1RO2A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m manganese soak
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
210
Chain Sequence
b'SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein ORF904
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
total genus 59
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro2A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro2A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro2A02
1RO2A 3M1MA 1RNIA 1RO0A
chains in the Genus database with same CATH superfamily
1EOQA 2GDWA 3RG2A 1M902 2OTJ1 1NJIQ 1VQPP 3CCR1 2KG9A 1VQ5P 1I3QI 3CPWY 2WAQA 3NY7B 1YIJ1 4U0BA 1VQO1 2Z44A 1QXFA 1NJI2 5KP6B 4WYMA 2FVFA 5C4XI 4BY1I 2KPIA 2MR8A 2L22A 1FDOA 4A3II 5CM2M 1VQ4P 2L9FA 5JPAA 5CZDB 1VQM1 2XV6A 2JO0A 3CC71 4COCA 2O53A 5EJDA 2PMZA 1YJW1 2K92A 1KC81 4QTTA 1WIIA 3H0DA 2QEXZ 2JB0A 2MF4A 4RVDA 2AFEA 1YHQZ 1ZB8A 1VQL1 2AYDA 3CC41 2EIAA 3DS3A 1RLYA 1F80D 1VQKZ 3S16I 2KG8A 3EJDA 2K0DX 3HKZA 4UHPB 2KGAA 1YJNP 4HH4A 5IP9I 3BG1B 3S14I 1NUIA 3GKQA 2J6AA 3GTJI 1USPA 4A3JI 1Y1VI 1SFOI 1DL6A 2ZAEB 4NOZA 1L0HA 2RIQA 3S1MI 3CC2P 2OTJP 2Z45A 3FQQA 1S721 3VMIA 3I551 3Q20A 2EHTA 3D6WA 3S2HI 4E32A 2JIPA 4PXHB 3M4OI 2P9XA 2AKLA 3PO3I 1QVFY 1UJZA 4DQYB 2E9HA 1YIJP 1VQOP 2YADA 1VQ71 3PO2I 4GR6A 1Z6MA 2FHSC 2L6EA 2DE7A 2XXMA 2JA7I 1AA6A 3CMA1 2VLPA 2E2HI 7CEIA 2PEJA 4A3MI 5A2Qf 3CCUZ 3S15I 4NBGA 3CC7P 4PWVB 3B5IA 3HYBA 4A3CI 3J80b 1MZ8A 3CC4P 1WW9A 1X3ZA 1ZB9A 3KIHA 2FQ2A 3I56Z 1KD11 5LL6f 5I4TG 2EGTA 3JAMf 4BBRI 2R6MA 5T64A 2AVAA 2MVVA 4A3FI 2QA4P 2KGCA 1K83I 4MRIA 3G4S1 1YITZ 3CCSP 2ONTA 2DGYA 2BUOA 2H85A 2CGQA 3I55P 1Q16A 1QVGY 2KR5A 2JA5I 1AUMA 1TWFI 1RO0A 1VQP1 2VLQA 3DS5A 1FR2A 2PEQA 1Q7YQ 2QRCB 2E1MA 4NBAA 5HGMA 4H2XC 1VQ7P 3OW2O 3CCVZ 2KOOA 4HKGA 4NEOA 3RG6C 2F4MA 2JU2A 3D2LA 2P28A 2KORA 1Q861 1VQ41 1WZNA 2W04A 1K8AQ 2VPZA 2PK7A 1Q821 2YU9I 2JA6I 1ZNVA 4R0MA 3J81f 2OTLZ 1X3OA 2QEXP 2JUBA 1YHQP 1BXIA 2JIRA 2LEXA 5DCKA 2R93I 2GZGA 3CMEZ 2BJOA 3I4MI 2X2BA 1VQKP 3S1RI 4QKOA 2MY5A 2G2KA 4A3EI 3EERA 1W2BO 2AF8A 1USPB 4NBCA 5HV8A 1RNIA 2CQ8A 2IV2X 1VQ9Z 2LIUA 3G71Z 3IR7A 2V3VA 4Y7NI 2KWLA 2NVXI 1P9NA 3NH4A 1VQNZ 1NP6A 1Q811 2GZEA 1M1KQ 5T67A 3CC21 3S17I 3EJBA 1K9MQ 2PM9A 2QLVB 2VF1A 3LUSA 1TWHI 1Y1VS 4MD7A 4NH1C 4A3BI 1X3WA 4E33A 3RZOI 2KG6A 4MONA 5AN9F 3CD6Z 5IT9f 2F4OA 2NAPA 1QYPA 3S1QI 5A2Qb 1M1K2 3CCE1 4XFYA 5D1PA 3HOYI 4E2XA 4NBHA 4RVGA 1E6JP 3PO3S 2L4BA 2FVAA 2JU1A 3CCUP 1N2FA 3EEDA 2IZ3A 1TWGI 1I50I 1S72Z 1GPJA 3G6E1 2M8LA 3TE5B 1YI2Z 1YJ9Z 4BXXI 1Y1WI 1NQ4A 3JAMb 2L0QA 4XFZA 3CCJZ 3CXCZ 2FQ0A 3CQZI 2HF1A 2OOXB 3I56P 1Z01A 1VQ8Z 2KOQA 4E2YA 2AFDA 1JJ2O 1KQSZ 3MGEA 2P3YA 3Q87A 3K7AI 4HGYA 3H47A 4NB8A 2QNWA 2QA41 1N8R1 3GTOI 3T4NB 1K73Q 1Z02A 1AF8A 2JNYA 3GTKI 2E7ZA 2N6YA 3CXCO 2RBLA 3CCS1 4M0IA 1HY8A 1TWAI 4PH1A 4U0CA 3CCQZ 2PEOA 2JIOA 1KQSO 2PENA 2KGDA 2VLNA 4XX2A 3CCMZ 2FAEA 2XZ1C 4RV9A 1UNKA 2K2QA 2XT1A 3CCEP 3CCVP 1CEIA 2IZ4A 3U43A 2M6NA 2JBGA 2R7ZI 1AYIA 2KGEA 4BPFA 2OOYB 3J81b 1IMPA 2K3RA 1X0TA 2LIYA 2E2II 1ZH1A 3WBHA 2GZFA 5C3EI 4NBFA 3G6EP 4U0FA 3HOXI 2BHVA 3GJNA 2VSQA 2OTLP 2LF4A 4NB9A 3GTMI 3FQMA 3MZLB 4NBBA 2QEX1 1YHQ1 2LTEA 2LPKA 3CCLZ 3CMEP 4BY7I 1VQ5Z 2JYLA 4DGLA 1VQK1 2FVEA 1YUKA 2WPTA 2LKIA 1VQ6Z 4X6AI 3VB9A 2QKDA 4AYBA 1W2BY 1M901 2I3CA 2PEIA 4PH0A 3G1GA 3TDHB 4E2WA 1TFIA 2PY8A 3OW2Z 1VQNP 1BAJA 5HGLA 3NTEA 5IT9b 5KP7B 1KRLA 1PFTA 2JS4A 1KC8Q 2JGPA 1NJI1 1Z03A 2QR1B 3CD6P 2NVQI 4U0EA 4TNUA 3H4EA 1YJNZ 5HGNA 3FKII 1KC82 2DNWA 1QRJA 3I07A 4RS4A 2R92I 1Q7Y2 3M3YI 1T8KA 3QWUA 1W2BZ 2JQ4A 3CCU1 3EJEA 2ERHA 1GXGA 3G4SZ 1ZMBA 4RVFA 2OTJZ 3CCRZ 2W03A 2Y0SA 2HU9A 2PNGA 5F2KA 2FACA 5T6BA 2N50A 2FADA 1K8A2 3GZLA 1VQ8P 3I561 3GTQI 1YIJZ 1VQOZ 5C4JI 3RZDI 5HVCA 1VHNA 4MXUA 4COPA 4RVHA 5F2NA 3NH8A 1VQMZ 4E30A 3P5JB 1YIT1 3G1IA 3CXCY 3CC7Z 2N98A 1YJWZ 3M1MA 2JYGA 2JR6A 4NBEA 3ESWA 4NBDA 2KW2A 3VMHA 1VQLZ 4XRQA 3CCMP 1KQSY 3CC4Z 2OZKA 2GDYA 1KD1Q 3H3VJ 3MONA 3F3PC 3CCV1 1RO4A 1Y8CA 1M90Q 1K9M2 2KOPA 2DE6A 2DE5A 3DS0A 4NFRA 1JJ2Z 1KD12 2LFUA 1RQFA 2N5HA 2VPWA 1QVGO 4QNBA 1L1OC 4EWCA 3I55Z 5EW5E 3MZKB 2ROQA 2NO8A 4MH4A 2OTL1 5HGOA 3DS1A 3CCLP 3GTLI 3IF8A 5D1OA 3CME1 2VPXA 5C44I 2V45A 2VUGA 1VQ7Z 4F37A 5F2OA 1VQ6P 4Y52I 4MD8A 3GTMS 3NFZA 3CMAZ 3G26A 1VQ91 4MRTC 3E2DA 3G711 2PEKA 2K0YA 1Q86Q 1A8OA 3NH5A 1VQN1 1YITP 1IUQA 4DG9A 1WCMI 4HGZA 1EIAA 2EHSA 2GZIA 2JIMA 3S2DI 1Q82Q 2CG5B 4E31A 1IMQA 3VMGA 2O4HA 1TWCI 1VKUA 2GTHA 4S1TA 2PEMA 1Q862 2K5XA 1Q7Y1 1K732 1FDIA 2QRDB 2GTIA 3GTGI 3CD61 4A3DI 2RT9A 3G29A 4GR2A 1Q822 5KP8B 3OW2Y 5FLXf 4A3KI 4E2ZA 3CPWZ 3GTPI 2E2JI 5IP7I 2GU2A 1Q81Q 1DNYA 2K94A 4A3GI 4BBSI 1OR5A 3G4SP 1K8A1 3G21A 2LIWA 2M5RA 3CCRP 3HOVI 1ML8A 1YI21 1YJ91 1VQPZ 1ACPA 2M48A 3CCJ1 2Q4ZA 4IPYA 4CA3A 4U0DA 4H2YC 4U0AA 3CPWO 2JIQA 1Q812 2V8KA 1QF8A 5FLMI 1GXHA 5BS1A 3DTJA 2GZJA 2M8NA 4MD9A 1VQ81 1EMVA 1WJ2A 2K5RA 2KOSA 3KIFA 2EG5A 3F3FC 1HQBA 1VQ9P 3VRLC 2B63I 3G71P 3G28A 2Z46A 3VTNA 1VQ4Z 1VQMP 2V8JA 3S1NI 2CNRA 3IX0A 2VPYA 1YJWP 1M1K1 3CE7A 2RPRA 2K0XA 3NDJA 3CCQ1 1VQLP 1K9M1 3IFUA 3I4NI 1RO2A 2M8PA 4A3LI 3CCM1 1M74A 3U50C 1E0HA 1VLAA 3J7A4 3GZMA 2RHBA 4H2WC 1QVFZ 1N8RQ 2V8IA 4QTUA 1D1DA 3DS4A 1S72P 3BG0B 3CC2Z 1DV5A 1YI2P 1YJ9P 3D9XA 2OARA 3B4QA 2QREB 3LMOA 3CCJP 1N8R2 5D1OB 3HOUI 4IZ6A 2Q51A 4XROA 3CCL1 2GDXA 1QVFO 2K93A 2LL8A 3HZQA 2WB1A 1VQ51 3CCEZ 4BPHA 1LQLA 2JMOA 3DS2A 1JJ2Y 2XZ0D 2VLOA 1VQ61 3CMAP 2JA8I 2KODA 3HOWI 3HOZI 2N6ZA 2MD9A 1R9TI 1M6NA 3NDIA 5BS2A 1K731 2LOLA 3G6EZ 2VUMI 3GKLC 4XFXA 1S7MA 3GCFA 2JAZA 4BPGA 4CL1A 2GYKA 3CCQP 3LRYA 3G0VA 2NVYI 2CWOA 5FLXb 2MVUA 1A43A 1SIWA 2LMLA 1QVGZ 1KLPA 3DPHA 4A93I 2N5IA 4DK1A 3J80f 1L0IA 1YJN1 2MR7A 2KI7B 1YUAA 2NVTI 2QA4Z 3P05A 1M6EX 1JWHC 3H0GI 3CCSZ 1I6HI 2EFJA 2FQ1A 1K30A
chains in the Genus database with same CATH topology
1EOQA 2OTJ1 1M902 1NJIQ 1VQPP 3CCR1 1VQ5P 1I3QI 3CPWY 2WAQA 1YIJ1 4U0BA 1VQO1 2Z44A 1NJI2 4WYMA 5C4XI 4BY1I 2KPIA 4A3II 5CM2M 1VQ4P 5JPAA 1VQM1 2XV6A 2JO0A 3CC71 4COCA 2O53A 2PMZA 1YJW1 1KC81 4QTTA 1WIIA 3H0DA 2QEXZ 1YHQZ 4RVDA 1VQL1 1ZB8A 3CC41 2EIAA 3DS3A 1RLYA 3S16I 1VQKZ 3HKZA 1YJNP 4HH4A 5IP9I 3BG1B 3S14I 1NUIA 3GKQA 2J6AA 3GTJI 1USPA 4A3JI 1Y1VI 1SFOI 1DL6A 2ZAEB 4NOZA 2RIQA 3S1MI 3CC2P 2OTJP 2Z45A 3FQQA 1S721 3VMIA 3I551 3Q20A 3D6WA 3S2HI 4E32A 3M4OI 2P9XA 2AKLA 3PO3I 1QVFY 4DQYB 2E9HA 1YIJP 1VQOP 2YADA 1VQ71 3PO2I 4GR6A 2L6EA 2DE7A 2XXMA 2JA7I 3CMA1 2E2HI 2PEJA 4A3MI 5A2Qf 3CCUZ 3S15I 4NBGA 3CC7P 3B5IA 3HYBA 4A3CI 3J80b 3CC4P 1WW9A 1X3ZA 1ZB9A 3KIHA 3I56Z 1KD11 5LL6f 5I4TG 2EGTA 3JAMf 4BBRI 2R6MA 5T64A 4A3FI 2QA4P 1K83I 4MRIA 1YITZ 2ONTA 3CCSP 2DGYA 2BUOA 2H85A 3I55P 1QVGY 2JA5I 1AUMA 1TWFI 1RO0A 1VQP1 3DS5A 2PEQA 1Q7YQ 2QRCB 2E1MA 4NBAA 5HGMA 1VQ7P 3OW2O 3CCVZ 3RG6C 2F4MA 2P28A 1Q861 1VQ41 2W04A 1K8AQ 2PK7A 1Q821 2YU9I 2JA6I 3J81f 2OTLZ 2JUBA 2QEXP 1YHQP 5DCKA 2R93I 3CMEZ 3I4MI 2BJOA 1VQKP 3S1RI 2G2KA 4A3EI 3EERA 1W2BO 1USPB 4NBCA 1RNIA 1VQ9Z 3G71Z 4Y7NI 2NVXI 1VQNZ 1P9NA 3NH4A 1NP6A 1Q811 1M1KQ 5T67A 3CC21 3S17I 1K9MQ 2PM9A 2QLVB 4NH1C 2VF1A 3LUSA 1TWHI 1Y1VS 4MD7A 4A3BI 1X3WA 4E33A 3RZOI 4MONA 5AN9F 3CD6Z 5IT9f 2F4OA 1QYPA 3S1QI 5A2Qb 1M1K2 3CCE1 4XFYA 5D1PA 3HOYI 4E2XA 4NBHA 4RVGA 1E6JP 3PO3S 3CCUP 1N2FA 3EEDA 2IZ3A 1TWGI 1I50I 1S72Z 3G6E1 2M8LA 3TE5B 1YI2Z 1YJ9Z 4BXXI 1Y1WI 3JAMb 4XFZA 3CCJZ 3CXCZ 3CQZI 2HF1A 2OOXB 3I56P 1Z01A 1VQ8Z 4E2YA 1JJ2O 1KQSZ 3MGEA 2P3YA 3Q87A 3K7AI 4HGYA 3H47A 4NB8A 2QA41 1N8R1 3GTOI 3T4NB 1K73Q 1Z02A 3GTKI 2JNYA 3CXCO 2RBLA 3CCS1 4M0IA 1TWAI 4PH1A 4U0CA 3CCQZ 2PEOA 1KQSO 2PENA 3CCMZ 4XX2A 4RV9A 2XT1A 3CCEP 3CCVP 2IZ4A 2M6NA 2R7ZI 2OOYB 3J81b 2K3RA 1X0TA 2LIYA 2E2II 1ZH1A 3WBHA 5C3EI 4NBFA 3G6EP 4U0FA 3HOXI 2BHVA 2OTLP 2LF4A 4NB9A 3GTMI 3FQMA 3MZLB 4NBBA 2QEX1 1YHQ1 3CCLZ 4BY7I 3CMEP 1VQ5Z 2JYLA 4DGLA 1VQK1 1YUKA 1VQ6Z 4X6AI 3VB9A 2QKDA 4AYBA 1W2BY 1M901 2I3CA 2PEIA 4PH0A 3G1GA 3TDHB 4E2WA 1TFIA 2PY8A 3OW2Z 1VQNP 1BAJA 5HGLA 3NTEA 5IT9b 1KRLA 1PFTA 2JS4A 1KC8Q 1NJI1 1Z03A 2QR1B 3CD6P 2NVQI 4U0EA 4TNUA 3H4EA 1YJNZ 5HGNA 3FKII 1KC82 1QRJA 3I07A 4RS4A 2R92I 1Q7Y2 3M3YI 3QWUA 1W2BZ 3CCU1 3G4SZ 1ZMBA 4RVFA 2OTJZ 3CCRZ 2W03A 2Y0SA 2HU9A 5F2KA 5T6BA 1K8A2 1VQ8P 3I561 3GTQI 1YIJZ 1VQOZ 5C4JI 3RZDI 4MXUA 4COPA 4RVHA 5F2NA 3NH8A 1VQMZ 4E30A 3P5JB 1YIT1 3G1IA 3CXCY 3CC7Z 1YJWZ 3M1MA 2JYGA 2JR6A 4NBEA 3ESWA 4NBDA 3VMHA 1VQLZ 4XRQA 3CCMP 1KQSY 3CC4Z 2OZKA 1KD1Q 3H3VJ 3MONA 3F3PC 3CCV1 1RO4A 1M90Q 1K9M2 2DE6A 2DE5A 3DS0A 4NFRA 1JJ2Z 1KD12 2LFUA 1RQFA 1QVGO 4QNBA 1L1OC 4EWCA 3I55Z 3MZKB 4MH4A 2OTL1 5HGOA 3DS1A 3CCLP 3GTLI 3IF8A 5D1OA 3CME1 5C44I 2VUGA 1VQ7Z 5F2OA 1VQ6P 4Y52I 4MD8A 3GTMS 3NFZA 3CMAZ 3G26A 1VQ91 3E2DA 3G711 2PEKA 1Q86Q 1A8OA 3NH5A 1VQN1 1YITP 1IUQA 1WCMI 4HGZA 1EIAA 3S2DI 1Q82Q 4E31A 3VMGA 2O4HA 1TWCI 2GTHA 4S1TA 1Q862 2PEMA 1K732 1Q7Y1 2QRDB 2GTIA 3GTGI 3CD61 4A3DI 2RT9A 3G29A 4GR2A 1Q822 3OW2Y 5FLXf 4A3KI 4E2ZA 3CPWZ 3GTPI 2E2JI 5IP7I 2GU2A 1Q81Q 4A3GI 4BBSI 3G4SP 1K8A1 3G21A 3CCRP 3HOVI 1ML8A 1YI21 1YJ91 1VQPZ 2M48A 3CCJ1 2Q4ZA 4IPYA 4U0DA 4U0AA 3CPWO 1Q812 2V8KA 1QF8A 5FLMI 5BS1A 3DTJA 1VQ81 2M8NA 4MD9A 2K5RA 3KIFA 2EG5A 3F3FC 1VQ9P 3VRLC 2B63I 3G71P 3G28A 2Z46A 3VTNA 1VQ4Z 1VQMP 2V8JA 3S1NI 3IX0A 1YJWP 1M1K1 2RPRA 3NDJA 3CCQ1 1VQLP 1K9M1 3IFUA 3I4NI 1RO2A 2M8PA 4A3LI 3CCM1 1M74A 3U50C 1VLAA 3J7A4 2RHBA 1QVFZ 1N8RQ 2V8IA 4QTUA 1D1DA 3DS4A 1S72P 3BG0B 3CC2Z 1YI2P 1YJ9P 3D9XA 2OARA 2QREB 3CCJP 1N8R2 5D1OB 3HOUI 2Q51A 4XROA 3CCL1 1VQ51 1QVFO 3HZQA 2WB1A 3CCEZ 1LQLA 2JMOA 3DS2A 1JJ2Y 1VQ61 3CMAP 2JA8I 2KODA 3HOWI 3HOZI 1R9TI 1M6NA 3NDIA 5BS2A 1K731 3G6EZ 2VUMI 4XFXA 1S7MA 3GCFA 4CL1A 3CCQP 3LRYA 3G0VA 2NVYI 2CWOA 5FLXb 1A43A 1QVGZ 3DPHA 4A93I 4DK1A 3J80f 1YJN1 2KI7B 1YUAA 2NVTI 2QA4Z 3P05A 1M6EX 1JWHC 3H0GI 3CCSZ 1I6HI 2EFJA 3G4S1 1K30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RO2 A;  3M1M A;  1RNI A;  1RO0 A; 
#chains in the Genus database with same CATH topology
 1EOQ A;  2GDW A;  3RG2 A;  1M90 2;  2OTJ 1;  1NJI Q;  1VQP P;  3CCR 1;  2KG9 A;  1VQ5 P;  1I3Q I;  3CPW Y;  2WAQ A;  3NY7 B;  1YIJ 1;  4U0B A;  1VQO 1;  2Z44 A;  1QXF A;  1NJI 2;  5KP6 B;  4WYM A;  2FVF A;  5C4X I;  4BY1 I;  2KPI A;  2MR8 A;  2L22 A;  1FDO A;  4A3I I;  5CM2 M;  1VQ4 P;  2L9F A;  5JPA A;  5CZD B;  1VQM 1;  2XV6 A;  2JO0 A;  3CC7 1;  4COC A;  2O53 A;  5EJD A;  2PMZ A;  1YJW 1;  2K92 A;  1KC8 1;  4QTT A;  1WII A;  3H0D A;  2QEX Z;  2JB0 A;  2MF4 A;  4RVD A;  2AFE A;  1YHQ Z;  1ZB8 A;  1VQL 1;  2AYD A;  3CC4 1;  2EIA A;  3DS3 A;  1RLY A;  1F80 D;  1VQK Z;  3S16 I;  2KG8 A;  3EJD A;  2K0D X;  3HKZ A;  4UHP B;  2KGA A;  1YJN P;  4HH4 A;  5IP9 I;  3BG1 B;  3S14 I;  1NUI A;  3GKQ A;  2J6A A;  3GTJ I;  1USP A;  4A3J I;  1Y1V I;  1SFO I;  1DL6 A;  2ZAE B;  4NOZ A;  1L0H A;  2RIQ A;  3S1M I;  3CC2 P;  2OTJ P;  2Z45 A;  3FQQ A;  1S72 1;  3VMI A;  3I55 1;  3Q20 A;  2EHT A;  3D6W A;  3S2H I;  4E32 A;  2JIP A;  4PXH B;  3M4O I;  2P9X A;  2AKL A;  3PO3 I;  1QVF Y;  1UJZ A;  4DQY B;  2E9H A;  1YIJ P;  1VQO P;  2YAD A;  1VQ7 1;  3PO2 I;  4GR6 A;  1Z6M A;  2FHS C;  2L6E A;  2DE7 A;  2XXM A;  2JA7 I;  1AA6 A;  3CMA 1;  2VLP A;  2E2H I;  7CEI A;  2PEJ A;  4A3M I;  5A2Q f;  3CCU Z;  3S15 I;  4NBG A;  3CC7 P;  4PWV B;  3B5I A;  3HYB A;  4A3C I;  3J80 b;  1MZ8 A;  3CC4 P;  1WW9 A;  1X3Z A;  1ZB9 A;  3KIH A;  2FQ2 A;  3I56 Z;  1KD1 1;  5LL6 f;  5I4T G;  2EGT A;  3JAM f;  4BBR I;  2R6M A;  5T64 A;  2AVA A;  2MVV A;  4A3F I;  2QA4 P;  2KGC A;  1K83 I;  4MRI A;  3G4S 1;  1YIT Z;  3CCS P;  2ONT A;  2DGY A;  2BUO A;  2H85 A;  2CGQ A;  3I55 P;  1Q16 A;  1QVG Y;  2KR5 A;  2JA5 I;  1AUM A;  1TWF I;  1RO0 A;  1VQP 1;  2VLQ A;  3DS5 A;  1FR2 A;  2PEQ A;  1Q7Y Q;  2QRC B;  2E1M A;  4NBA A;  5HGM A;  4H2X C;  1VQ7 P;  3OW2 O;  3CCV Z;  2KOO A;  4HKG A;  4NEO A;  3RG6 C;  2F4M A;  2JU2 A;  3D2L A;  2P28 A;  2KOR A;  1Q86 1;  1VQ4 1;  1WZN A;  2W04 A;  1K8A Q;  2VPZ A;  2PK7 A;  1Q82 1;  2YU9 I;  2JA6 I;  1ZNV A;  4R0M A;  3J81 f;  2OTL Z;  1X3O A;  2QEX P;  2JUB A;  1YHQ P;  1BXI A;  2JIR A;  2LEX A;  5DCK A;  2R93 I;  2GZG A;  3CME Z;  2BJO A;  3I4M I;  2X2B A;  1VQK P;  3S1R I;  4QKO A;  2MY5 A;  2G2K A;  4A3E I;  3EER A;  1W2B O;  2AF8 A;  1USP B;  4NBC A;  5HV8 A;  1RNI A;  2CQ8 A;  2IV2 X;  1VQ9 Z;  2LIU A;  3G71 Z;  3IR7 A;  2V3V A;  4Y7N I;  2KWL A;  2NVX I;  1P9N A;  3NH4 A;  1VQN Z;  1NP6 A;  1Q81 1;  2GZE A;  1M1K Q;  5T67 A;  3CC2 1;  3S17 I;  3EJB A;  1K9M Q;  2PM9 A;  2QLV B;  2VF1 A;  3LUS A;  1TWH I;  1Y1V S;  4MD7 A;  4NH1 C;  4A3B I;  1X3W A;  4E33 A;  3RZO I;  2KG6 A;  4MON A;  5AN9 F;  3CD6 Z;  5IT9 f;  2F4O A;  2NAP A;  1QYP A;  3S1Q I;  5A2Q b;  1M1K 2;  3CCE 1;  4XFY A;  5D1P A;  3HOY I;  4E2X A;  4NBH A;  4RVG A;  1E6J P;  3PO3 S;  2L4B A;  2FVA A;  2JU1 A;  3CCU P;  1N2F A;  3EED A;  2IZ3 A;  1TWG I;  1I50 I;  1S72 Z;  1GPJ A;  3G6E 1;  2M8L A;  3TE5 B;  1YI2 Z;  1YJ9 Z;  4BXX I;  1Y1W I;  1NQ4 A;  3JAM b;  2L0Q A;  4XFZ A;  3CCJ Z;  3CXC Z;  2FQ0 A;  3CQZ I;  2HF1 A;  2OOX B;  3I56 P;  1Z01 A;  1VQ8 Z;  2KOQ A;  4E2Y A;  2AFD A;  1JJ2 O;  1KQS Z;  3MGE A;  2P3Y A;  3Q87 A;  3K7A I;  4HGY A;  3H47 A;  4NB8 A;  2QNW A;  2QA4 1;  1N8R 1;  3GTO I;  3T4N B;  1K73 Q;  1Z02 A;  1AF8 A;  2JNY A;  3GTK I;  2E7Z A;  2N6Y A;  3CXC O;  2RBL A;  3CCS 1;  4M0I A;  1HY8 A;  1TWA I;  4PH1 A;  4U0C A;  3CCQ Z;  2PEO A;  2JIO A;  1KQS O;  2PEN A;  2KGD A;  2VLN A;  4XX2 A;  3CCM Z;  2FAE A;  2XZ1 C;  4RV9 A;  1UNK A;  2K2Q A;  2XT1 A;  3CCE P;  3CCV P;  1CEI A;  2IZ4 A;  3U43 A;  2M6N A;  2JBG A;  2R7Z I;  1AYI A;  2KGE A;  4BPF A;  2OOY B;  3J81 b;  1IMP A;  2K3R A;  1X0T A;  2LIY A;  2E2I I;  1ZH1 A;  3WBH A;  2GZF A;  5C3E I;  4NBF A;  3G6E P;  4U0F A;  3HOX I;  2BHV A;  3GJN A;  2VSQ A;  2OTL P;  2LF4 A;  4NB9 A;  3GTM I;  3FQM A;  3MZL B;  4NBB A;  2QEX 1;  1YHQ 1;  2LTE A;  2LPK A;  3CCL Z;  3CME P;  4BY7 I;  1VQ5 Z;  2JYL A;  4DGL A;  1VQK 1;  2FVE A;  1YUK A;  2WPT A;  2LKI A;  1VQ6 Z;  4X6A I;  3VB9 A;  2QKD A;  4AYB A;  1W2B Y;  1M90 1;  2I3C A;  2PEI A;  4PH0 A;  3G1G A;  3TDH B;  4E2W A;  1TFI A;  2PY8 A;  3OW2 Z;  1VQN P;  1BAJ A;  5HGL A;  3NTE A;  5IT9 b;  5KP7 B;  1KRL A;  1PFT A;  2JS4 A;  1KC8 Q;  2JGP A;  1NJI 1;  1Z03 A;  2QR1 B;  3CD6 P;  2NVQ I;  4U0E A;  4TNU A;  3H4E A;  1YJN Z;  5HGN A;  3FKI I;  1KC8 2;  2DNW A;  1QRJ A;  3I07 A;  4RS4 A;  2R92 I;  1Q7Y 2;  3M3Y I;  1T8K A;  3QWU A;  1W2B Z;  2JQ4 A;  3CCU 1;  3EJE A;  2ERH A;  1GXG A;  3G4S Z;  1ZMB A;  4RVF A;  2OTJ Z;  3CCR Z;  2W03 A;  2Y0S A;  2HU9 A;  2PNG A;  5F2K A;  2FAC A;  5T6B A;  2N50 A;  2FAD A;  1K8A 2;  3GZL A;  1VQ8 P;  3I56 1;  3GTQ I;  1YIJ Z;  1VQO Z;  5C4J I;  3RZD I;  5HVC A;  1VHN A;  4MXU A;  4COP A;  4RVH A;  5F2N A;  3NH8 A;  1VQM Z;  4E30 A;  3P5J B;  1YIT 1;  3G1I A;  3CXC Y;  3CC7 Z;  2N98 A;  1YJW Z;  3M1M A;  2JYG A;  2JR6 A;  4NBE A;  3ESW A;  4NBD A;  2KW2 A;  3VMH A;  1VQL Z;  4XRQ A;  3CCM P;  1KQS Y;  3CC4 Z;  2OZK A;  2GDY A;  1KD1 Q;  3H3V J;  3MON A;  3F3P C;  3CCV 1;  1RO4 A;  1Y8C A;  1M90 Q;  1K9M 2;  2KOP A;  2DE6 A;  2DE5 A;  3DS0 A;  4NFR A;  1JJ2 Z;  1KD1 2;  2LFU A;  1RQF A;  2N5H A;  2VPW A;  1QVG O;  4QNB A;  1L1O C;  4EWC A;  3I55 Z;  5EW5 E;  3MZK B;  2ROQ A;  2NO8 A;  4MH4 A;  2OTL 1;  5HGO A;  3DS1 A;  3CCL P;  3GTL I;  3IF8 A;  5D1O A;  3CME 1;  2VPX A;  5C44 I;  2V45 A;  2VUG A;  1VQ7 Z;  4F37 A;  5F2O A;  1VQ6 P;  4Y52 I;  4MD8 A;  3GTM S;  3NFZ A;  3CMA Z;  3G26 A;  1VQ9 1;  4MRT C;  3E2D A;  3G71 1;  2PEK A;  2K0Y A;  1Q86 Q;  1A8O A;  3NH5 A;  1VQN 1;  1YIT P;  1IUQ A;  4DG9 A;  1WCM I;  4HGZ A;  1EIA A;  2EHS A;  2GZI A;  2JIM A;  3S2D I;  1Q82 Q;  2CG5 B;  4E31 A;  1IMQ A;  3VMG A;  2O4H A;  1TWC I;  1VKU A;  2GTH A;  4S1T A;  2PEM A;  1Q86 2;  2K5X A;  1Q7Y 1;  1K73 2;  1FDI A;  2QRD B;  2GTI A;  3GTG I;  3CD6 1;  4A3D I;  2RT9 A;  3G29 A;  4GR2 A;  1Q82 2;  5KP8 B;  3OW2 Y;  5FLX f;  4A3K I;  4E2Z A;  3CPW Z;  3GTP I;  2E2J I;  5IP7 I;  2GU2 A;  1Q81 Q;  1DNY A;  2K94 A;  4A3G I;  4BBS I;  1OR5 A;  3G4S P;  1K8A 1;  3G21 A;  2LIW A;  2M5R A;  3CCR P;  3HOV I;  1ML8 A;  1YI2 1;  1YJ9 1;  1VQP Z;  1ACP A;  2M48 A;  3CCJ 1;  2Q4Z A;  4IPY A;  4CA3 A;  4U0D A;  4H2Y C;  4U0A A;  3CPW O;  2JIQ A;  1Q81 2;  2V8K A;  1QF8 A;  5FLM I;  1GXH A;  5BS1 A;  3DTJ A;  2GZJ A;  2M8N A;  4MD9 A;  1VQ8 1;  1EMV A;  1WJ2 A;  2K5R A;  2KOS A;  3KIF A;  2EG5 A;  3F3F C;  1HQB A;  1VQ9 P;  3VRL C;  2B63 I;  3G71 P;  3G28 A;  2Z46 A;  3VTN A;  1VQ4 Z;  1VQM P;  2V8J A;  3S1N I;  2CNR A;  3IX0 A;  2VPY A;  1YJW P;  1M1K 1;  3CE7 A;  2RPR A;  2K0X A;  3NDJ A;  3CCQ 1;  1VQL P;  1K9M 1;  3IFU A;  3I4N I;  1RO2 A;  2M8P A;  4A3L I;  3CCM 1;  1M74 A;  3U50 C;  1E0H A;  1VLA A;  3J7A 4;  3GZM A;  2RHB A;  4H2W C;  1QVF Z;  1N8R Q;  2V8I A;  4QTU A;  1D1D A;  3DS4 A;  1S72 P;  3BG0 B;  3CC2 Z;  1DV5 A;  1YI2 P;  1YJ9 P;  3D9X A;  2OAR A;  3B4Q A;  2QRE B;  3LMO A;  3CCJ P;  1N8R 2;  5D1O B;  3HOU I;  4IZ6 A;  2Q51 A;  4XRO A;  3CCL 1;  2GDX A;  1QVF O;  2K93 A;  2LL8 A;  3HZQ A;  2WB1 A;  1VQ5 1;  3CCE Z;  4BPH A;  1LQL A;  2JMO A;  3DS2 A;  1JJ2 Y;  2XZ0 D;  2VLO A;  1VQ6 1;  3CMA P;  2JA8 I;  2KOD A;  3HOW I;  3HOZ I;  2N6Z A;  2MD9 A;  1R9T I;  1M6N A;  3NDI A;  5BS2 A;  1K73 1;  2LOL A;  3G6E Z;  2VUM I;  3GKL C;  4XFX A;  1S7M A;  3GCF A;  2JAZ A;  4BPG A;  4CL1 A;  2GYK A;  3CCQ P;  3LRY A;  3G0V A;  2NVY I;  2CWO A;  5FLX b;  2MVU A;  1A43 A;  1SIW A;  2LML A;  1QVG Z;  1KLP A;  3DPH A;  4A93 I;  2N5I A;  4DK1 A;  3J80 f;  1L0I A;  1YJN 1;  2MR7 A;  2KI7 B;  1YUA A;  2NVT I;  2QA4 Z;  3P05 A;  1M6E X;  1JWH C;  3H0G I;  3CCS Z;  1I6H I;  2EFJ A;  2FQ1 A;  1K30 A; 
#chains in the Genus database with same CATH homology
 1EOQ A;  2OTJ 1;  1M90 2;  1NJI Q;  1VQP P;  3CCR 1;  1VQ5 P;  1I3Q I;  3CPW Y;  2WAQ A;  1YIJ 1;  4U0B A;  1VQO 1;  2Z44 A;  1NJI 2;  4WYM A;  5C4X I;  4BY1 I;  2KPI A;  4A3I I;  5CM2 M;  1VQ4 P;  5JPA A;  1VQM 1;  2XV6 A;  2JO0 A;  3CC7 1;  4COC A;  2O53 A;  2PMZ A;  1YJW 1;  1KC8 1;  4QTT A;  1WII A;  3H0D A;  2QEX Z;  1YHQ Z;  4RVD A;  1VQL 1;  1ZB8 A;  3CC4 1;  2EIA A;  3DS3 A;  1RLY A;  3S16 I;  1VQK Z;  3HKZ A;  1YJN P;  4HH4 A;  5IP9 I;  3BG1 B;  3S14 I;  1NUI A;  3GKQ A;  2J6A A;  3GTJ I;  1USP A;  4A3J I;  1Y1V I;  1SFO I;  1DL6 A;  2ZAE B;  4NOZ A;  2RIQ A;  3S1M I;  3CC2 P;  2OTJ P;  2Z45 A;  3FQQ A;  1S72 1;  3VMI A;  3I55 1;  3Q20 A;  3D6W A;  3S2H I;  4E32 A;  3M4O I;  2P9X A;  2AKL A;  3PO3 I;  1QVF Y;  4DQY B;  2E9H A;  1YIJ P;  1VQO P;  2YAD A;  1VQ7 1;  3PO2 I;  4GR6 A;  2L6E A;  2DE7 A;  2XXM A;  2JA7 I;  3CMA 1;  2E2H I;  2PEJ A;  4A3M I;  5A2Q f;  3CCU Z;  3S15 I;  4NBG A;  3CC7 P;  3B5I A;  3HYB A;  4A3C I;  3J80 b;  3CC4 P;  1WW9 A;  1X3Z A;  1ZB9 A;  3KIH A;  3I56 Z;  1KD1 1;  5LL6 f;  5I4T G;  2EGT A;  3JAM f;  4BBR I;  2R6M A;  5T64 A;  4A3F I;  2QA4 P;  1K83 I;  4MRI A;  1YIT Z;  2ONT A;  3CCS P;  2DGY A;  2BUO A;  2H85 A;  3I55 P;  1QVG Y;  2JA5 I;  1AUM A;  1TWF I;  1RO0 A;  1VQP 1;  3DS5 A;  2PEQ A;  1Q7Y Q;  2QRC B;  2E1M A;  4NBA A;  5HGM A;  1VQ7 P;  3OW2 O;  3CCV Z;  3RG6 C;  2F4M A;  2P28 A;  1Q86 1;  1VQ4 1;  2W04 A;  1K8A Q;  2PK7 A;  1Q82 1;  2YU9 I;  2JA6 I;  3J81 f;  2OTL Z;  2JUB A;  2QEX P;  1YHQ P;  5DCK A;  2R93 I;  3CME Z;  3I4M I;  2BJO A;  1VQK P;  3S1R I;  2G2K A;  4A3E I;  3EER A;  1W2B O;  1USP B;  4NBC A;  1RNI A;  1VQ9 Z;  3G71 Z;  4Y7N I;  2NVX I;  1VQN Z;  1P9N A;  3NH4 A;  1NP6 A;  1Q81 1;  1M1K Q;  5T67 A;  3CC2 1;  3S17 I;  1K9M Q;  2PM9 A;  2QLV B;  4NH1 C;  2VF1 A;  3LUS A;  1TWH I;  1Y1V S;  4MD7 A;  4A3B I;  1X3W A;  4E33 A;  3RZO I;  4MON A;  5AN9 F;  3CD6 Z;  5IT9 f;  2F4O A;  1QYP A;  3S1Q I;  5A2Q b;  1M1K 2;  3CCE 1;  4XFY A;  5D1P A;  3HOY I;  4E2X A;  4NBH A;  4RVG A;  1E6J P;  3PO3 S;  3CCU P;  1N2F A;  3EED A;  2IZ3 A;  1TWG I;  1I50 I;  1S72 Z;  3G6E 1;  2M8L A;  3TE5 B;  1YI2 Z;  1YJ9 Z;  4BXX I;  1Y1W I;  3JAM b;  4XFZ A;  3CCJ Z;  3CXC Z;  3CQZ I;  2HF1 A;  2OOX B;  3I56 P;  1Z01 A;  1VQ8 Z;  4E2Y A;  1JJ2 O;  1KQS Z;  3MGE A;  2P3Y A;  3Q87 A;  3K7A I;  4HGY A;  3H47 A;  4NB8 A;  2QA4 1;  1N8R 1;  3GTO I;  3T4N B;  1K73 Q;  1Z02 A;  3GTK I;  2JNY A;  3CXC O;  2RBL A;  3CCS 1;  4M0I A;  1TWA I;  4PH1 A;  4U0C A;  3CCQ Z;  2PEO A;  1KQS O;  2PEN A;  3CCM Z;  4XX2 A;  4RV9 A;  2XT1 A;  3CCE P;  3CCV P;  2IZ4 A;  2M6N A;  2R7Z I;  2OOY B;  3J81 b;  2K3R A;  1X0T A;  2LIY A;  2E2I I;  1ZH1 A;  3WBH A;  5C3E I;  4NBF A;  3G6E P;  4U0F A;  3HOX I;  2BHV A;  2OTL P;  2LF4 A;  4NB9 A;  3GTM I;  3FQM A;  3MZL B;  4NBB A;  2QEX 1;  1YHQ 1;  3CCL Z;  4BY7 I;  3CME P;  1VQ5 Z;  2JYL A;  4DGL A;  1VQK 1;  1YUK A;  1VQ6 Z;  4X6A I;  3VB9 A;  2QKD A;  4AYB A;  1W2B Y;  1M90 1;  2I3C A;  2PEI A;  4PH0 A;  3G1G A;  3TDH B;  4E2W A;  1TFI A;  2PY8 A;  3OW2 Z;  1VQN P;  1BAJ A;  5HGL A;  3NTE A;  5IT9 b;  1KRL A;  1PFT A;  2JS4 A;  1KC8 Q;  1NJI 1;  1Z03 A;  2QR1 B;  3CD6 P;  2NVQ I;  4U0E A;  4TNU A;  3H4E A;  1YJN Z;  5HGN A;  3FKI I;  1KC8 2;  1QRJ A;  3I07 A;  4RS4 A;  2R92 I;  1Q7Y 2;  3M3Y I;  3QWU A;  1W2B Z;  3CCU 1;  3G4S Z;  1ZMB A;  4RVF A;  2OTJ Z;  3CCR Z;  2W03 A;  2Y0S A;  2HU9 A;  5F2K A;  5T6B A;  1K8A 2;  1VQ8 P;  3I56 1;  3GTQ I;  1YIJ Z;  1VQO Z;  5C4J I;  3RZD I;  4MXU A;  4COP A;  4RVH A;  5F2N A;  3NH8 A;  1VQM Z;  4E30 A;  3P5J B;  1YIT 1;  3G1I A;  3CXC Y;  3CC7 Z;  1YJW Z;  3M1M A;  2JYG A;  2JR6 A;  4NBE A;  3ESW A;  4NBD A;  3VMH A;  1VQL Z;  4XRQ A;  3CCM P;  1KQS Y;  3CC4 Z;  2OZK A;  1KD1 Q;  3H3V J;  3MON A;  3F3P C;  3CCV 1;  1RO4 A;  1M90 Q;  1K9M 2;  2DE6 A;  2DE5 A;  3DS0 A;  4NFR A;  1JJ2 Z;  1KD1 2;  2LFU A;  1RQF A;  1QVG O;  4QNB A;  1L1O C;  4EWC A;  3I55 Z;  3MZK B;  4MH4 A;  2OTL 1;  5HGO A;  3DS1 A;  3CCL P;  3GTL I;  3IF8 A;  5D1O A;  3CME 1;  5C44 I;  2VUG A;  1VQ7 Z;  5F2O A;  1VQ6 P;  4Y52 I;  4MD8 A;  3GTM S;  3NFZ A;  3CMA Z;  3G26 A;  1VQ9 1;  3E2D A;  3G71 1;  2PEK A;  1Q86 Q;  1A8O A;  3NH5 A;  1VQN 1;  1YIT P;  1IUQ A;  1WCM I;  4HGZ A;  1EIA A;  3S2D I;  1Q82 Q;  4E31 A;  3VMG A;  2O4H A;  1TWC I;  2GTH A;  4S1T A;  1Q86 2;  2PEM A;  1K73 2;  1Q7Y 1;  2QRD B;  2GTI A;  3GTG I;  3CD6 1;  4A3D I;  2RT9 A;  3G29 A;  4GR2 A;  1Q82 2;  3OW2 Y;  5FLX f;  4A3K I;  4E2Z A;  3CPW Z;  3GTP I;  2E2J I;  5IP7 I;  2GU2 A;  1Q81 Q;  4A3G I;  4BBS I;  3G4S P;  1K8A 1;  3G21 A;  3CCR P;  3HOV I;  1ML8 A;  1YI2 1;  1YJ9 1;  1VQP Z;  2M48 A;  3CCJ 1;  2Q4Z A;  4IPY A;  4U0D A;  4U0A A;  3CPW O;  1Q81 2;  2V8K A;  1QF8 A;  5FLM I;  5BS1 A;  3DTJ A;  1VQ8 1;  2M8N A;  4MD9 A;  2K5R A;  3KIF A;  2EG5 A;  3F3F C;  1VQ9 P;  3VRL C;  2B63 I;  3G71 P;  3G28 A;  2Z46 A;  3VTN A;  1VQ4 Z;  1VQM P;  2V8J A;  3S1N I;  3IX0 A;  1YJW P;  1M1K 1;  2RPR A;  3NDJ A;  3CCQ 1;  1VQL P;  1K9M 1;  3IFU A;  3I4N I;  1RO2 A;  2M8P A;  4A3L I;  3CCM 1;  1M74 A;  3U50 C;  1VLA A;  3J7A 4;  2RHB A;  1QVF Z;  1N8R Q;  2V8I A;  4QTU A;  1D1D A;  3DS4 A;  1S72 P;  3BG0 B;  3CC2 Z;  1YI2 P;  1YJ9 P;  3D9X A;  2OAR A;  2QRE B;  3CCJ P;  1N8R 2;  5D1O B;  3HOU I;  2Q51 A;  4XRO A;  3CCL 1;  1VQ5 1;  1QVF O;  3HZQ A;  2WB1 A;  3CCE Z;  1LQL A;  2JMO A;  3DS2 A;  1JJ2 Y;  1VQ6 1;  3CMA P;  2JA8 I;  2KOD A;  3HOW I;  3HOZ I;  1R9T I;  1M6N A;  3NDI A;  5BS2 A;  1K73 1;  3G6E Z;  2VUM I;  4XFX A;  1S7M A;  3GCF A;  4CL1 A;  3CCQ P;  3LRY A;  3G0V A;  2NVY I;  2CWO A;  5FLX b;  1A43 A;  1QVG Z;  3DPH A;  4A93 I;  4DK1 A;  3J80 f;  1YJN 1;  2KI7 B;  1YUA A;  2NVT I;  2QA4 Z;  3P05 A;  1M6E X;  1JWH C;  3H0G I;  3CCS Z;  1I6H I;  2EFJ A;  3G4S 1;  1K30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...