2JU2A

Minimized mean solution structure of the acyl carrier protein domain from module 2 of 6-deoxyerythronolide b synthase (debs)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
GSHMLRDRLAGLPRAERTAELVRLVRTSTATVLGHDDPKAVRATTPFKELGFDSLAAVRLRNLLNAATGLRLPSTLVFDHPNASAVAGFLDAELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Erythronolide synthase
publication title Solution structure and proposed domain domain recognition interface of an acyl carrier protein domain from a modular polyketide synthase.
pubmed doi rcsb
source organism Saccharopolyspora erythraea
total genus 22
structure length 95
sequence length 95
ec nomenclature ec 2.3.1.94: 6-deoxyerythronolide-B synthase.
pdb deposition date 2007-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2ju2A00
2K0YA 2XZ1C 2LIUA 2CQ8A 2N5HA 2FVAA 2EHTA 2KG9A 2N6ZA 4H2XC 4CA3A 2L4BA 2KOPA 2FHSC 2KGDA 1L0IA 1VKUA 4DG9A 2KWLA 2K92A 4PXHB 2K0XA 3GZMA 2EHSA 2GDXA 3CE7A 2CG5B 2FVEA 2X2BA 2FAEA 2LTEA 2FACA 2N6YA 2JU1A 2MF4A 2VSQA 2CGQA 5KP8B 4HKGA 1X3OA 2KW2A 5KP7B 3NY7B 5HV8A 2JQ4A 1KLPA 2ROQA 1AF8A 2DNWA 2L9FA 2K93A 2FVFA 2MR8A 2FQ2A 2KOSA 4H2WC 3EJDA 2FQ0A 2GDWA 1HY8A 4IZ6A 4BPFA 2AVAA 2N5IA 4R0MA 5KP6B 2FQ1A 2FADA 2JGPA 2KORA 2N50A 4BPGA 2AF8A 4BPHA 2LKIA 3GZLA 3EJEA 3RG2A 5EJDA 3EJBA 1ACPA 1OR5A 4NEOA 5HVCA 2MVVA 5CZDB 2KGCA 2AFEA 2XZ0D 4H2YC 1T8KA 2LOLA 2GDYA 2MY5A 3LMOA 1HQBA 2MR7A 2K94A 4PWVB 2AFDA 2QNWA 2KG6A 2JU2A 2KGAA 2L0QA 2KG8A 2L22A 2MVUA 2LL8A 1NQ4A 1L0HA 2KOOA 2MD9A 2K2QA 2KR5A 1DNYA 2LPKA 1F80D 2KGEA 2CNRA 2M5RA 2PNGA 1DV5A 2KOQA 4MRTC 2N98A 2LMLA 2LIWA
chains in the Genus database with same CATH superfamily
2K0YA 2XZ1C 2LIUA 2CQ8A 3DS5A 2FVAA 4H2XC 3DS0A 2L4BA 3H47A 2KOPA 5F2KA 3G1GA 3CXCO 2KGDA 1QRJA 4XROA 4DG9A 2K0XA 3CE7A 4U0BA 3M1MA 2CG5B 1X3OA 2KW2A 2ROQA 4XFZA 2L9FA 2FQ2A 4UHPB 3VRLC 4QNBA 3DPHA 3E2DA 4IZ6A 4BPFA 4R0MA 2GZEA 5KP6B 2FQ1A 3HYBA 1Z6MA 4XFXA 4GR2A 4BPGA 3G28A 1VQMP 2QA4P 3GZLA 1UJZA 1RO0A 3CC2P 4M0IA 3G1IA 1ZMBA 3G21A 4PH1A 4QKOA 3I55P 7CEIA 1FR2A 2GDYA 3I56P 4PH0A 1KC8Q 1HQBA 2MR7A 2AFDA 2QNWA 3CCLP 2KG6A 5BS2A 1VQLP 2L22A 3DTJA 2ONTA 3DS2A 2KOOA 1YJWP 1EMVA 2JYGA 3G26A 3DS1A 2KGEA 2CNRA 2M5RA 3G29A 2BUOA 2KOQA 2LMLA 5HGMA 2LIWA 2N5HA 2EHTA 2KG9A 3G4SP 1GXHA 1IUQA 1Q86Q 1K30A 3GJNA 1L0IA 2GZFA 1M1KQ 2PEQA 4PXHB 2JBGA 2M8LA 2EHSA 1EOQA 2GDXA 2PEMA 1K8AQ 2X2BA 2LTEA 2FACA 1JJ2O 2KODA 2VSQA 2CGQA 1IMPA 5I4TG 4U0EA 2XXMA 5HV8A 1S72P 2OTLP 1AF8A 1VQ7P 2DNWA 4IPYA 2PEJA 2XV6A 1NJIQ 2OARA 3G6EP 1VQ8P 1M90Q 1IMQA 1YHQP 1Q7YQ 3CCJP 1YITP 2JGPA 2KORA 1YJ9P 2E1MA 2L6EA 4BPHA 2LKIA 1AUMA 2EG5A 1M6EX 1MZ8A 1VQ4P 3CC7P 2KGCA 2AFEA 4H2YC 1T8KA 2WPTA 5HGLA 3LMOA 3H0DA 3CCMP 1BAJA 3CMAP 1KD1Q 2P9XA 3CD6P 2JU2A 1VQNP 2Z45A 4WYMA 4F37A 2QEXP 2LL8A 4COPA 2MD9A 2KR5A 2LPKA 1F80D 1VQPP 2PENA 4COCA 2PNGA 1DV5A 2DGYA 2GZGA 2N98A 1VQ5P 2JAZA 3B5IA 4U0FA 4U0DA 2Z44A 4CA3A 1W2BO 2FHSC 1D1DA 1UNKA 1M6NA 2KWLA 3HZQA 3GZMA 2PEKA 2N6YA 2JU1A 2MF4A 1RO2A 5KP8B 4HKGA 5HGOA 5KP7B 1A8OA 2JQ4A 3CCUP 1GXGA 1VQOP 2FVFA 2MR8A 4GR6A 2GDWA 3U43A 2EFJA 1HY8A 2ERHA 1Q82Q 1K73Q 3CMEP 2GYKA 2FADA 2N50A 5F2NA 3CCSP 2AF8A 2OTJP 1GPJA 3GKLC 1VQ6P 3EJEA 3RG2A 5EJDA 3EJBA 2VLPA 4NEOA 5HVCA 1VHNA 3G0VA 2XZ0D 2GZJA 1K9MQ 2MY5A 3DS4A 2K94A 4PWVB 2M8NA 2KGAA 2KG8A 5HGNA 3RG6C 3CCVP 1A43A 4U0AA 1NQ4A 2JO0A 3NTEA 3WBHA 1L0HA 5EW5E 5DCKA 1VQKP 1BXIA 1KQSO 2VLNA 3H4EA 3G71P 2GZIA 4U0CA 2N6ZA 4XRQA 3DS3A 4XFYA 2JB0A 2VLQA 1VKUA 2Z46A 2PEIA 2K0DX 2K92A 1QVFO 3P05A 1E0HA 2FVEA 5JPAA 2FAEA 3LRYA 3Q20A 3NY7B 1VQ9P 2VLOA 2JYLA 1KLPA 3B4QA 2M8PA 2K93A 4H2WC 2KOSA 3MGEA 3EJDA 2FQ0A 1CEIA 1N8RQ 2AVAA 2N5IA 1YJNP 2PY8A 2XT1A 5F2OA 1ZNVA 1YIJP 1ACPA 1OR5A 2CWOA 1M74A 2MVVA 5CZDB 3CPWO 2BHVA 2K5XA 2LOLA 5BS1A 2EIAA 1QVGO 2PEOA 3CCRP 1YI2P 2L0QA 1RNIA 3CCQP 3CCEP 3OW2O 3CC4P 1Q81Q 2MVUA 2K2QA 1DNYA 1EIAA 2LF4A 1E6JP 2NO8A 4MRTC 1AYIA
chains in the Genus database with same CATH topology
2K0YA 2XZ1C 2LIUA 2CQ8A 2N5HA 2FVAA 2EHTA 2KG9A 2N6ZA 4H2XC 4CA3A 2L4BA 2KOPA 2FHSC 2KGDA 1L0IA 1VKUA 4DG9A 2KWLA 2K92A 4PXHB 2K0XA 3GZMA 2EHSA 2GDXA 3CE7A 2CG5B 2FVEA 2X2BA 2FAEA 2LTEA 2FACA 2N6YA 2JU1A 2MF4A 2VSQA 2CGQA 5KP8B 4HKGA 1X3OA 2KW2A 5KP7B 3NY7B 5HV8A 2JQ4A 1KLPA 2ROQA 1AF8A 2DNWA 2L9FA 2K93A 2FVFA 2MR8A 2FQ2A 2KOSA 4H2WC 3EJDA 2FQ0A 2GDWA 1HY8A 4IZ6A 4BPFA 2AVAA 2N5IA 4R0MA 5KP6B 2FQ1A 2FADA 2JGPA 2KORA 2N50A 4BPGA 2AF8A 4BPHA 2LKIA 3GZLA 3EJEA 3RG2A 5EJDA 3EJBA 1ACPA 1OR5A 4NEOA 5HVCA 2MVVA 5CZDB 2KGCA 2AFEA 2XZ0D 4H2YC 1T8KA 2LOLA 2GDYA 2MY5A 3LMOA 1HQBA 2MR7A 2K94A 4PWVB 2AFDA 2QNWA 2KG6A 2JU2A 2KGAA 2L0QA 2KG8A 2L22A 2MVUA 2LL8A 1NQ4A 1L0HA 2KOOA 2MD9A 2K2QA 2KR5A 1DNYA 2LPKA 1F80D 2KGEA 2CNRA 2M5RA 2PNGA 1DV5A 2KOQA 4MRTC 2N98A 2LMLA 2LIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0Y A;  2XZ1 C;  2LIU A;  2CQ8 A;  2N5H A;  2FVA A;  2EHT A;  2KG9 A;  2N6Z A;  4H2X C;  4CA3 A;  2L4B A;  2KOP A;  2FHS C;  2KGD A;  1L0I A;  1VKU A;  4DG9 A;  2KWL A;  2K92 A;  4PXH B;  2K0X A;  3GZM A;  2EHS A;  2GDX A;  3CE7 A;  2CG5 B;  2FVE A;  2X2B A;  2FAE A;  2LTE A;  2FAC A;  2N6Y A;  2JU1 A;  2MF4 A;  2VSQ A;  2CGQ A;  5KP8 B;  4HKG A;  1X3O A;  2KW2 A;  5KP7 B;  3NY7 B;  5HV8 A;  2JQ4 A;  1KLP A;  2ROQ A;  1AF8 A;  2DNW A;  2L9F A;  2K93 A;  2FVF A;  2MR8 A;  2FQ2 A;  2KOS A;  4H2W C;  3EJD A;  2FQ0 A;  2GDW A;  1HY8 A;  4IZ6 A;  4BPF A;  2AVA A;  2N5I A;  4R0M A;  5KP6 B;  2FQ1 A;  2FAD A;  2JGP A;  2KOR A;  2N50 A;  4BPG A;  2AF8 A;  4BPH A;  2LKI A;  3GZL A;  3EJE A;  3RG2 A;  5EJD A;  3EJB A;  1ACP A;  1OR5 A;  4NEO A;  5HVC A;  2MVV A;  5CZD B;  2KGC A;  2AFE A;  2XZ0 D;  4H2Y C;  1T8K A;  2LOL A;  2GDY A;  2MY5 A;  3LMO A;  1HQB A;  2MR7 A;  2K94 A;  4PWV B;  2AFD A;  2QNW A;  2KG6 A;  2JU2 A;  2KGA A;  2L0Q A;  2KG8 A;  2L22 A;  2MVU A;  2LL8 A;  1NQ4 A;  1L0H A;  2KOO A;  2MD9 A;  2K2Q A;  2KR5 A;  1DNY A;  2LPK A;  1F80 D;  2KGE A;  2CNR A;  2M5R A;  2PNG A;  1DV5 A;  2KOQ A;  4MRT C;  2N98 A;  2LML A;  2LIW A; 
#chains in the Genus database with same CATH topology
 2K0Y A;  2XZ1 C;  2LIU A;  2CQ8 A;  3DS5 A;  2FVA A;  4H2X C;  3DS0 A;  2L4B A;  3H47 A;  2KOP A;  5F2K A;  3G1G A;  3CXC O;  2KGD A;  1QRJ A;  4XRO A;  4DG9 A;  2K0X A;  3CE7 A;  4U0B A;  3M1M A;  2CG5 B;  1X3O A;  2KW2 A;  2ROQ A;  4XFZ A;  2L9F A;  2FQ2 A;  4UHP B;  3VRL C;  4QNB A;  3DPH A;  3E2D A;  4IZ6 A;  4BPF A;  4R0M A;  2GZE A;  5KP6 B;  2FQ1 A;  3HYB A;  1Z6M A;  4XFX A;  4GR2 A;  4BPG A;  3G28 A;  1VQM P;  2QA4 P;  3GZL A;  1UJZ A;  1RO0 A;  3CC2 P;  4M0I A;  3G1I A;  1ZMB A;  3G21 A;  4PH1 A;  4QKO A;  3I55 P;  7CEI A;  1FR2 A;  2GDY A;  3I56 P;  4PH0 A;  1KC8 Q;  1HQB A;  2MR7 A;  2AFD A;  2QNW A;  3CCL P;  2KG6 A;  5BS2 A;  1VQL P;  2L22 A;  3DTJ A;  2ONT A;  3DS2 A;  2KOO A;  1YJW P;  1EMV A;  2JYG A;  3G26 A;  3DS1 A;  2KGE A;  2CNR A;  2M5R A;  3G29 A;  2BUO A;  2KOQ A;  2LML A;  5HGM A;  2LIW A;  2N5H A;  2EHT A;  2KG9 A;  3G4S P;  1GXH A;  1IUQ A;  1Q86 Q;  1K30 A;  3GJN A;  1L0I A;  2GZF A;  1M1K Q;  2PEQ A;  4PXH B;  2JBG A;  2M8L A;  2EHS A;  1EOQ A;  2GDX A;  2PEM A;  1K8A Q;  2X2B A;  2LTE A;  2FAC A;  1JJ2 O;  2KOD A;  2VSQ A;  2CGQ A;  1IMP A;  5I4T G;  4U0E A;  2XXM A;  5HV8 A;  1S72 P;  2OTL P;  1AF8 A;  1VQ7 P;  2DNW A;  4IPY A;  2PEJ A;  2XV6 A;  1NJI Q;  2OAR A;  3G6E P;  1VQ8 P;  1M90 Q;  1IMQ A;  1YHQ P;  1Q7Y Q;  3CCJ P;  1YIT P;  2JGP A;  2KOR A;  1YJ9 P;  2E1M A;  2L6E A;  4BPH A;  2LKI A;  1AUM A;  2EG5 A;  1M6E X;  1MZ8 A;  1VQ4 P;  3CC7 P;  2KGC A;  2AFE A;  4H2Y C;  1T8K A;  2WPT A;  5HGL A;  3LMO A;  3H0D A;  3CCM P;  1BAJ A;  3CMA P;  1KD1 Q;  2P9X A;  3CD6 P;  2JU2 A;  1VQN P;  2Z45 A;  4WYM A;  4F37 A;  2QEX P;  2LL8 A;  4COP A;  2MD9 A;  2KR5 A;  2LPK A;  1F80 D;  1VQP P;  2PEN A;  4COC A;  2PNG A;  1DV5 A;  2DGY A;  2GZG A;  2N98 A;  1VQ5 P;  2JAZ A;  3B5I A;  4U0F A;  4U0D A;  2Z44 A;  4CA3 A;  1W2B O;  2FHS C;  1D1D A;  1UNK A;  1M6N A;  2KWL A;  3HZQ A;  3GZM A;  2PEK A;  2N6Y A;  2JU1 A;  2MF4 A;  1RO2 A;  5KP8 B;  4HKG A;  5HGO A;  5KP7 B;  1A8O A;  2JQ4 A;  3CCU P;  1GXG A;  1VQO P;  2FVF A;  2MR8 A;  4GR6 A;  2GDW A;  3U43 A;  2EFJ A;  1HY8 A;  2ERH A;  1Q82 Q;  1K73 Q;  3CME P;  2GYK A;  2FAD A;  2N50 A;  5F2N A;  3CCS P;  2AF8 A;  2OTJ P;  1GPJ A;  3GKL C;  1VQ6 P;  3EJE A;  3RG2 A;  5EJD A;  3EJB A;  2VLP A;  4NEO A;  5HVC A;  1VHN A;  3G0V A;  2XZ0 D;  2GZJ A;  1K9M Q;  2MY5 A;  3DS4 A;  2K94 A;  4PWV B;  2M8N A;  2KGA A;  2KG8 A;  5HGN A;  3RG6 C;  3CCV P;  1A43 A;  4U0A A;  1NQ4 A;  2JO0 A;  3NTE A;  3WBH A;  1L0H A;  5EW5 E;  5DCK A;  1VQK P;  1BXI A;  1KQS O;  2VLN A;  3H4E A;  3G71 P;  2GZI A;  4U0C A;  2N6Z A;  4XRQ A;  3DS3 A;  4XFY A;  2JB0 A;  2VLQ A;  1VKU A;  2Z46 A;  2PEI A;  2K0D X;  2K92 A;  1QVF O;  3P05 A;  1E0H A;  2FVE A;  5JPA A;  2FAE A;  3LRY A;  3Q20 A;  3NY7 B;  1VQ9 P;  2VLO A;  2JYL A;  1KLP A;  3B4Q A;  2M8P A;  2K93 A;  4H2W C;  2KOS A;  3MGE A;  3EJD A;  2FQ0 A;  1CEI A;  1N8R Q;  2AVA A;  2N5I A;  1YJN P;  2PY8 A;  2XT1 A;  5F2O A;  1ZNV A;  1YIJ P;  1ACP A;  1OR5 A;  2CWO A;  1M74 A;  2MVV A;  5CZD B;  3CPW O;  2BHV A;  2K5X A;  2LOL A;  5BS1 A;  2EIA A;  1QVG O;  2PEO A;  3CCR P;  1YI2 P;  2L0Q A;  1RNI A;  3CCQ P;  3CCE P;  3OW2 O;  3CC4 P;  1Q81 Q;  2MVU A;  2K2Q A;  1DNY A;  1EIA A;  2LF4 A;  1E6J P;  2NO8 A;  4MRT C;  1AYI A; 
#chains in the Genus database with same CATH homology
 2K0Y A;  2XZ1 C;  2LIU A;  2CQ8 A;  2N5H A;  2FVA A;  2EHT A;  2KG9 A;  2N6Z A;  4H2X C;  4CA3 A;  2L4B A;  2KOP A;  2FHS C;  2KGD A;  1L0I A;  1VKU A;  4DG9 A;  2KWL A;  2K92 A;  4PXH B;  2K0X A;  3GZM A;  2EHS A;  2GDX A;  3CE7 A;  2CG5 B;  2FVE A;  2X2B A;  2FAE A;  2LTE A;  2FAC A;  2N6Y A;  2JU1 A;  2MF4 A;  2VSQ A;  2CGQ A;  5KP8 B;  4HKG A;  1X3O A;  2KW2 A;  5KP7 B;  3NY7 B;  5HV8 A;  2JQ4 A;  1KLP A;  2ROQ A;  1AF8 A;  2DNW A;  2L9F A;  2K93 A;  2FVF A;  2MR8 A;  2FQ2 A;  2KOS A;  4H2W C;  3EJD A;  2FQ0 A;  2GDW A;  1HY8 A;  4IZ6 A;  4BPF A;  2AVA A;  2N5I A;  4R0M A;  5KP6 B;  2FQ1 A;  2FAD A;  2JGP A;  2KOR A;  2N50 A;  4BPG A;  2AF8 A;  4BPH A;  2LKI A;  3GZL A;  3EJE A;  3RG2 A;  5EJD A;  3EJB A;  1ACP A;  1OR5 A;  4NEO A;  5HVC A;  2MVV A;  5CZD B;  2KGC A;  2AFE A;  2XZ0 D;  4H2Y C;  1T8K A;  2LOL A;  2GDY A;  2MY5 A;  3LMO A;  1HQB A;  2MR7 A;  2K94 A;  4PWV B;  2AFD A;  2QNW A;  2KG6 A;  2JU2 A;  2KGA A;  2L0Q A;  2KG8 A;  2L22 A;  2MVU A;  2LL8 A;  1NQ4 A;  1L0H A;  2KOO A;  2MD9 A;  2K2Q A;  2KR5 A;  1DNY A;  2LPK A;  1F80 D;  2KGE A;  2CNR A;  2M5R A;  2PNG A;  1DV5 A;  2KOQ A;  4MRT C;  2N98 A;  2LML A;  2LIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...