  1EIA A;  1IMQ A;  2GZI A;  1Q7Y Q;  2JYL A;  2M8N A;  1DNY A;  1VQ9 P;  1X3O A;  2ONT A;  4UHP B;  2LKI A;  3I55 P;  2KGA A;  3CMA P;  3E2D A;  4CA3 A;  1YIT P;  1VQ7 P;  2PEN A;  1IUQ A;  3MGE A;  4QKO A;  2K2Q A;  2JU2 A;  1KQS O;  2Z45 A;  3G29 A;  3G6E P;  3CME P;  2ERH A;  2Z46 A;  4XFZ A;  1A43 A;  1L0H A;  1YI2 P;  4XRQ A;  2N6Z A;  2FAE A;  1N8R Q;  4XFY A;  1GXH A;  1Z6M A;  3RG2 A;  2PEQ A;  4M0I A;  3GJN A;  2EFJ A;  1EMV A;  4H2X C;  3GZL A;  4GR6 A;  1D1D A;  2K93 A;  4IZ6 A;  3DS0 A;  3NY7 B;  3DS4 A;  3GKL C;  3DS2 A;  1ZNV A;  4XFX A;  2K94 A;  5HGN A;  1GPJ A;  5HGO A;  3G1I A;  4XRO A;  1AYI A;  2OAR A;  4U0E A;  2JU1 A;  2GZG A;  3CCQ P;  1M74 A;  1RO2 A;  3B5I A;  5KP8 B;  2N5I A;  1VQM P;  2K0D X;  5BS2 A;  2AF8 A;  3CCR P;  2FVE A;  3CCS P;  2CWO A;  2FQ0 A;  1AUM A;  4PH0 A;  1M1K Q;  1K8A Q;  5F2K A;  3CPW O;  2JAZ A;  1M6N A;  3G1G A;  5CZD B;  2MVV A;  1YHQ P;  4H2W C;  2KG6 A;  4R0M A;  2KOS A;  3CC4 P;  1M90 Q;  2PEM A;  3HZQ A;  4F37 A;  3EJB A;  5EW5 E;  2JQ4 A;  2LTE A;  4PWV B;  2K92 A;  2FVA A;  1JJ2 O;  2E1M A;  2VSQ A;  7CEI A;  5BS1 A;  4U0B A;  1E0H A;  2KGE A;  2KGD A;  2L0Q A;  2N5H A;  4U0A A;  1YJN P;  2N50 A;  2FHS C;  1Q82 Q;  2XXM A;  3LRY A;  2VLO A;  3H4E A;  2PEO A;  2FAC A;  2QA4 P;  1BAJ A;  4U0F A;  2LIW A;  3WBH A;  2K5X A;  1YIJ P;  5KP6 B;  2VLP A;  1VQN P;  2LOL A;  2QNW A;  5HGM A;  3EJE A;  2LML A;  2EIA A;  2CG5 B;  2KOR A;  3DS5 A;  3EJD A;  1IMP A;  2AFD A;  3G71 P;  2GZF A;  5HVC A;  2JYG A;  4HKG A;  4IPY A;  2M8L A;  1VQ8 P;  2JGP A;  3DPH A;  5I4T G;  2MF4 A;  1KD1 Q;  2XV6 A;  2FQ2 A;  2CNR A;  2PEI A;  1OR5 A;  2GDW A;  1HY8 A;  4QNB A;  2KOO A;  5JPA A;  2FQ1 A;  2LL8 A;  1QVG O;  2ROQ A;  1GXG A;  5HV8 A;  2K0Y A;  2EHS A;  2JO0 A;  1Q81 Q;  3CCJ P;  2KOD A;  1RO0 A;  3M1M A;  1W2B O;  2QEX P;  2GDY A;  1MZ8 A;  1HQB A;  1KLP A;  3CCM P;  3CE7 A;  4GR2 A;  1UJZ A;  2XZ1 C;  2LIU A;  1ACP A;  2EG5 A;  2MR8 A;  4U0C A;  2BUO A;  3DTJ A;  3P05 A;  3CCE P;  3H47 A;  2AFE A;  2VLN A;  3VRL C;  2JBG A;  2PY8 A;  1VQL P;  1QRJ A;  3HYB A;  4WYM A;  4BPF A;  1A8O A;  4COC A;  1NJI Q;  1Q86 Q;  1VQK P;  1F80 D;  5EJD A;  1AF8 A;  4BPG A;  3OW2 O;  2L4B A;  1K30 A;  2P9X A;  2MR7 A;  4PH1 A; 
#chains in the Genus database with same CATH homology
 2LOL A;  2QNW A;  4DG9 A;  2DNW A;  3EJE A;  2GDX A;  2K0X A;  2KG8 A;  4PXH B;  2LML A;  1L0I A;  4NEO A;  2CG5 B;  2KOR A;  2KOQ A;  3EJD A;  2AFD A;  2JU1 A;  2XZ0 D;  5HVC A;  2MD9 A;  1VKU A;  4HKG A;  2EHT A;  2JGP A;  2MF4 A;  1DNY A;  2FQ2 A;  2CNR A;  1NQ4 A;  1X3O A;  5KP8 B;  2N5I A;  1OR5 A;  2GDW A;  2LKI A;  1HY8 A;  2MY5 A;  2KGA A;  2M5R A;  1T8K A;  3GZM A;  2KOO A;  2AF8 A;  4CA3 A;  2FQ1 A;  2LL8 A;  2ROQ A;  2FVE A;  2CQ8 A;  2L9F A;  5HV8 A;  2FQ0 A;  2EHS A;  2K0Y A;  4BPH A;  2N98 A;  2MVU A;  2K2Q A;  2GDY A;  2AVA A;  2JU2 A;  1HQB A;  5CZD B;  2MVV A;  4H2W C;  2KG6 A;  1KLP A;  4R0M A;  3CE7 A;  4MRT C;  2KOP A;  5KP7 B;  2KOS A;  2KGC A;  2XZ1 C;  2LIU A;  2KR5 A;  1L0H A;  1ACP A;  3EJB A;  2JQ4 A;  2LTE A;  2MR8 A;  2N6Z A;  2FAE A;  3RG2 A;  4PWV B;  2KW2 A;  2K92 A;  2FVA A;  2AFE A;  2L22 A;  2VSQ A;  2PNG A;  2X2B A;  2LPK A;  3LMO A;  2KGE A;  2KGD A;  4H2X C;  2L0Q A;  2N5H A;  4BPF A;  2CGQ A;  2N50 A;  2FHS C;  1DV5 A;  2N6Y A;  3GZL A;  2FAD A;  1F80 D;  5EJD A;  2K93 A;  2FAC A;  2KWL A;  1AF8 A;  4BPG A;  2LIW A;  2KG9 A;  2FVF A;  4IZ6 A;  3NY7 B;  2L4B A;  2K94 A;  5KP6 B;  4H2Y C;  2MR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...