1RO2A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m manganese soak
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
molecule keywords hypothetical protein ORF904
total genus 59
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro2A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro2A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro2A02
1RNIA 3M1MA 1RO0A 1RO2A
chains in the Genus database with same CATH superfamily
3F3PC 1VQKP 2K93A 1MZ8A 3RG6C 3IR7A 1M90Q 3MGEA 3J80f 1I6HI 3CD61 2R7ZI 4E30A 4BPFA 2IZ3A 1E6JP 1YIJP 2RPRA 5T67A 1A8OA 5F2NA 2MR7A 1BXIA 1RO0A 3B5IA 2W03A 3HKZA 4NBCA 3VMIA 5A2Qf 1VLAA 3CCV1 5LL6f 2NO8A 3J81b 5IP7I 5FLMI 5T64A 1VQKZ 2K0DX 1WIIA 2PK7A 4NBGA 2OTJ1 4COCA 3DS3A 3LMOA 2GDXA 5KP7B 1NJIQ 1OR5A 2E2JI 2KODA 2JAZA 1KC81 3CCUP 2M48A 2M5RA 2V3VA 4HGZA 1YIJZ 3DS0A 3G6E1 1VQ8P 4H2XC 4XRQA 1YJ9Z 5HGMA 2YADA 2QEXZ 3S1NI 2FACA 5CZDB 2Q51A 5EW5E 3ESWA 4RVDA 4WYMA 4U0FA 2PY8A 1KD12 4NB9A 3PO3I 1HY8A 2KGDA 5AN9F 3CD6Z 2ZAEB 3S2DI 1YJW1 3NH4A 3U43A 3H4EA 3CCQP 2QEX1 1K731 2HU9A 1YJ9P 1VQMP 3S1RI 1YUAA 3RZDI 2P3YA 1YHQZ 4BBRI 1ZMBA 1GPJA 3KIHA 2G2KA 3G711 3CCJ1 1Y1VS 1YI2P 2E9HA 1CEIA 1Q7YQ 2AF8A 2JBGA 2VLPA 3EJEA 3NFZA 1VQ5P 1VQK1 2N6YA 2KR5A 4UHPB 3J81f 3CD6P 4U0DA 2LF4A 3WBHA 2FVAA 2QRCB 1DL6A 3VMGA 2F4MA 1YJ91 2PEKA 3TDHB 2K3RA 2RHBA 2DE5A 4DG9A 2LPKA 2CQ8A 2AYDA 2KOQA 1TWHI 2VLQA 1UNKA 1Q821 3CCJP 1VQL1 4GR6A 3BG0B 2JA6I 1L0IA 4COPA 2V45A 2LMLA 2LIUA 1YI2Z 3I4MI 2VLOA 2VPXA 3D9XA 4E2ZA 3EERA 3K7AI 3S14I 2F4OA 3QWUA 2VPWA 3HOWI 3P5JB 2CNRA 1IMPA 2P28A 4EWCA 4CL1A 1S72Z 4BY7I 5D1OA 2KOOA 3Q20A 1VQM1 2JMOA 3EJBA 3IX0A 4NEOA 5FLXb 1RNIA 1YITZ 3DS5A 1X0TA 3I55Z 2M8NA 2KG8A 1Q861 3J80b 1KD1Q 3OW2Z 2LIWA 3CC41 1N8RQ 1NUIA 1EOQA 1VQLZ 2Y0SA 2ONTA 2VLNA 4U0CA 3G4S1 1VHNA 2KGCA 2DGYA 2MVVA 3CCS1 1I50I 4XFYA 1M6EX 1Y1WI 1K9M1 1DV5A 4QTTA 4XFZA 3GCFA 1YI21 2E2II 3S1QI 3I561 1A43A 2N50A 1K30A 4PH1A 3I07A 2JA5I 2Z46A 3PO2I 2YU9I 1VQLP 2FAEA 1X3OA 1QVGZ 5C3EI 1AA6A 2R93I 1X3WA 1QVFZ 3GJNA 2PEQA 3CCSP 4XROA 1Q822 2OTL1 3IF8A 1YIJ1 4BPHA 2QA4P 2KI7B 1M1K1 2CG5B 1JJ2O 1EMVA 3NH8A 1EIAA 1D1DA 2AKLA 1ZB8A 1YJWZ 2KG6A 3G26A 4NBDA 2M8PA 1Q7Y1 2K0XA 1KC8Q 1RQFA 2JIRA 2OTJP 2OOXB 5FLXf 2PENA 1Q7Y2 3CMA1 2JIPA 3CCSZ 2W04A 2N5HA 1Y8CA 1KLPA 4NBFA 2QA4Z 5I4TG 1M1K2 2BHVA 1VQ7Z 5HGOA 2KG9A 2Z45A 3NH5A 4NBEA 3G4SP 1NQ4A 2XT1A 4PXHB 2WAQA 4MH4A 3I551 3CXCZ 2KORA 2PNGA 1QVFY 1ACPA 3G21A 3I56Z 5JPAA 2OTJZ 3DS2A 1WW9A 2JIMA 1Q811 3CMAP 1VKUA 1T8KA 1YJNZ 3S16I 5BS2A 2PEOA 1AYIA 4A3DI 3G6EZ 2PEJA 4RVFA 3FQMA 3CCR1 2EG5A 1R9TI 4XX2A 3G29A 3CMEZ 2GZIA 2JGPA 1K9M2 2NVXI 4R0MA 1S7MA 3P05A 2N5IA 2QEXP 1K83I 3CCQ1 1TWGI 4M0IA 3I56P 2JA8I 5KP6B 3FQQA 1N2FA 2LEXA 2K0YA 3G71P 2JIQA 1IMQA 2K5XA 4PH0A 2L6EA 2PEIA 2FADA 4IZ6A 3CCL1 1USPB 3GTKI 1Q862 4RV9A 1KQSZ 1K8AQ 4A3CI 2GZJA 1TWCI 1KQSO 4MRTC 2FQ1A 3M4OI 2JQ4A 2MR8A 3OW2O 4H2WC 1QF8A 3PO3S 2OTLP 2MY5A 2V8JA 1RO4A 2FQ0A 2GYKA 1YHQP 2GDWA 5KP8B 5C4XI 1K73Q 3M1MA 4HGYA 2KOPA 3VMHA 2GTHA 2EFJA 2QR1B 3S17I 1PFTA 2XXMA 4DK1A 3G71Z 2ROQA 2GDYA 4A3GI 2OZKA 2VPYA 4NH1C 5HV8A 3NTEA 1TWAI 3T4NB 2AVAA 3TE5B 3GTMS 3CCEZ 2BJOA 2CGQA 3GKQA 3KIFA 2LL8A 2GZGA 3G1IA 3CCRP 4XFXA 3GTMI 2NVYI 3DS4A 5A2Qb 4BXXI 3J7A4 2RIQA 1VQN1 3G28A 1VQPP 1VQ41 1JJ2Z 2JO0A 4QTUA 4IPYA 1SIWA 3CCLZ 2L9FA 2GTIA 3GTOI 3H3VJ 2NAPA 5IP9I 3MONA 2VPZA 2RT9A 1QVGO 4NFRA 2R6MA 1TWFI 2IZ4A 3B4QA 3GZLA 1S72P 1TFIA 4AYBA 2ERHA 2WPTA 5D1PA 1VQNP 1NJI1 4MONA 1YHQ1 2L0QA 4NOZA 2FHSC 2O4HA 2R92I 5DCKA 3CCLP 2K5RA 1VQPZ 4X6AI 1P9NA 2NVTI 1FR2A 2AFEA 2VUGA 3CPWY 1K8A2 2HF1A 2EIAA 3HZQA 1IUQA 2LOLA 3G1GA 2PEMA 7CEIA 1KD11 5D1OB 1F80D 4HH4A 2J6AA 1LQLA 2Z44A 1VQOP 1L0HA 4U0EA 1QVFO 4RVHA 3CPWO 2XZ1C 3LUSA 2QA41 3DS1A 1QRJA 2QLVB 2M8LA 1K9MQ 1RLYA 1NP6A 4PWVB 2JU1A 2MD9A 2OOYB 4Y52I 1W2BY 3VTNA 2JYLA 2JYGA 2L22A 2RBLA 1ZH1A 4Y7NI 2Q4ZA 5CM2M 1ML8A 2E7ZA 4A3FI 3HOXI 1VQ8Z 1VQOZ 1I3QI 1HQBA 4A3KI 3RZOI 2JS4A 2V8IA 4CA3A 3MZLB 2N98A 2KGAA 1M1KQ 1S721 1VQP1 4NBHA 2JA7I 1KQSY 3I55P 4MD9A 2DE6A 2QKDA 2IV2X 5C44I 4A3MI 4QNBA 3NDJA 2LIYA 5C4JI 3CC7P 2E2HI 1VQMZ 1VQ7P 3GZMA 1YIT1 1M902 1AUMA 3H0GI 4BBSI 2MVUA 5T6BA 4MD8A 4A3EI 1N8R2 3I4NI 1UJZA 2QRDB 2KW2A 5F2OA 3CE7A 2GZEA 4E2WA 3S15I 4RVGA 2H85A 3EJDA 2O53A 3CC7Z 3CCUZ 1WZNA 2OARA 1Z02A 3JAMf 3CC71 1VQO1 2B63I 2LFUA 2FVFA 1Q86Q 1QYPA 3G0VA 2CWOA 3CCJZ 1YUKA 1W2BZ 2I3CA 1DNYA 1M74A 3GTGI 4A93I 2GZFA 1Z03A 2JIOA 3GTQI 1QVGY 1YJN1 4BPGA 3NDIA 3GKLC 2KGEA 3CCQZ 3CQZI 1K8A1 2VF1A 1Q812 4U0AA 2P9XA 5HVCA 2KWLA 3RG2A 2QREB 3GTPI 1VQ91 1KC82 1VQ71 2JNYA 2XZ0D 3CCM1 3FKII 4NBAA 4NBBA 1YITP 1Z01A 3H47A 2EGTA 5HGLA 1VQ5Z 1X3ZA 1QXFA 4A3II 3D6WA 1YJNP 3CMAZ 5HGNA 1VQ4P 2DE7A 1GXGA 3MZKB 2JUBA 3CCEP 3S1MI 1Q16A 5IT9b 5BS1A 3CME1 3NY7B 3CCRZ 2NVQI 3CC21 3IFUA 3GTJI 1WCMI 1JJ2Y 1SFOI 4A3LI 3CCMP 1JWHC 1VQ51 4BY1I 2K92A 3DPHA 2X2BA 3HOZI 1VQ4Z 1VQ9Z 3DTJA 4QKOA 1GXHA 1K732 3F3FC 1WJ2A 4DGLA 2EHSA 4A3JI 2OTLZ 5EJDA 2L4BA 4MD7A 1Q81Q 4NB8A 3S2HI 2PMZA 3H0DA 2LTEA 3CCMZ 4RS4A 3CCVP 3HOYI 3HOUI 4E2YA 2EHTA 3CC2Z 1VQNZ 2VUMI 3CPWZ 3VB9A 1W2BO 1Q82Q 1KRLA 2AFDA 1VQ9P 1RO2A 4MRIA 3JAMb 3CXCO 1E0HA 4S1TA 4E32A 3CC4Z 2GU2A 2V8KA 1USPA 1VQ6Z 2JB0A 4E2XA 2JR6A 2KPIA 2JU2A 1NJI2 2WB1A 3HYBA 1L1OC 3OW2Y 4A3BI 4F37A 3CCU1 3M3YI 2FVEA 2BUOA 3D2LA 4E31A 3GTLI 2E1MA 3CCVZ 4DQYB 3VRLC 3G4SZ 2K2QA 3BG1B 4E33A 5IT9f 1FDIA 1ZNVA 4GR2A 4HKGA 5F2KA 2QNWA 3CC2P 2PM9A 3CC4P 2DNWA 2N6ZA 1VQ6P 2K94A 1BAJA 2XV6A 4U0BA 3EEDA 3U50C 3G6EP 1Z6MA 1AF8A 1VQ81 1Y1VI 1ZB9A 3Q87A 3CCE1 4TNUA 1N8R1 3HOVI 3CMEP 3E2DA 1M901 1FDOA 2MF4A 3LRYA 4MXUA 2FQ2A 4H2YC 2LKIA 3CXCY 2M6NA 1YJWP 2VSQA 1M6NA 2KOSA 1VQ61
chains in the Genus database with same CATH topology
3F3PC 1VQKP 3RG6C 2R7ZI 1M90Q 3MGEA 3J80f 1I6HI 3CD61 4E30A 2IZ3A 1E6JP 1YIJP 2RPRA 5T67A 1A8OA 5F2NA 2W03A 3B5IA 1RO0A 3HKZA 4NBCA 3VMIA 5A2Qf 1VLAA 3CCV1 5LL6f 3J81b 5IP7I 5FLMI 5T64A 1VQKZ 1WIIA 2PK7A 4NBGA 2OTJ1 4COCA 3DS3A 1NJIQ 2E2JI 2KODA 1KC81 3CCUP 2M48A 4HGZA 1YIJZ 3DS0A 3G6E1 1VQ8P 4XRQA 1YJ9Z 5HGMA 2YADA 2QEXZ 3S1NI 2Q51A 3ESWA 4RVDA 4WYMA 4U0FA 2PY8A 1KD12 4NB9A 3PO3I 5AN9F 3CD6Z 2ZAEB 3S2DI 1YJW1 3NH4A 3H4EA 3CCQP 2QEX1 1K731 2HU9A 1YJ9P 1VQMP 3S1RI 1YUAA 3RZDI 2P3YA 1YHQZ 4BBRI 1ZMBA 3KIHA 2G2KA 3G711 3CCJ1 1Y1VS 1YI2P 2E9HA 1Q7YQ 3NFZA 1VQ5P 1VQK1 3J81f 3CD6P 4U0DA 2LF4A 3WBHA 2QRCB 1DL6A 3VMGA 2F4MA 1YJ91 2PEKA 3TDHB 2K3RA 2RHBA 2DE5A 1TWHI 1Q821 3CCJP 1VQL1 4GR6A 3BG0B 2JA6I 4COPA 1YI2Z 3I4MI 3D9XA 4E2ZA 3K7AI 3EERA 3S14I 2F4OA 3QWUA 3HOWI 3P5JB 2P28A 4EWCA 4CL1A 1S72Z 4BY7I 5D1OA 3Q20A 1VQM1 2JMOA 3IX0A 5FLXb 1RNIA 1YITZ 3DS5A 1X0TA 3I55Z 2M8NA 1Q861 3J80b 1KD1Q 3OW2Z 3CC41 1N8RQ 1NUIA 1EOQA 1VQLZ 2Y0SA 2ONTA 3G4S1 4U0CA 2DGYA 3CCS1 1I50I 4XFYA 1M6EX 1Y1WI 1K9M1 4QTTA 4XFZA 3GCFA 1YI21 3S1QI 3I561 1A43A 1K30A 4PH1A 3I07A 2JA5I 2Z46A 3PO2I 2YU9I 1VQLP 1QVGZ 5C3EI 2R93I 1X3WA 1QVFZ 1Q822 2PEQA 3CCSP 4XROA 2OTL1 3IF8A 1YIJ1 2QA4P 2KI7B 1M1K1 1JJ2O 3NH8A 1EIAA 1D1DA 2AKLA 1ZB8A 1YJWZ 3G26A 4NBDA 2M8PA 1Q7Y1 1KC8Q 1RQFA 5FLXf 2OTJP 2OOXB 3CMA1 2PENA 1Q7Y2 3CCSZ 2W04A 4NBFA 2QA4Z 5I4TG 1M1K2 2BHVA 1VQ7Z 5HGOA 2Z45A 3NH5A 4NBEA 3G4SP 2XT1A 2WAQA 4MH4A 3I551 3CXCZ 1QVFY 3G21A 3I56Z 5JPAA 2OTJZ 3DS2A 1WW9A 1Q811 3CMAP 1YJNZ 3S16I 5BS2A 2PEOA 4A3DI 3G6EZ 2PEJA 4RVFA 3FQMA 3CCR1 2EG5A 1R9TI 4XX2A 3G29A 3CMEZ 1K9M2 2NVXI 1S7MA 3P05A 2QEXP 1K83I 3CCQ1 1TWGI 4M0IA 3I56P 2JA8I 3FQQA 1N2FA 3G71P 4PH0A 2L6EA 2PEIA 3CCL1 3GTKI 1USPB 1Q862 4RV9A 1KQSZ 1K8AQ 4A3CI 1TWCI 1KQSO 3M4OI 1QF8A 3PO3S 3OW2O 2OTLP 2V8JA 1RO4A 1YHQP 5C4XI 1K73Q 3M1MA 4HGYA 3VMHA 2GTHA 2EFJA 2QR1B 3S17I 1PFTA 2XXMA 4DK1A 3G71Z 4A3GI 2OZKA 4NH1C 1TWAI 3NTEA 3T4NB 3TE5B 3GTMS 3CCEZ 2BJOA 3GKQA 3KIFA 3G1IA 3GTMI 3CCRP 4XFXA 2NVYI 3DS4A 5A2Qb 4BXXI 3J7A4 2RIQA 1VQN1 3G28A 1VQPP 1VQ41 1JJ2Z 2JO0A 4QTUA 4IPYA 3CCLZ 3GTOI 2GTIA 3H3VJ 5IP9I 3MONA 2RT9A 1QVGO 4NFRA 2R6MA 1TWFI 2IZ4A 1S72P 1TFIA 4AYBA 5D1PA 1NJI1 1VQNP 4MONA 1YHQ1 4NOZA 2O4HA 2R92I 5DCKA 3CCLP 2K5RA 1VQPZ 4X6AI 1P9NA 2NVTI 3CPWY 2VUGA 1K8A2 2HF1A 2EIAA 3HZQA 1IUQA 3G1GA 1KD11 2PEMA 5D1OB 4HH4A 2J6AA 1LQLA 2Z44A 1VQOP 4U0EA 1QVFO 4RVHA 3CPWO 3LUSA 2QA41 3DS1A 1QRJA 2QLVB 2M8LA 1K9MQ 1RLYA 1NP6A 2OOYB 4Y52I 1W2BY 3VTNA 2JYLA 2JYGA 2RBLA 1ZH1A 4Y7NI 2Q4ZA 5CM2M 1ML8A 4A3FI 3HOXI 1VQ8Z 1VQOZ 1I3QI 4A3KI 3RZOI 2JS4A 2V8IA 3MZLB 1M1KQ 1S721 1VQP1 4NBHA 2JA7I 1KQSY 3I55P 4MD9A 2DE6A 2QKDA 5C44I 4A3MI 4QNBA 3NDJA 2LIYA 5C4JI 3CC7P 2E2HI 1VQMZ 1VQ7P 1YIT1 1M902 1AUMA 3H0GI 4BBSI 5T6BA 1N8R2 4MD8A 4A3EI 3I4NI 2QRDB 5F2OA 4E2WA 3S15I 4RVGA 2H85A 2O53A 3CC7Z 3CCUZ 2OARA 1Z02A 3JAMf 3CC71 1VQO1 2B63I 2LFUA 1Q86Q 1QYPA 3G0VA 2CWOA 3CCJZ 1YUKA 1W2BZ 2I3CA 1M74A 3GTGI 4A93I 1Z03A 3GTQI 1QVGY 1YJN1 3NDIA 3CCQZ 3CQZI 1K8A1 2VF1A 1Q812 4U0AA 2P9XA 2QREB 3GTPI 1VQ91 1KC82 1VQ71 2JNYA 3CCM1 3FKII 4NBAA 4NBBA 1YITP 1Z01A 3H47A 2EGTA 5HGLA 1VQ5Z 1X3ZA 4A3II 3D6WA 1YJNP 3CMAZ 5HGNA 1VQ4P 2DE7A 3MZKB 2JUBA 3CCEP 3S1MI 5IT9b 5BS1A 3CME1 3CCRZ 2NVQI 3CC21 3IFUA 3GTJI 1WCMI 1JJ2Y 1SFOI 4A3LI 3CCMP 1JWHC 1VQ51 4BY1I 3DPHA 3HOZI 1VQ4Z 1VQ9Z 3DTJA 1K732 3F3FC 4DGLA 4A3JI 2OTLZ 4MD7A 1Q81Q 4NB8A 3S2HI 2PMZA 3H0DA 3CCMZ 4RS4A 3CCVP 3HOYI 3HOUI 4E2YA 3CC2Z 1VQNZ 2VUMI 3CPWZ 3VB9A 1W2BO 1Q82Q 1KRLA 1VQ9P 1RO2A 4MRIA 3JAMb 3CXCO 4S1TA 4E32A 3CC4Z 2GU2A 2V8KA 1USPA 1VQ6Z 4E2XA 2JR6A 2KPIA 1NJI2 2WB1A 3HYBA 1L1OC 3OW2Y 4A3BI 3CCU1 3M3YI 2BUOA 4E31A 3GTLI 2E1MA 3CCVZ 4DQYB 3VRLC 3G4SZ 3BG1B 4E33A 5IT9f 4GR2A 5F2KA 3CC2P 2PM9A 3CC4P 1VQ6P 1BAJA 2XV6A 4U0BA 3EEDA 3U50C 3G6EP 1VQ81 1Y1VI 1ZB9A 3Q87A 3CCE1 4TNUA 1N8R1 3HOVI 3CMEP 3E2DA 1M901 3LRYA 4MXUA 3CXCY 2M6NA 1YJWP 1M6NA 2E2II 1VQ61
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNI A;  3M1M A;  1RO0 A;  1RO2 A; 
#chains in the Genus database with same CATH topology
 3F3P C;  1VQK P;  2K93 A;  1MZ8 A;  3RG6 C;  3IR7 A;  1M90 Q;  3MGE A;  3J80 f;  1I6H I;  3CD6 1;  2R7Z I;  4E30 A;  4BPF A;  2IZ3 A;  1E6J P;  1YIJ P;  2RPR A;  5T67 A;  1A8O A;  5F2N A;  2MR7 A;  1BXI A;  1RO0 A;  3B5I A;  2W03 A;  3HKZ A;  4NBC A;  3VMI A;  5A2Q f;  1VLA A;  3CCV 1;  5LL6 f;  2NO8 A;  3J81 b;  5IP7 I;  5FLM I;  5T64 A;  1VQK Z;  2K0D X;  1WII A;  2PK7 A;  4NBG A;  2OTJ 1;  4COC A;  3DS3 A;  3LMO A;  2GDX A;  5KP7 B;  1NJI Q;  1OR5 A;  2E2J I;  2KOD A;  2JAZ A;  1KC8 1;  3CCU P;  2M48 A;  2M5R A;  2V3V A;  4HGZ A;  1YIJ Z;  3DS0 A;  3G6E 1;  1VQ8 P;  4H2X C;  4XRQ A;  1YJ9 Z;  5HGM A;  2YAD A;  2QEX Z;  3S1N I;  2FAC A;  5CZD B;  2Q51 A;  5EW5 E;  3ESW A;  4RVD A;  4WYM A;  4U0F A;  2PY8 A;  1KD1 2;  4NB9 A;  3PO3 I;  1HY8 A;  2KGD A;  5AN9 F;  3CD6 Z;  2ZAE B;  3S2D I;  1YJW 1;  3NH4 A;  3U43 A;  3H4E A;  3CCQ P;  2QEX 1;  1K73 1;  2HU9 A;  1YJ9 P;  1VQM P;  3S1R I;  1YUA A;  3RZD I;  2P3Y A;  1YHQ Z;  4BBR I;  1ZMB A;  1GPJ A;  3KIH A;  2G2K A;  3G71 1;  3CCJ 1;  1Y1V S;  1YI2 P;  2E9H A;  1CEI A;  1Q7Y Q;  2AF8 A;  2JBG A;  2VLP A;  3EJE A;  3NFZ A;  1VQ5 P;  1VQK 1;  2N6Y A;  2KR5 A;  4UHP B;  3J81 f;  3CD6 P;  4U0D A;  2LF4 A;  3WBH A;  2FVA A;  2QRC B;  1DL6 A;  3VMG A;  2F4M A;  1YJ9 1;  2PEK A;  3TDH B;  2K3R A;  2RHB A;  2DE5 A;  4DG9 A;  2LPK A;  2CQ8 A;  2AYD A;  2KOQ A;  1TWH I;  2VLQ A;  1UNK A;  1Q82 1;  3CCJ P;  1VQL 1;  4GR6 A;  3BG0 B;  2JA6 I;  1L0I A;  4COP A;  2V45 A;  2LML A;  2LIU A;  1YI2 Z;  3I4M I;  2VLO A;  2VPX A;  3D9X A;  4E2Z A;  3EER A;  3K7A I;  3S14 I;  2F4O A;  3QWU A;  2VPW A;  3HOW I;  3P5J B;  2CNR A;  1IMP A;  2P28 A;  4EWC A;  4CL1 A;  1S72 Z;  4BY7 I;  5D1O A;  2KOO A;  3Q20 A;  1VQM 1;  2JMO A;  3EJB A;  3IX0 A;  4NEO A;  5FLX b;  1RNI A;  1YIT Z;  3DS5 A;  1X0T A;  3I55 Z;  2M8N A;  2KG8 A;  1Q86 1;  3J80 b;  1KD1 Q;  3OW2 Z;  2LIW A;  3CC4 1;  1N8R Q;  1NUI A;  1EOQ A;  1VQL Z;  2Y0S A;  2ONT A;  2VLN A;  4U0C A;  3G4S 1;  1VHN A;  2KGC A;  2DGY A;  2MVV A;  3CCS 1;  1I50 I;  4XFY A;  1M6E X;  1Y1W I;  1K9M 1;  1DV5 A;  4QTT A;  4XFZ A;  3GCF A;  1YI2 1;  2E2I I;  3S1Q I;  3I56 1;  1A43 A;  2N50 A;  1K30 A;  4PH1 A;  3I07 A;  2JA5 I;  2Z46 A;  3PO2 I;  2YU9 I;  1VQL P;  2FAE A;  1X3O A;  1QVG Z;  5C3E I;  1AA6 A;  2R93 I;  1X3W A;  1QVF Z;  3GJN A;  2PEQ A;  3CCS P;  4XRO A;  1Q82 2;  2OTL 1;  3IF8 A;  1YIJ 1;  4BPH A;  2QA4 P;  2KI7 B;  1M1K 1;  2CG5 B;  1JJ2 O;  1EMV A;  3NH8 A;  1EIA A;  1D1D A;  2AKL A;  1ZB8 A;  1YJW Z;  2KG6 A;  3G26 A;  4NBD A;  2M8P A;  1Q7Y 1;  2K0X A;  1KC8 Q;  1RQF A;  2JIR A;  2OTJ P;  2OOX B;  5FLX f;  2PEN A;  1Q7Y 2;  3CMA 1;  2JIP A;  3CCS Z;  2W04 A;  2N5H A;  1Y8C A;  1KLP A;  4NBF A;  2QA4 Z;  5I4T G;  1M1K 2;  2BHV A;  1VQ7 Z;  5HGO A;  2KG9 A;  2Z45 A;  3NH5 A;  4NBE A;  3G4S P;  1NQ4 A;  2XT1 A;  4PXH B;  2WAQ A;  4MH4 A;  3I55 1;  3CXC Z;  2KOR A;  2PNG A;  1QVF Y;  1ACP A;  3G21 A;  3I56 Z;  5JPA A;  2OTJ Z;  3DS2 A;  1WW9 A;  2JIM A;  1Q81 1;  3CMA P;  1VKU A;  1T8K A;  1YJN Z;  3S16 I;  5BS2 A;  2PEO A;  1AYI A;  4A3D I;  3G6E Z;  2PEJ A;  4RVF A;  3FQM A;  3CCR 1;  2EG5 A;  1R9T I;  4XX2 A;  3G29 A;  3CME Z;  2GZI A;  2JGP A;  1K9M 2;  2NVX I;  4R0M A;  1S7M A;  3P05 A;  2N5I A;  2QEX P;  1K83 I;  3CCQ 1;  1TWG I;  4M0I A;  3I56 P;  2JA8 I;  5KP6 B;  3FQQ A;  1N2F A;  2LEX A;  2K0Y A;  3G71 P;  2JIQ A;  1IMQ A;  2K5X A;  4PH0 A;  2L6E A;  2PEI A;  2FAD A;  4IZ6 A;  3CCL 1;  1USP B;  3GTK I;  1Q86 2;  4RV9 A;  1KQS Z;  1K8A Q;  4A3C I;  2GZJ A;  1TWC I;  1KQS O;  4MRT C;  2FQ1 A;  3M4O I;  2JQ4 A;  2MR8 A;  3OW2 O;  4H2W C;  1QF8 A;  3PO3 S;  2OTL P;  2MY5 A;  2V8J A;  1RO4 A;  2FQ0 A;  2GYK A;  1YHQ P;  2GDW A;  5KP8 B;  5C4X I;  1K73 Q;  3M1M A;  4HGY A;  2KOP A;  3VMH A;  2GTH A;  2EFJ A;  2QR1 B;  3S17 I;  1PFT A;  2XXM A;  4DK1 A;  3G71 Z;  2ROQ A;  2GDY A;  4A3G I;  2OZK A;  2VPY A;  4NH1 C;  5HV8 A;  3NTE A;  1TWA I;  3T4N B;  2AVA A;  3TE5 B;  3GTM S;  3CCE Z;  2BJO A;  2CGQ A;  3GKQ A;  3KIF A;  2LL8 A;  2GZG A;  3G1I A;  3CCR P;  4XFX A;  3GTM I;  2NVY I;  3DS4 A;  5A2Q b;  4BXX I;  3J7A 4;  2RIQ A;  1VQN 1;  3G28 A;  1VQP P;  1VQ4 1;  1JJ2 Z;  2JO0 A;  4QTU A;  4IPY A;  1SIW A;  3CCL Z;  2L9F A;  2GTI A;  3GTO I;  3H3V J;  2NAP A;  5IP9 I;  3MON A;  2VPZ A;  2RT9 A;  1QVG O;  4NFR A;  2R6M A;  1TWF I;  2IZ4 A;  3B4Q A;  3GZL A;  1S72 P;  1TFI A;  4AYB A;  2ERH A;  2WPT A;  5D1P A;  1VQN P;  1NJI 1;  4MON A;  1YHQ 1;  2L0Q A;  4NOZ A;  2FHS C;  2O4H A;  2R92 I;  5DCK A;  3CCL P;  2K5R A;  1VQP Z;  4X6A I;  1P9N A;  2NVT I;  1FR2 A;  2AFE A;  2VUG A;  3CPW Y;  1K8A 2;  2HF1 A;  2EIA A;  3HZQ A;  1IUQ A;  2LOL A;  3G1G A;  2PEM A;  7CEI A;  1KD1 1;  5D1O B;  1F80 D;  4HH4 A;  2J6A A;  1LQL A;  2Z44 A;  1VQO P;  1L0H A;  4U0E A;  1QVF O;  4RVH A;  3CPW O;  2XZ1 C;  3LUS A;  2QA4 1;  3DS1 A;  1QRJ A;  2QLV B;  2M8L A;  1K9M Q;  1RLY A;  1NP6 A;  4PWV B;  2JU1 A;  2MD9 A;  2OOY B;  4Y52 I;  1W2B Y;  3VTN A;  2JYL A;  2JYG A;  2L22 A;  2RBL A;  1ZH1 A;  4Y7N I;  2Q4Z A;  5CM2 M;  1ML8 A;  2E7Z A;  4A3F I;  3HOX I;  1VQ8 Z;  1VQO Z;  1I3Q I;  1HQB A;  4A3K I;  3RZO I;  2JS4 A;  2V8I A;  4CA3 A;  3MZL B;  2N98 A;  2KGA A;  1M1K Q;  1S72 1;  1VQP 1;  4NBH A;  2JA7 I;  1KQS Y;  3I55 P;  4MD9 A;  2DE6 A;  2QKD A;  2IV2 X;  5C44 I;  4A3M I;  4QNB A;  3NDJ A;  2LIY A;  5C4J I;  3CC7 P;  2E2H I;  1VQM Z;  1VQ7 P;  3GZM A;  1YIT 1;  1M90 2;  1AUM A;  3H0G I;  4BBS I;  2MVU A;  5T6B A;  4MD8 A;  4A3E I;  1N8R 2;  3I4N I;  1UJZ A;  2QRD B;  2KW2 A;  5F2O A;  3CE7 A;  2GZE A;  4E2W A;  3S15 I;  4RVG A;  2H85 A;  3EJD A;  2O53 A;  3CC7 Z;  3CCU Z;  1WZN A;  2OAR A;  1Z02 A;  3JAM f;  3CC7 1;  1VQO 1;  2B63 I;  2LFU A;  2FVF A;  1Q86 Q;  1QYP A;  3G0V A;  2CWO A;  3CCJ Z;  1YUK A;  1W2B Z;  2I3C A;  1DNY A;  1M74 A;  3GTG I;  4A93 I;  2GZF A;  1Z03 A;  2JIO A;  3GTQ I;  1QVG Y;  1YJN 1;  4BPG A;  3NDI A;  3GKL C;  2KGE A;  3CCQ Z;  3CQZ I;  1K8A 1;  2VF1 A;  1Q81 2;  4U0A A;  2P9X A;  5HVC A;  2KWL A;  3RG2 A;  2QRE B;  3GTP I;  1VQ9 1;  1KC8 2;  1VQ7 1;  2JNY A;  2XZ0 D;  3CCM 1;  3FKI I;  4NBA A;  4NBB A;  1YIT P;  1Z01 A;  3H47 A;  2EGT A;  5HGL A;  1VQ5 Z;  1X3Z A;  1QXF A;  4A3I I;  3D6W A;  1YJN P;  3CMA Z;  5HGN A;  1VQ4 P;  2DE7 A;  1GXG A;  3MZK B;  2JUB A;  3CCE P;  3S1M I;  1Q16 A;  5IT9 b;  5BS1 A;  3CME 1;  3NY7 B;  3CCR Z;  2NVQ I;  3CC2 1;  3IFU A;  3GTJ I;  1WCM I;  1JJ2 Y;  1SFO I;  4A3L I;  3CCM P;  1JWH C;  1VQ5 1;  4BY1 I;  2K92 A;  3DPH A;  2X2B A;  3HOZ I;  1VQ4 Z;  1VQ9 Z;  3DTJ A;  4QKO A;  1GXH A;  1K73 2;  3F3F C;  1WJ2 A;  4DGL A;  2EHS A;  4A3J I;  2OTL Z;  5EJD A;  2L4B A;  4MD7 A;  1Q81 Q;  4NB8 A;  3S2H I;  2PMZ A;  3H0D A;  2LTE A;  3CCM Z;  4RS4 A;  3CCV P;  3HOY I;  3HOU I;  4E2Y A;  2EHT A;  3CC2 Z;  1VQN Z;  2VUM I;  3CPW Z;  3VB9 A;  1W2B O;  1Q82 Q;  1KRL A;  2AFD A;  1VQ9 P;  1RO2 A;  4MRI A;  3JAM b;  3CXC O;  1E0H A;  4S1T A;  4E32 A;  3CC4 Z;  2GU2 A;  2V8K A;  1USP A;  1VQ6 Z;  2JB0 A;  4E2X A;  2JR6 A;  2KPI A;  2JU2 A;  1NJI 2;  2WB1 A;  3HYB A;  1L1O C;  3OW2 Y;  4A3B I;  4F37 A;  3CCU 1;  3M3Y I;  2FVE A;  2BUO A;  3D2L A;  4E31 A;  3GTL I;  2E1M A;  3CCV Z;  4DQY B;  3VRL C;  3G4S Z;  2K2Q A;  3BG1 B;  4E33 A;  5IT9 f;  1FDI A;  1ZNV A;  4GR2 A;  4HKG A;  5F2K A;  2QNW A;  3CC2 P;  2PM9 A;  3CC4 P;  2DNW A;  2N6Z A;  1VQ6 P;  2K94 A;  1BAJ A;  2XV6 A;  4U0B A;  3EED A;  3U50 C;  3G6E P;  1Z6M A;  1AF8 A;  1VQ8 1;  1Y1V I;  1ZB9 A;  3Q87 A;  3CCE 1;  4TNU A;  1N8R 1;  3HOV I;  3CME P;  3E2D A;  1M90 1;  1FDO A;  2MF4 A;  3LRY A;  4MXU A;  2FQ2 A;  4H2Y C;  2LKI A;  3CXC Y;  2M6N A;  1YJW P;  2VSQ A;  1M6N A;  2KOS A;  1VQ6 1; 
#chains in the Genus database with same CATH homology
 3F3P C;  1VQK P;  3RG6 C;  2R7Z I;  1M90 Q;  3MGE A;  3J80 f;  1I6H I;  3CD6 1;  4E30 A;  2IZ3 A;  1E6J P;  1YIJ P;  2RPR A;  5T67 A;  1A8O A;  5F2N A;  2W03 A;  3B5I A;  1RO0 A;  3HKZ A;  4NBC A;  3VMI A;  5A2Q f;  1VLA A;  3CCV 1;  5LL6 f;  3J81 b;  5IP7 I;  5FLM I;  5T64 A;  1VQK Z;  1WII A;  2PK7 A;  4NBG A;  2OTJ 1;  4COC A;  3DS3 A;  1NJI Q;  2E2J I;  2KOD A;  1KC8 1;  3CCU P;  2M48 A;  4HGZ A;  1YIJ Z;  3DS0 A;  3G6E 1;  1VQ8 P;  4XRQ A;  1YJ9 Z;  5HGM A;  2YAD A;  2QEX Z;  3S1N I;  2Q51 A;  3ESW A;  4RVD A;  4WYM A;  4U0F A;  2PY8 A;  1KD1 2;  4NB9 A;  3PO3 I;  5AN9 F;  3CD6 Z;  2ZAE B;  3S2D I;  1YJW 1;  3NH4 A;  3H4E A;  3CCQ P;  2QEX 1;  1K73 1;  2HU9 A;  1YJ9 P;  1VQM P;  3S1R I;  1YUA A;  3RZD I;  2P3Y A;  1YHQ Z;  4BBR I;  1ZMB A;  3KIH A;  2G2K A;  3G71 1;  3CCJ 1;  1Y1V S;  1YI2 P;  2E9H A;  1Q7Y Q;  3NFZ A;  1VQ5 P;  1VQK 1;  3J81 f;  3CD6 P;  4U0D A;  2LF4 A;  3WBH A;  2QRC B;  1DL6 A;  3VMG A;  2F4M A;  1YJ9 1;  2PEK A;  3TDH B;  2K3R A;  2RHB A;  2DE5 A;  1TWH I;  1Q82 1;  3CCJ P;  1VQL 1;  4GR6 A;  3BG0 B;  2JA6 I;  4COP A;  1YI2 Z;  3I4M I;  3D9X A;  4E2Z A;  3K7A I;  3EER A;  3S14 I;  2F4O A;  3QWU A;  3HOW I;  3P5J B;  2P28 A;  4EWC A;  4CL1 A;  1S72 Z;  4BY7 I;  5D1O A;  3Q20 A;  1VQM 1;  2JMO A;  3IX0 A;  5FLX b;  1RNI A;  1YIT Z;  3DS5 A;  1X0T A;  3I55 Z;  2M8N A;  1Q86 1;  3J80 b;  1KD1 Q;  3OW2 Z;  3CC4 1;  1N8R Q;  1NUI A;  1EOQ A;  1VQL Z;  2Y0S A;  2ONT A;  3G4S 1;  4U0C A;  2DGY A;  3CCS 1;  1I50 I;  4XFY A;  1M6E X;  1Y1W I;  1K9M 1;  4QTT A;  4XFZ A;  3GCF A;  1YI2 1;  3S1Q I;  3I56 1;  1A43 A;  1K30 A;  4PH1 A;  3I07 A;  2JA5 I;  2Z46 A;  3PO2 I;  2YU9 I;  1VQL P;  1QVG Z;  5C3E I;  2R93 I;  1X3W A;  1QVF Z;  1Q82 2;  2PEQ A;  3CCS P;  4XRO A;  2OTL 1;  3IF8 A;  1YIJ 1;  2QA4 P;  2KI7 B;  1M1K 1;  1JJ2 O;  3NH8 A;  1EIA A;  1D1D A;  2AKL A;  1ZB8 A;  1YJW Z;  3G26 A;  4NBD A;  2M8P A;  1Q7Y 1;  1KC8 Q;  1RQF A;  5FLX f;  2OTJ P;  2OOX B;  3CMA 1;  2PEN A;  1Q7Y 2;  3CCS Z;  2W04 A;  4NBF A;  2QA4 Z;  5I4T G;  1M1K 2;  2BHV A;  1VQ7 Z;  5HGO A;  2Z45 A;  3NH5 A;  4NBE A;  3G4S P;  2XT1 A;  2WAQ A;  4MH4 A;  3I55 1;  3CXC Z;  1QVF Y;  3G21 A;  3I56 Z;  5JPA A;  2OTJ Z;  3DS2 A;  1WW9 A;  1Q81 1;  3CMA P;  1YJN Z;  3S16 I;  5BS2 A;  2PEO A;  4A3D I;  3G6E Z;  2PEJ A;  4RVF A;  3FQM A;  3CCR 1;  2EG5 A;  1R9T I;  4XX2 A;  3G29 A;  3CME Z;  1K9M 2;  2NVX I;  1S7M A;  3P05 A;  2QEX P;  1K83 I;  3CCQ 1;  1TWG I;  4M0I A;  3I56 P;  2JA8 I;  3FQQ A;  1N2F A;  3G71 P;  4PH0 A;  2L6E A;  2PEI A;  3CCL 1;  3GTK I;  1USP B;  1Q86 2;  4RV9 A;  1KQS Z;  1K8A Q;  4A3C I;  1TWC I;  1KQS O;  3M4O I;  1QF8 A;  3PO3 S;  3OW2 O;  2OTL P;  2V8J A;  1RO4 A;  1YHQ P;  5C4X I;  1K73 Q;  3M1M A;  4HGY A;  3VMH A;  2GTH A;  2EFJ A;  2QR1 B;  3S17 I;  1PFT A;  2XXM A;  4DK1 A;  3G71 Z;  4A3G I;  2OZK A;  4NH1 C;  1TWA I;  3NTE A;  3T4N B;  3TE5 B;  3GTM S;  3CCE Z;  2BJO A;  3GKQ A;  3KIF A;  3G1I A;  3GTM I;  3CCR P;  4XFX A;  2NVY I;  3DS4 A;  5A2Q b;  4BXX I;  3J7A 4;  2RIQ A;  1VQN 1;  3G28 A;  1VQP P;  1VQ4 1;  1JJ2 Z;  2JO0 A;  4QTU A;  4IPY A;  3CCL Z;  3GTO I;  2GTI A;  3H3V J;  5IP9 I;  3MON A;  2RT9 A;  1QVG O;  4NFR A;  2R6M A;  1TWF I;  2IZ4 A;  1S72 P;  1TFI A;  4AYB A;  5D1P A;  1NJI 1;  1VQN P;  4MON A;  1YHQ 1;  4NOZ A;  2O4H A;  2R92 I;  5DCK A;  3CCL P;  2K5R A;  1VQP Z;  4X6A I;  1P9N A;  2NVT I;  3CPW Y;  2VUG A;  1K8A 2;  2HF1 A;  2EIA A;  3HZQ A;  1IUQ A;  3G1G A;  1KD1 1;  2PEM A;  5D1O B;  4HH4 A;  2J6A A;  1LQL A;  2Z44 A;  1VQO P;  4U0E A;  1QVF O;  4RVH A;  3CPW O;  3LUS A;  2QA4 1;  3DS1 A;  1QRJ A;  2QLV B;  2M8L A;  1K9M Q;  1RLY A;  1NP6 A;  2OOY B;  4Y52 I;  1W2B Y;  3VTN A;  2JYL A;  2JYG A;  2RBL A;  1ZH1 A;  4Y7N I;  2Q4Z A;  5CM2 M;  1ML8 A;  4A3F I;  3HOX I;  1VQ8 Z;  1VQO Z;  1I3Q I;  4A3K I;  3RZO I;  2JS4 A;  2V8I A;  3MZL B;  1M1K Q;  1S72 1;  1VQP 1;  4NBH A;  2JA7 I;  1KQS Y;  3I55 P;  4MD9 A;  2DE6 A;  2QKD A;  5C44 I;  4A3M I;  4QNB A;  3NDJ A;  2LIY A;  5C4J I;  3CC7 P;  2E2H I;  1VQM Z;  1VQ7 P;  1YIT 1;  1M90 2;  1AUM A;  3H0G I;  4BBS I;  5T6B A;  1N8R 2;  4MD8 A;  4A3E I;  3I4N I;  2QRD B;  5F2O A;  4E2W A;  3S15 I;  4RVG A;  2H85 A;  2O53 A;  3CC7 Z;  3CCU Z;  2OAR A;  1Z02 A;  3JAM f;  3CC7 1;  1VQO 1;  2B63 I;  2LFU A;  1Q86 Q;  1QYP A;  3G0V A;  2CWO A;  3CCJ Z;  1YUK A;  1W2B Z;  2I3C A;  1M74 A;  3GTG I;  4A93 I;  1Z03 A;  3GTQ I;  1QVG Y;  1YJN 1;  3NDI A;  3CCQ Z;  3CQZ I;  1K8A 1;  2VF1 A;  1Q81 2;  4U0A A;  2P9X A;  2QRE B;  3GTP I;  1VQ9 1;  1KC8 2;  1VQ7 1;  2JNY A;  3CCM 1;  3FKI I;  4NBA A;  4NBB A;  1YIT P;  1Z01 A;  3H47 A;  2EGT A;  5HGL A;  1VQ5 Z;  1X3Z A;  4A3I I;  3D6W A;  1YJN P;  3CMA Z;  5HGN A;  1VQ4 P;  2DE7 A;  3MZK B;  2JUB A;  3CCE P;  3S1M I;  5IT9 b;  5BS1 A;  3CME 1;  3CCR Z;  2NVQ I;  3CC2 1;  3IFU A;  3GTJ I;  1WCM I;  1JJ2 Y;  1SFO I;  4A3L I;  3CCM P;  1JWH C;  1VQ5 1;  4BY1 I;  3DPH A;  3HOZ I;  1VQ4 Z;  1VQ9 Z;  3DTJ A;  1K73 2;  3F3F C;  4DGL A;  4A3J I;  2OTL Z;  4MD7 A;  1Q81 Q;  4NB8 A;  3S2H I;  2PMZ A;  3H0D A;  3CCM Z;  4RS4 A;  3CCV P;  3HOY I;  3HOU I;  4E2Y A;  3CC2 Z;  1VQN Z;  2VUM I;  3CPW Z;  3VB9 A;  1W2B O;  1Q82 Q;  1KRL A;  1VQ9 P;  1RO2 A;  4MRI A;  3JAM b;  3CXC O;  4S1T A;  4E32 A;  3CC4 Z;  2GU2 A;  2V8K A;  1USP A;  1VQ6 Z;  4E2X A;  2JR6 A;  2KPI A;  1NJI 2;  2WB1 A;  3HYB A;  1L1O C;  3OW2 Y;  4A3B I;  3CCU 1;  3M3Y I;  2BUO A;  4E31 A;  3GTL I;  2E1M A;  3CCV Z;  4DQY B;  3VRL C;  3G4S Z;  3BG1 B;  4E33 A;  5IT9 f;  4GR2 A;  5F2K A;  3CC2 P;  2PM9 A;  3CC4 P;  1VQ6 P;  1BAJ A;  2XV6 A;  4U0B A;  3EED A;  3U50 C;  3G6E P;  1VQ8 1;  1Y1V I;  1ZB9 A;  3Q87 A;  3CCE 1;  4TNU A;  1N8R 1;  3HOV I;  3CME P;  3E2D A;  1M90 1;  3LRY A;  4MXU A;  3CXC Y;  2M6N A;  1YJW P;  1M6N A;  2E2I I;  1VQ6 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...