1RO2A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m manganese soak
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords hypothetical protein ORF904
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
total genus 59
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro2A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro2A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro2A02
3M1MA 1RO2A 1RNIA 1RO0A
chains in the Genus database with same CATH superfamily
1FDIA 1YIJ1 1Q81Q 2JA6I 3CCLZ 3J80b 2JAZA 2K94A 4E2WA 1LQLA 2CQ8A 1VLAA 1VQ4Z 5HGOA 1JJ2Z 3S17I 3G6E1 1VQLZ 3HKZA 4H2WC 4A3II 1AF8A 3CC2P 2R93I 2Y0SA 2ROQA 5D1OB 3G6EP 3I56Z 2OTL1 1VQNZ 1Z01A 2KOOA 5FLXf 3GTMS 1QRJA 3CXCY 2OARA 3CCE1 2NVQI 3DS0A 1T8KA 4GR2A 1KD1Q 1IMPA 2GZGA 4COCA 3HOVI 1E0HA 2M5RA 1GPJA 1VQPZ 3CCEP 5C44I 3GTPI 1M6EX 2K5XA 4BY1I 1USPB 1KD11 1DL6A 2FQ1A 3CPWY 3H3VJ 3D2LA 1RNIA 4WYMA 4Y7NI 1VQL1 2DGYA 3CCSZ 4E30A 4DGLA 3M3YI 3CMEZ 3NDJA 2VF1A 5JPAA 4HGZA 1F80D 2DNWA 3I561 1ZH1A 4NOZA 5HGMA 1VQOZ 1RO0A 2JGPA 2E7ZA 2K2QA 1OR5A 2L22A 2OOXB 2R6MA 4E2ZA 1WJ2A 4MH4A 1VQP1 3CD6Z 2PEOA 1YJNZ 5LL6f 4RV9A 3RZDI 2KGAA 1SIWA 1Q862 4E33A 1VQ61 1QVFY 1S721 2N5IA 1K8A2 4A3DI 2GZFA 2OTJP 1I50I 1KQSZ 1JWHC 3FKII 1Y1VI 3CME1 3TDHB 2JIMA 3PO3S 1Z02A 1VQMZ 4MD8A 4PXHB 3NTEA 3GKLC 1K9M2 3CC4P 1M74A 5KP6B 3U43A 3CXCO 3H0DA 1M902 2DE6A 3G21A 2B63I 3J7A4 2KOSA 2GTHA 1VHNA 3CD61 1YJN1 2MR8A 2NO8A 4AYBA 3GTOI 3GTKI 2V8JA 2X2BA 2GYKA 3D9XA 2VPXA 1Q86Q 4PH0A 4DQYB 1Q822 1K8AQ 1P9NA 3CCRP 1BAJA 2MVUA 4NBFA 3K7AI 7CEIA 3CCQZ 4BXXI 2KORA 1BXIA 1X3ZA 2KPIA 3S16I 1D1DA 1Q861 2VUGA 1EOQA 3F3PC 1K9MQ 2QKDA 2V45A 1MZ8A 4BY7I 5I4TG 1M90Q 3CMAZ 1N8R2 3CCVP 2EGTA 1M6NA 1KQSY 3CCMZ 3MZLB 5A2Qb 2V3VA 3GTLI 4HH4A 3S2HI 1DNYA 2J6AA 1M901 1QVFO 2KG9A 2CNRA 1YITZ 2MR7A 2FVAA 3G1IA 3HZQA 4F37A 1VQ51 2LTEA 3QWUA 4NBCA 2K0YA 1VQ9Z 4CA3A 5AN9F 1DV5A 2JA8I 3I55Z 1VQ5P 5EJDA 3J80f 1YJ9P 1CEIA 2PEIA 2XT1A 2QA4Z 2YU9I 2NVTI 2PENA 2FQ0A 4XROA 3CMA1 2LPKA 1FDOA 2Q4ZA 3HOZI 1N8RQ 2FAEA 4CL1A 5FLMI 4PWVB 3CCM1 2K0DX 3KIHA 1ZMBA 2E9HA 1M1K1 1KD12 2AYDA 2QEXZ 2AVAA 2K92A 1N8R1 3IX0A 4A3KI 1VQ91 2FACA 2WB1A 2LKIA 1TWCI 3D6WA 2L4BA 2P3YA 3DS2A 1YIJP 2QA41 2XZ0D 2K3RA 4DK1A 2N50A 1N2FA 5F2KA 4NBEA 1A8OA 4UHPB 3JAMb 2JIOA 2WAQA 3OW2Z 2VLQA 3NY7B 3FQMA 1K30A 1X3OA 3TE5B 2O53A 1ZB9A 2EFJA 2OTLP 4NBHA 3CCUZ 3KIFA 3G26A 3CC7Z 2KGDA 2HU9A 2IZ3A 3H4EA 1YJWZ 3S1RI 4BPFA 2M6NA 2V8IA 3VMHA 3CCL1 2XZ1C 2QRDB 2M8LA 4COPA 1VQ41 4IZ6A 3I4NI 4HKGA 3I4MI 5HGNA 4U0DA 2ZAEB 2K0XA 2AF8A 3LRYA 1VQ4P 1Z6MA 2I3CA 2JIPA 1VQN1 2FHSC 1VQLP 2EIAA 1W2BO 1QVGZ 1VQ8Z 5C4JI 2NAPA 1RO2A 4A3CI 4U0EA 1NJI1 3I56P 2N6YA 1YHQZ 2P28A 2VLPA 1ACPA 1VQKZ 3Q87A 1KC81 2LOLA 2OTJZ 1YJW1 1JJ2Y 2N5HA 2E1MA 2JBGA 3DPHA 4XFYA 3GJNA 1VQPP 1UJZA 3RG2A 2LEXA 2JYLA 3CC4Z 1WIIA 3LUSA 4QTTA 3CCS1 4GR6A 3GTQI 2BHVA 1VQ6P 2RT9A 2MVVA 4NBGA 1S72P 3DS3A 3CCSP 1VQO1 3CMEP 3CCJZ 5T6BA 1VQ81 3WBHA 1YUAA 2KI7B 1YI2Z 3DS5A 2RBLA 4NB9A 3S14I 1YHQ1 2PY8A 1VQK1 1VQOP 2PNGA 3LMOA 3G71Z 2RPRA 2FVEA 1EMVA 4QNBA 4R0MA 4MONA 2CG5B 3CD6P 2M8NA 5A2Qf 3CPWO 1YJNP 2Z45A 2DE5A 4A3GI 3GTGI 2FADA 1YUKA 2OOYB 1EIAA 1KLPA 5CM2M 3E2DA 5EW5E 4MD7A 5T67A 4NEOA 1VQM1 3HYBA 5BS1A 1GXHA 4HGYA 1IMQA 5IT9b 1Y1VS 1M1K2 2QRCB 1YI21 1TWGI 1R9TI 3VRLC 2Q51A 3T4NB 3GKQA 5IP9I 3H0GI 1JJ2O 4XX2A 4XRQA 4XFZA 5KP7B 3EERA 4NBDA 5IP7I 3G4SZ 2JU1A 2XXMA 3NDIA 2R92I 2JO0A 1ML8A 2MF4A 2JU2A 1TFIA 1WCMI 2JS4A 2AFDA 3S1NI 1FR2A 4M0IA 3GZMA 3HOYI 3CCQ1 1GXGA 2G2KA 4MXUA 3CCQP 2YADA 1PFTA 4RS4A 1RLYA 4E2XA 1M1KQ 4A3BI 2PM9A 1L1OC 4RVGA 3IF8A 1Q7Y2 2GU2A 3G1GA 4NBBA 2L6EA 1VQ7Z 2LMLA 2IZ4A 2QLVB 3VTNA 1K83I 5F2NA 3JAMf 5C3EI 2VUMI 3CMAP 3VMIA 5C4XI 2JB0A 2K5RA 1RO4A 3GZLA 2VPWA 1YIT1 3CCMP 1E6JP 3EEDA 3NFZA 3CXCZ 4MD9A 2LIWA 2E2HI 1Y8CA 2JR6A 2JIRA 2CWOA 1YITP 3S2DI 3I551 4BPHA 4NFRA 4H2XC 2GDXA 3CC2Z 3G6EZ 1VQ9P 2Z46A 3GTMI 2N6ZA 2KG8A 3I55P 3J81b 1NJI2 2M48A 3NH8A 4A3LI 1L0IA 1KC82 1Q7YQ 2QA4P 2LIYA 1VQ71 3Q20A 5DCKA 1KQSO 4Y52I 3DS1A 3CCEZ 4A3JI 4MRTC 4NBAA 2LL8A 3EJDA 2MD9A 4MRIA 2KOPA 2GZIA 2QEX1 3S1MI 2L0QA 2PK7A 4RVHA 1Q7Y1 5HVCA 1K731 3S1QI 2QEXP 3IFUA 5D1PA 4PH1A 1X3WA 3H47A 4A3MI 3CC21 2RHBA 2R7ZI 1Q811 4EWCA 4TNUA 2PEJA 2CGQA 3CCLP 2RIQA 2EHTA 4A3EI 2VSQA 1NJIQ 4NB8A 2JA5I 1QVFZ 2E2JI 3NH4A 1KC8Q 2BJOA 1KRLA 2JQ4A 3M1MA 2GZEA 1VQNP 3CCU1 5HGLA 2M8PA 3CC71 5F2OA 3MONA 3PO3I 2KWLA 2AFEA 3U50C 3CCUP 1VQ6Z 1Z03A 2MY5A 1S72Z 4A93I 3CC7P 1WZNA 4S1TA 3OW2Y 1YJWP 3F3FC 1A43A 2H85A 1AA6A 5CZDB 3P5JB 2AKLA 5FLXb 2LF4A 4A3FI 4RVDA 2KGEA 4IPYA 1I3QI 4U0BA 1ZB8A 1VKUA 2N98A 5IT9f 3VB9A 3RZOI 3DTJA 1QF8A 1QXFA 2F4MA 2EG5A 1S7MA 2ONTA 1VQ8P 2OTJ1 3EJBA 2KW2A 3CCRZ 5KP8B 1YHQP 3BG1B 1VQKP 2JYGA 3S15I 3B4QA 2VPZA 4BBRI 2E2II 2WPTA 2GDWA 1NUIA 2PEMA 3CC41 3BG0B 4E32A 1QVGY 2QR1B 3GTJI 1UNKA 2LIUA 4QTUA 2PEKA 2EHSA 2NVYI 2O4HA 1AUMA 2VPYA 2F4OA 3CCVZ 4E2YA 2KGCA 4NH1C 3CCJ1 2KR5A 1VQMP 2NVXI 1I6HI 4H2YC 2JUBA 1AYIA 4BPGA 3CCJP 2JNYA 2GZJA 3G711 3B5IA 2K93A 3HOWI 1YI2P 1QYPA 5D1OA 3CCR1 3G28A 4U0FA 3MZKB 2W03A 3HOXI 4X6AI 2KG6A 2P9XA 3G71P 3OW2O 2XV6A 1W2BZ 3GCFA 2GDYA 1VQ5Z 2VLNA 3VMGA 1TWHI 1YJ9Z 2HF1A 4U0CA 2FQ2A 3I07A 3RG6C 3CCV1 3EJEA 3CQZI 1USPA 3FQQA 1NP6A 1K8A1 3HOUI 2JMOA 2OZKA 5BS2A 2FVFA 1X0TA 3NH5A 3J81f 1SFOI 1K732 1K9M1 3DS4A 1RQFA 1NQ4A 4E31A 3G4S1 3G29A 1TWFI 3MGEA 1Q812 1Q82Q 1HQBA 5T64A 1YIJZ 2VLOA 1YJ91 2PEQA 1QVGO 1L0HA 3G4SP 2KOQA 3M4OI 3ESWA 3P05A 2JIQA 2JA7I 2GTIA 1Q821 2Z44A 2BUOA 4BBSI 1HY8A 3CPWZ 4QKOA 2QREB 4XFXA 1Y1WI 1TWAI 4RVFA 2OTLZ 3CE7A 1W2BY 2QNWA 1K73Q 2W04A 2DE7A 4U0AA 2LFUA 2PMZA 1Q16A 5HV8A 3IR7A 2ERHA 1WW9A 1ZNVA 3G0VA 2IV2X 3PO2I 1IUQA 1VQ7P 2KODA 4DG9A 2L9FA 2V8KA
chains in the Genus database with same CATH topology
1YIJ1 1Q81Q 2JA6I 3CCLZ 3J80b 4E2WA 1LQLA 1VLAA 1VQ4Z 5HGOA 1JJ2Z 3S17I 3G6E1 1VQLZ 3HKZA 4A3II 2R93I 3CC2P 2Y0SA 5D1OB 3I56Z 3G6EP 2OTL1 1VQNZ 1Z01A 5FLXf 3GTMS 1QRJA 3CXCY 2OARA 3CCE1 2NVQI 3DS0A 4GR2A 1KD1Q 4COCA 3HOVI 1VQPZ 3CCEP 5C44I 3GTPI 1M6EX 4BY1I 1USPB 1KD11 1DL6A 3CPWY 3H3VJ 1RNIA 4WYMA 4Y7NI 1VQL1 2DGYA 3CCSZ 4E30A 4DGLA 3M3YI 3CMEZ 3NDJA 2VF1A 5JPAA 4HGZA 3I561 1ZH1A 4NOZA 5HGMA 1VQOZ 1RO0A 4E2ZA 2OOXB 2R6MA 4MH4A 3CD6Z 1VQP1 2PEOA 1YJNZ 5LL6f 4RV9A 3RZDI 1Q862 4E33A 1VQ61 1QVFY 1S721 1K8A2 4A3DI 1I50I 2OTJP 1KQSZ 1JWHC 3FKII 1Y1VI 3CME1 3TDHB 3PO3S 1Z02A 1VQMZ 4MD8A 3NTEA 1K9M2 3CC4P 1M74A 3CXCO 3H0DA 1M902 2DE6A 3G21A 2B63I 3J7A4 2GTHA 3CD61 1YJN1 4AYBA 3GTOI 3GTKI 2V8JA 3D9XA 1Q86Q 4PH0A 4DQYB 1Q822 1K8AQ 1P9NA 3CCRP 1BAJA 4NBFA 3K7AI 3CCQZ 4BXXI 1X3ZA 2KPIA 3S16I 1D1DA 1Q861 2VUGA 1EOQA 3F3PC 1K9MQ 2QKDA 4BY7I 5I4TG 1M90Q 3CMAZ 1N8R2 3CCVP 2EGTA 1M6NA 1KQSY 3CCMZ 3MZLB 5A2Qb 3GTLI 4HH4A 3S2HI 2J6AA 1M901 1QVFO 1YITZ 3G1IA 3HZQA 1VQ51 3QWUA 4NBCA 1VQ9Z 5AN9F 2JA8I 3I55Z 1VQ5P 3J80f 1YJ9P 2YU9I 2PEIA 2XT1A 2QA4Z 2NVTI 2PENA 4XROA 3CMA1 2Q4ZA 3HOZI 1N8RQ 4CL1A 5FLMI 3CCM1 3KIHA 1ZMBA 2E9HA 1M1K1 1KD12 2QEXZ 1N8R1 3IX0A 4A3KI 1VQ91 2WB1A 1TWCI 3D6WA 2P3YA 3DS2A 1YIJP 2QA41 4DK1A 2K3RA 1N2FA 5F2KA 4NBEA 1A8OA 3JAMb 2WAQA 3OW2Z 3FQMA 1K30A 3TE5B 2O53A 1ZB9A 2EFJA 2OTLP 4NBHA 3CCUZ 3KIFA 3G26A 3CC7Z 2HU9A 2IZ3A 3H4EA 1YJWZ 3S1RI 3VMHA 2M6NA 2V8IA 3CCL1 2QRDB 2M8LA 4COPA 1VQ41 3I4NI 3I4MI 5HGNA 4U0DA 2ZAEB 3LRYA 1VQ4P 2I3CA 1VQN1 1VQLP 2EIAA 1W2BO 1QVGZ 1VQ8Z 5C4JI 1RO2A 4A3CI 4U0EA 1NJI1 3I56P 1YHQZ 2P28A 1VQKZ 3Q87A 1KC81 2OTJZ 1YJW1 1JJ2Y 2E1MA 3DPHA 4XFYA 1VQPP 2JYLA 3CC4Z 1WIIA 3LUSA 4QTTA 3CCS1 4GR6A 3GTQI 2BHVA 1VQ6P 2RT9A 4NBGA 1S72P 3DS3A 3CCSP 1VQO1 3CMEP 3CCJZ 5T6BA 1VQ81 3WBHA 1YUAA 2KI7B 1YI2Z 3DS5A 2RBLA 4NB9A 3S14I 1YHQ1 2PY8A 1VQK1 1VQOP 3G71Z 2RPRA 4QNBA 4MONA 3CD6P 5A2Qf 2M8NA 3CPWO 1YJNP 2Z45A 2DE5A 4A3GI 3GTGI 1YUKA 2OOYB 1EIAA 5CM2M 3E2DA 4MD7A 5T67A 1VQM1 3HYBA 5BS1A 4HGYA 5IT9b 1Y1VS 1M1K2 2QRCB 1YI21 1TWGI 1R9TI 3VRLC 2Q51A 3T4NB 3GKQA 5IP9I 3H0GI 1JJ2O 4XX2A 4XRQA 4XFZA 3EERA 4NBDA 5IP7I 3G4SZ 2XXMA 3NDIA 2R92I 2JO0A 1ML8A 1WCMI 1TFIA 2JS4A 3S1NI 4M0IA 3HOYI 3CCQ1 2G2KA 4MXUA 3CCQP 2YADA 1PFTA 4RS4A 1RLYA 4E2XA 1M1KQ 4A3BI 2PM9A 1L1OC 4RVGA 3IF8A 1Q7Y2 2GU2A 3G1GA 4NBBA 2L6EA 1VQ7Z 2IZ4A 2QLVB 3VTNA 1K83I 5F2NA 3JAMf 5C3EI 2VUMI 3CMAP 3VMIA 5C4XI 2K5RA 1RO4A 1YIT1 3CCMP 1E6JP 3EEDA 3NFZA 3CXCZ 4MD9A 2E2HI 2JR6A 2CWOA 1YITP 3S2DI 3I551 4NFRA 3CC2Z 3G6EZ 1VQ9P 2Z46A 3GTMI 3I55P 1NJI2 3J81b 2M48A 3NH8A 4A3LI 1KC82 1Q7YQ 2QA4P 2LIYA 1VQ71 3Q20A 5DCKA 1KQSO 4Y52I 3DS1A 3CCEZ 4A3JI 4NBAA 4MRIA 2QEX1 3S1MI 2PK7A 4RVHA 1Q7Y1 1K731 3S1QI 2QEXP 3IFUA 5D1PA 4PH1A 1X3WA 3H47A 4A3MI 3CC21 2RHBA 2R7ZI 1Q811 4EWCA 4TNUA 2PEJA 3CCLP 2RIQA 1QVFZ 4A3EI 1NJIQ 4NB8A 2JA5I 2E2JI 3NH4A 1KC8Q 2BJOA 1KRLA 3M1MA 1VQNP 3CCU1 5HGLA 2M8PA 3CC71 5F2OA 3MONA 3PO3I 3U50C 3CCUP 1VQ6Z 1Z03A 1S72Z 4A93I 3CC7P 4S1TA 3OW2Y 1YJWP 3F3FC 1A43A 2H85A 3P5JB 2AKLA 5FLXb 2LF4A 4A3FI 4RVDA 4IPYA 1I3QI 4U0BA 1ZB8A 5IT9f 3VB9A 3RZOI 3DTJA 1QF8A 2F4MA 2EG5A 1S7MA 2ONTA 1VQ8P 2OTJ1 3CCRZ 1YHQP 3BG1B 1VQKP 2JYGA 3S15I 4BBRI 2E2II 3CC41 1NUIA 2PEMA 3BG0B 4E32A 1QVGY 2QR1B 3GTJI 4QTUA 2PEKA 2NVYI 2O4HA 3CCVZ 1AUMA 2F4OA 4E2YA 3CCJ1 4NH1C 1VQMP 2NVXI 1I6HI 2JUBA 3CCJP 2JNYA 3G711 3B5IA 3HOWI 1YI2P 1QYPA 5D1OA 3CCR1 3G28A 4U0FA 3MZKB 2W03A 3HOXI 4X6AI 2P9XA 3G71P 3OW2O 2XV6A 1W2BZ 3GCFA 1VQ5Z 3VMGA 1TWHI 1YJ9Z 2HF1A 4U0CA 3I07A 3RG6C 3CCV1 3CQZI 1USPA 3FQQA 1NP6A 1K8A1 3HOUI 2JMOA 2OZKA 5BS2A 1X0TA 3NH5A 3J81f 1SFOI 1K732 1K9M1 3DS4A 1RQFA 4E31A 3G4S1 3G29A 1TWFI 3MGEA 1Q812 1Q82Q 5T64A 1YIJZ 1YJ91 2PEQA 1QVGO 3G4SP 3M4OI 3ESWA 3P05A 2JA7I 2GTIA 1Q821 2Z44A 2BUOA 4BBSI 3CPWZ 2QREB 4XFXA 1Y1WI 1TWAI 4RVFA 2OTLZ 1W2BY 1K73Q 2W04A 2DE7A 4U0AA 2LFUA 2PMZA 3PO2I 1WW9A 3G0VA 1IUQA 1VQ7P 2KODA 2V8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1M A;  1RO2 A;  1RNI A;  1RO0 A; 
#chains in the Genus database with same CATH topology
 1FDI A;  1YIJ 1;  1Q81 Q;  2JA6 I;  3CCL Z;  3J80 b;  2JAZ A;  2K94 A;  4E2W A;  1LQL A;  2CQ8 A;  1VLA A;  1VQ4 Z;  5HGO A;  1JJ2 Z;  3S17 I;  3G6E 1;  1VQL Z;  3HKZ A;  4H2W C;  4A3I I;  1AF8 A;  3CC2 P;  2R93 I;  2Y0S A;  2ROQ A;  5D1O B;  3G6E P;  3I56 Z;  2OTL 1;  1VQN Z;  1Z01 A;  2KOO A;  5FLX f;  3GTM S;  1QRJ A;  3CXC Y;  2OAR A;  3CCE 1;  2NVQ I;  3DS0 A;  1T8K A;  4GR2 A;  1KD1 Q;  1IMP A;  2GZG A;  4COC A;  3HOV I;  1E0H A;  2M5R A;  1GPJ A;  1VQP Z;  3CCE P;  5C44 I;  3GTP I;  1M6E X;  2K5X A;  4BY1 I;  1USP B;  1KD1 1;  1DL6 A;  2FQ1 A;  3CPW Y;  3H3V J;  3D2L A;  1RNI A;  4WYM A;  4Y7N I;  1VQL 1;  2DGY A;  3CCS Z;  4E30 A;  4DGL A;  3M3Y I;  3CME Z;  3NDJ A;  2VF1 A;  5JPA A;  4HGZ A;  1F80 D;  2DNW A;  3I56 1;  1ZH1 A;  4NOZ A;  5HGM A;  1VQO Z;  1RO0 A;  2JGP A;  2E7Z A;  2K2Q A;  1OR5 A;  2L22 A;  2OOX B;  2R6M A;  4E2Z A;  1WJ2 A;  4MH4 A;  1VQP 1;  3CD6 Z;  2PEO A;  1YJN Z;  5LL6 f;  4RV9 A;  3RZD I;  2KGA A;  1SIW A;  1Q86 2;  4E33 A;  1VQ6 1;  1QVF Y;  1S72 1;  2N5I A;  1K8A 2;  4A3D I;  2GZF A;  2OTJ P;  1I50 I;  1KQS Z;  1JWH C;  3FKI I;  1Y1V I;  3CME 1;  3TDH B;  2JIM A;  3PO3 S;  1Z02 A;  1VQM Z;  4MD8 A;  4PXH B;  3NTE A;  3GKL C;  1K9M 2;  3CC4 P;  1M74 A;  5KP6 B;  3U43 A;  3CXC O;  3H0D A;  1M90 2;  2DE6 A;  3G21 A;  2B63 I;  3J7A 4;  2KOS A;  2GTH A;  1VHN A;  3CD6 1;  1YJN 1;  2MR8 A;  2NO8 A;  4AYB A;  3GTO I;  3GTK I;  2V8J A;  2X2B A;  2GYK A;  3D9X A;  2VPX A;  1Q86 Q;  4PH0 A;  4DQY B;  1Q82 2;  1K8A Q;  1P9N A;  3CCR P;  1BAJ A;  2MVU A;  4NBF A;  3K7A I;  7CEI A;  3CCQ Z;  4BXX I;  2KOR A;  1BXI A;  1X3Z A;  2KPI A;  3S16 I;  1D1D A;  1Q86 1;  2VUG A;  1EOQ A;  3F3P C;  1K9M Q;  2QKD A;  2V45 A;  1MZ8 A;  4BY7 I;  5I4T G;  1M90 Q;  3CMA Z;  1N8R 2;  3CCV P;  2EGT A;  1M6N A;  1KQS Y;  3CCM Z;  3MZL B;  5A2Q b;  2V3V A;  3GTL I;  4HH4 A;  3S2H I;  1DNY A;  2J6A A;  1M90 1;  1QVF O;  2KG9 A;  2CNR A;  1YIT Z;  2MR7 A;  2FVA A;  3G1I A;  3HZQ A;  4F37 A;  1VQ5 1;  2LTE A;  3QWU A;  4NBC A;  2K0Y A;  1VQ9 Z;  4CA3 A;  5AN9 F;  1DV5 A;  2JA8 I;  3I55 Z;  1VQ5 P;  5EJD A;  3J80 f;  1YJ9 P;  1CEI A;  2PEI A;  2XT1 A;  2QA4 Z;  2YU9 I;  2NVT I;  2PEN A;  2FQ0 A;  4XRO A;  3CMA 1;  2LPK A;  1FDO A;  2Q4Z A;  3HOZ I;  1N8R Q;  2FAE A;  4CL1 A;  5FLM I;  4PWV B;  3CCM 1;  2K0D X;  3KIH A;  1ZMB A;  2E9H A;  1M1K 1;  1KD1 2;  2AYD A;  2QEX Z;  2AVA A;  2K92 A;  1N8R 1;  3IX0 A;  4A3K I;  1VQ9 1;  2FAC A;  2WB1 A;  2LKI A;  1TWC I;  3D6W A;  2L4B A;  2P3Y A;  3DS2 A;  1YIJ P;  2QA4 1;  2XZ0 D;  2K3R A;  4DK1 A;  2N50 A;  1N2F A;  5F2K A;  4NBE A;  1A8O A;  4UHP B;  3JAM b;  2JIO A;  2WAQ A;  3OW2 Z;  2VLQ A;  3NY7 B;  3FQM A;  1K30 A;  1X3O A;  3TE5 B;  2O53 A;  1ZB9 A;  2EFJ A;  2OTL P;  4NBH A;  3CCU Z;  3KIF A;  3G26 A;  3CC7 Z;  2KGD A;  2HU9 A;  2IZ3 A;  3H4E A;  1YJW Z;  3S1R I;  4BPF A;  2M6N A;  2V8I A;  3VMH A;  3CCL 1;  2XZ1 C;  2QRD B;  2M8L A;  4COP A;  1VQ4 1;  4IZ6 A;  3I4N I;  4HKG A;  3I4M I;  5HGN A;  4U0D A;  2ZAE B;  2K0X A;  2AF8 A;  3LRY A;  1VQ4 P;  1Z6M A;  2I3C A;  2JIP A;  1VQN 1;  2FHS C;  1VQL P;  2EIA A;  1W2B O;  1QVG Z;  1VQ8 Z;  5C4J I;  2NAP A;  1RO2 A;  4A3C I;  4U0E A;  1NJI 1;  3I56 P;  2N6Y A;  1YHQ Z;  2P28 A;  2VLP A;  1ACP A;  1VQK Z;  3Q87 A;  1KC8 1;  2LOL A;  2OTJ Z;  1YJW 1;  1JJ2 Y;  2N5H A;  2E1M A;  2JBG A;  3DPH A;  4XFY A;  3GJN A;  1VQP P;  1UJZ A;  3RG2 A;  2LEX A;  2JYL A;  3CC4 Z;  1WII A;  3LUS A;  4QTT A;  3CCS 1;  4GR6 A;  3GTQ I;  2BHV A;  1VQ6 P;  2RT9 A;  2MVV A;  4NBG A;  1S72 P;  3DS3 A;  3CCS P;  1VQO 1;  3CME P;  3CCJ Z;  5T6B A;  1VQ8 1;  3WBH A;  1YUA A;  2KI7 B;  1YI2 Z;  3DS5 A;  2RBL A;  4NB9 A;  3S14 I;  1YHQ 1;  2PY8 A;  1VQK 1;  1VQO P;  2PNG A;  3LMO A;  3G71 Z;  2RPR A;  2FVE A;  1EMV A;  4QNB A;  4R0M A;  4MON A;  2CG5 B;  3CD6 P;  2M8N A;  5A2Q f;  3CPW O;  1YJN P;  2Z45 A;  2DE5 A;  4A3G I;  3GTG I;  2FAD A;  1YUK A;  2OOY B;  1EIA A;  1KLP A;  5CM2 M;  3E2D A;  5EW5 E;  4MD7 A;  5T67 A;  4NEO A;  1VQM 1;  3HYB A;  5BS1 A;  1GXH A;  4HGY A;  1IMQ A;  5IT9 b;  1Y1V S;  1M1K 2;  2QRC B;  1YI2 1;  1TWG I;  1R9T I;  3VRL C;  2Q51 A;  3T4N B;  3GKQ A;  5IP9 I;  3H0G I;  1JJ2 O;  4XX2 A;  4XRQ A;  4XFZ A;  5KP7 B;  3EER A;  4NBD A;  5IP7 I;  3G4S Z;  2JU1 A;  2XXM A;  3NDI A;  2R92 I;  2JO0 A;  1ML8 A;  2MF4 A;  2JU2 A;  1TFI A;  1WCM I;  2JS4 A;  2AFD A;  3S1N I;  1FR2 A;  4M0I A;  3GZM A;  3HOY I;  3CCQ 1;  1GXG A;  2G2K A;  4MXU A;  3CCQ P;  2YAD A;  1PFT A;  4RS4 A;  1RLY A;  4E2X A;  1M1K Q;  4A3B I;  2PM9 A;  1L1O C;  4RVG A;  3IF8 A;  1Q7Y 2;  2GU2 A;  3G1G A;  4NBB A;  2L6E A;  1VQ7 Z;  2LML A;  2IZ4 A;  2QLV B;  3VTN A;  1K83 I;  5F2N A;  3JAM f;  5C3E I;  2VUM I;  3CMA P;  3VMI A;  5C4X I;  2JB0 A;  2K5R A;  1RO4 A;  3GZL A;  2VPW A;  1YIT 1;  3CCM P;  1E6J P;  3EED A;  3NFZ A;  3CXC Z;  4MD9 A;  2LIW A;  2E2H I;  1Y8C A;  2JR6 A;  2JIR A;  2CWO A;  1YIT P;  3S2D I;  3I55 1;  4BPH A;  4NFR A;  4H2X C;  2GDX A;  3CC2 Z;  3G6E Z;  1VQ9 P;  2Z46 A;  3GTM I;  2N6Z A;  2KG8 A;  3I55 P;  3J81 b;  1NJI 2;  2M48 A;  3NH8 A;  4A3L I;  1L0I A;  1KC8 2;  1Q7Y Q;  2QA4 P;  2LIY A;  1VQ7 1;  3Q20 A;  5DCK A;  1KQS O;  4Y52 I;  3DS1 A;  3CCE Z;  4A3J I;  4MRT C;  4NBA A;  2LL8 A;  3EJD A;  2MD9 A;  4MRI A;  2KOP A;  2GZI A;  2QEX 1;  3S1M I;  2L0Q A;  2PK7 A;  4RVH A;  1Q7Y 1;  5HVC A;  1K73 1;  3S1Q I;  2QEX P;  3IFU A;  5D1P A;  4PH1 A;  1X3W A;  3H47 A;  4A3M I;  3CC2 1;  2RHB A;  2R7Z I;  1Q81 1;  4EWC A;  4TNU A;  2PEJ A;  2CGQ A;  3CCL P;  2RIQ A;  2EHT A;  4A3E I;  2VSQ A;  1NJI Q;  4NB8 A;  2JA5 I;  1QVF Z;  2E2J I;  3NH4 A;  1KC8 Q;  2BJO A;  1KRL A;  2JQ4 A;  3M1M A;  2GZE A;  1VQN P;  3CCU 1;  5HGL A;  2M8P A;  3CC7 1;  5F2O A;  3MON A;  3PO3 I;  2KWL A;  2AFE A;  3U50 C;  3CCU P;  1VQ6 Z;  1Z03 A;  2MY5 A;  1S72 Z;  4A93 I;  3CC7 P;  1WZN A;  4S1T A;  3OW2 Y;  1YJW P;  3F3F C;  1A43 A;  2H85 A;  1AA6 A;  5CZD B;  3P5J B;  2AKL A;  5FLX b;  2LF4 A;  4A3F I;  4RVD A;  2KGE A;  4IPY A;  1I3Q I;  4U0B A;  1ZB8 A;  1VKU A;  2N98 A;  5IT9 f;  3VB9 A;  3RZO I;  3DTJ A;  1QF8 A;  1QXF A;  2F4M A;  2EG5 A;  1S7M A;  2ONT A;  1VQ8 P;  2OTJ 1;  3EJB A;  2KW2 A;  3CCR Z;  5KP8 B;  1YHQ P;  3BG1 B;  1VQK P;  2JYG A;  3S15 I;  3B4Q A;  2VPZ A;  4BBR I;  2E2I I;  2WPT A;  2GDW A;  1NUI A;  2PEM A;  3CC4 1;  3BG0 B;  4E32 A;  1QVG Y;  2QR1 B;  3GTJ I;  1UNK A;  2LIU A;  4QTU A;  2PEK A;  2EHS A;  2NVY I;  2O4H A;  1AUM A;  2VPY A;  2F4O A;  3CCV Z;  4E2Y A;  2KGC A;  4NH1 C;  3CCJ 1;  2KR5 A;  1VQM P;  2NVX I;  1I6H I;  4H2Y C;  2JUB A;  1AYI A;  4BPG A;  3CCJ P;  2JNY A;  2GZJ A;  3G71 1;  3B5I A;  2K93 A;  3HOW I;  1YI2 P;  1QYP A;  5D1O A;  3CCR 1;  3G28 A;  4U0F A;  3MZK B;  2W03 A;  3HOX I;  4X6A I;  2KG6 A;  2P9X A;  3G71 P;  3OW2 O;  2XV6 A;  1W2B Z;  3GCF A;  2GDY A;  1VQ5 Z;  2VLN A;  3VMG A;  1TWH I;  1YJ9 Z;  2HF1 A;  4U0C A;  2FQ2 A;  3I07 A;  3RG6 C;  3CCV 1;  3EJE A;  3CQZ I;  1USP A;  3FQQ A;  1NP6 A;  1K8A 1;  3HOU I;  2JMO A;  2OZK A;  5BS2 A;  2FVF A;  1X0T A;  3NH5 A;  3J81 f;  1SFO I;  1K73 2;  1K9M 1;  3DS4 A;  1RQF A;  1NQ4 A;  4E31 A;  3G4S 1;  3G29 A;  1TWF I;  3MGE A;  1Q81 2;  1Q82 Q;  1HQB A;  5T64 A;  1YIJ Z;  2VLO A;  1YJ9 1;  2PEQ A;  1QVG O;  1L0H A;  3G4S P;  2KOQ A;  3M4O I;  3ESW A;  3P05 A;  2JIQ A;  2JA7 I;  2GTI A;  1Q82 1;  2Z44 A;  2BUO A;  4BBS I;  1HY8 A;  3CPW Z;  4QKO A;  2QRE B;  4XFX A;  1Y1W I;  1TWA I;  4RVF A;  2OTL Z;  3CE7 A;  1W2B Y;  2QNW A;  1K73 Q;  2W04 A;  2DE7 A;  4U0A A;  2LFU A;  2PMZ A;  1Q16 A;  5HV8 A;  3IR7 A;  2ERH A;  1WW9 A;  1ZNV A;  3G0V A;  2IV2 X;  3PO2 I;  1IUQ A;  1VQ7 P;  2KOD A;  4DG9 A;  2L9F A;  2V8K A; 
#chains in the Genus database with same CATH homology
 1YIJ 1;  1Q81 Q;  2JA6 I;  3CCL Z;  3J80 b;  4E2W A;  1LQL A;  1VLA A;  1VQ4 Z;  5HGO A;  1JJ2 Z;  3S17 I;  3G6E 1;  1VQL Z;  3HKZ A;  4A3I I;  2R93 I;  3CC2 P;  2Y0S A;  5D1O B;  3I56 Z;  3G6E P;  2OTL 1;  1VQN Z;  1Z01 A;  5FLX f;  3GTM S;  1QRJ A;  3CXC Y;  2OAR A;  3CCE 1;  2NVQ I;  3DS0 A;  4GR2 A;  1KD1 Q;  4COC A;  3HOV I;  1VQP Z;  3CCE P;  5C44 I;  3GTP I;  1M6E X;  4BY1 I;  1USP B;  1KD1 1;  1DL6 A;  3CPW Y;  3H3V J;  1RNI A;  4WYM A;  4Y7N I;  1VQL 1;  2DGY A;  3CCS Z;  4E30 A;  4DGL A;  3M3Y I;  3CME Z;  3NDJ A;  2VF1 A;  5JPA A;  4HGZ A;  3I56 1;  1ZH1 A;  4NOZ A;  5HGM A;  1VQO Z;  1RO0 A;  4E2Z A;  2OOX B;  2R6M A;  4MH4 A;  3CD6 Z;  1VQP 1;  2PEO A;  1YJN Z;  5LL6 f;  4RV9 A;  3RZD I;  1Q86 2;  4E33 A;  1VQ6 1;  1QVF Y;  1S72 1;  1K8A 2;  4A3D I;  1I50 I;  2OTJ P;  1KQS Z;  1JWH C;  3FKI I;  1Y1V I;  3CME 1;  3TDH B;  3PO3 S;  1Z02 A;  1VQM Z;  4MD8 A;  3NTE A;  1K9M 2;  3CC4 P;  1M74 A;  3CXC O;  3H0D A;  1M90 2;  2DE6 A;  3G21 A;  2B63 I;  3J7A 4;  2GTH A;  3CD6 1;  1YJN 1;  4AYB A;  3GTO I;  3GTK I;  2V8J A;  3D9X A;  1Q86 Q;  4PH0 A;  4DQY B;  1Q82 2;  1K8A Q;  1P9N A;  3CCR P;  1BAJ A;  4NBF A;  3K7A I;  3CCQ Z;  4BXX I;  1X3Z A;  2KPI A;  3S16 I;  1D1D A;  1Q86 1;  2VUG A;  1EOQ A;  3F3P C;  1K9M Q;  2QKD A;  4BY7 I;  5I4T G;  1M90 Q;  3CMA Z;  1N8R 2;  3CCV P;  2EGT A;  1M6N A;  1KQS Y;  3CCM Z;  3MZL B;  5A2Q b;  3GTL I;  4HH4 A;  3S2H I;  2J6A A;  1M90 1;  1QVF O;  1YIT Z;  3G1I A;  3HZQ A;  1VQ5 1;  3QWU A;  4NBC A;  1VQ9 Z;  5AN9 F;  2JA8 I;  3I55 Z;  1VQ5 P;  3J80 f;  1YJ9 P;  2YU9 I;  2PEI A;  2XT1 A;  2QA4 Z;  2NVT I;  2PEN A;  4XRO A;  3CMA 1;  2Q4Z A;  3HOZ I;  1N8R Q;  4CL1 A;  5FLM I;  3CCM 1;  3KIH A;  1ZMB A;  2E9H A;  1M1K 1;  1KD1 2;  2QEX Z;  1N8R 1;  3IX0 A;  4A3K I;  1VQ9 1;  2WB1 A;  1TWC I;  3D6W A;  2P3Y A;  3DS2 A;  1YIJ P;  2QA4 1;  4DK1 A;  2K3R A;  1N2F A;  5F2K A;  4NBE A;  1A8O A;  3JAM b;  2WAQ A;  3OW2 Z;  3FQM A;  1K30 A;  3TE5 B;  2O53 A;  1ZB9 A;  2EFJ A;  2OTL P;  4NBH A;  3CCU Z;  3KIF A;  3G26 A;  3CC7 Z;  2HU9 A;  2IZ3 A;  3H4E A;  1YJW Z;  3S1R I;  3VMH A;  2M6N A;  2V8I A;  3CCL 1;  2QRD B;  2M8L A;  4COP A;  1VQ4 1;  3I4N I;  3I4M I;  5HGN A;  4U0D A;  2ZAE B;  3LRY A;  1VQ4 P;  2I3C A;  1VQN 1;  1VQL P;  2EIA A;  1W2B O;  1QVG Z;  1VQ8 Z;  5C4J I;  1RO2 A;  4A3C I;  4U0E A;  1NJI 1;  3I56 P;  1YHQ Z;  2P28 A;  1VQK Z;  3Q87 A;  1KC8 1;  2OTJ Z;  1YJW 1;  1JJ2 Y;  2E1M A;  3DPH A;  4XFY A;  1VQP P;  2JYL A;  3CC4 Z;  1WII A;  3LUS A;  4QTT A;  3CCS 1;  4GR6 A;  3GTQ I;  2BHV A;  1VQ6 P;  2RT9 A;  4NBG A;  1S72 P;  3DS3 A;  3CCS P;  1VQO 1;  3CME P;  3CCJ Z;  5T6B A;  1VQ8 1;  3WBH A;  1YUA A;  2KI7 B;  1YI2 Z;  3DS5 A;  2RBL A;  4NB9 A;  3S14 I;  1YHQ 1;  2PY8 A;  1VQK 1;  1VQO P;  3G71 Z;  2RPR A;  4QNB A;  4MON A;  3CD6 P;  5A2Q f;  2M8N A;  3CPW O;  1YJN P;  2Z45 A;  2DE5 A;  4A3G I;  3GTG I;  1YUK A;  2OOY B;  1EIA A;  5CM2 M;  3E2D A;  4MD7 A;  5T67 A;  1VQM 1;  3HYB A;  5BS1 A;  4HGY A;  5IT9 b;  1Y1V S;  1M1K 2;  2QRC B;  1YI2 1;  1TWG I;  1R9T I;  3VRL C;  2Q51 A;  3T4N B;  3GKQ A;  5IP9 I;  3H0G I;  1JJ2 O;  4XX2 A;  4XRQ A;  4XFZ A;  3EER A;  4NBD A;  5IP7 I;  3G4S Z;  2XXM A;  3NDI A;  2R92 I;  2JO0 A;  1ML8 A;  1WCM I;  1TFI A;  2JS4 A;  3S1N I;  4M0I A;  3HOY I;  3CCQ 1;  2G2K A;  4MXU A;  3CCQ P;  2YAD A;  1PFT A;  4RS4 A;  1RLY A;  4E2X A;  1M1K Q;  4A3B I;  2PM9 A;  1L1O C;  4RVG A;  3IF8 A;  1Q7Y 2;  2GU2 A;  3G1G A;  4NBB A;  2L6E A;  1VQ7 Z;  2IZ4 A;  2QLV B;  3VTN A;  1K83 I;  5F2N A;  3JAM f;  5C3E I;  2VUM I;  3CMA P;  3VMI A;  5C4X I;  2K5R A;  1RO4 A;  1YIT 1;  3CCM P;  1E6J P;  3EED A;  3NFZ A;  3CXC Z;  4MD9 A;  2E2H I;  2JR6 A;  2CWO A;  1YIT P;  3S2D I;  3I55 1;  4NFR A;  3CC2 Z;  3G6E Z;  1VQ9 P;  2Z46 A;  3GTM I;  3I55 P;  1NJI 2;  3J81 b;  2M48 A;  3NH8 A;  4A3L I;  1KC8 2;  1Q7Y Q;  2QA4 P;  2LIY A;  1VQ7 1;  3Q20 A;  5DCK A;  1KQS O;  4Y52 I;  3DS1 A;  3CCE Z;  4A3J I;  4NBA A;  4MRI A;  2QEX 1;  3S1M I;  2PK7 A;  4RVH A;  1Q7Y 1;  1K73 1;  3S1Q I;  2QEX P;  3IFU A;  5D1P A;  4PH1 A;  1X3W A;  3H47 A;  4A3M I;  3CC2 1;  2RHB A;  2R7Z I;  1Q81 1;  4EWC A;  4TNU A;  2PEJ A;  3CCL P;  2RIQ A;  1QVF Z;  4A3E I;  1NJI Q;  4NB8 A;  2JA5 I;  2E2J I;  3NH4 A;  1KC8 Q;  2BJO A;  1KRL A;  3M1M A;  1VQN P;  3CCU 1;  5HGL A;  2M8P A;  3CC7 1;  5F2O A;  3MON A;  3PO3 I;  3U50 C;  3CCU P;  1VQ6 Z;  1Z03 A;  1S72 Z;  4A93 I;  3CC7 P;  4S1T A;  3OW2 Y;  1YJW P;  3F3F C;  1A43 A;  2H85 A;  3P5J B;  2AKL A;  5FLX b;  2LF4 A;  4A3F I;  4RVD A;  4IPY A;  1I3Q I;  4U0B A;  1ZB8 A;  5IT9 f;  3VB9 A;  3RZO I;  3DTJ A;  1QF8 A;  2F4M A;  2EG5 A;  1S7M A;  2ONT A;  1VQ8 P;  2OTJ 1;  3CCR Z;  1YHQ P;  3BG1 B;  1VQK P;  2JYG A;  3S15 I;  4BBR I;  2E2I I;  3CC4 1;  1NUI A;  2PEM A;  3BG0 B;  4E32 A;  1QVG Y;  2QR1 B;  3GTJ I;  4QTU A;  2PEK A;  2NVY I;  2O4H A;  3CCV Z;  1AUM A;  2F4O A;  4E2Y A;  3CCJ 1;  4NH1 C;  1VQM P;  2NVX I;  1I6H I;  2JUB A;  3CCJ P;  2JNY A;  3G71 1;  3B5I A;  3HOW I;  1YI2 P;  1QYP A;  5D1O A;  3CCR 1;  3G28 A;  4U0F A;  3MZK B;  2W03 A;  3HOX I;  4X6A I;  2P9X A;  3G71 P;  3OW2 O;  2XV6 A;  1W2B Z;  3GCF A;  1VQ5 Z;  3VMG A;  1TWH I;  1YJ9 Z;  2HF1 A;  4U0C A;  3I07 A;  3RG6 C;  3CCV 1;  3CQZ I;  1USP A;  3FQQ A;  1NP6 A;  1K8A 1;  3HOU I;  2JMO A;  2OZK A;  5BS2 A;  1X0T A;  3NH5 A;  3J81 f;  1SFO I;  1K73 2;  1K9M 1;  3DS4 A;  1RQF A;  4E31 A;  3G4S 1;  3G29 A;  1TWF I;  3MGE A;  1Q81 2;  1Q82 Q;  5T64 A;  1YIJ Z;  1YJ9 1;  2PEQ A;  1QVG O;  3G4S P;  3M4O I;  3ESW A;  3P05 A;  2JA7 I;  2GTI A;  1Q82 1;  2Z44 A;  2BUO A;  4BBS I;  3CPW Z;  2QRE B;  4XFX A;  1Y1W I;  1TWA I;  4RVF A;  2OTL Z;  1W2B Y;  1K73 Q;  2W04 A;  2DE7 A;  4U0A A;  2LFU A;  2PMZ A;  3PO2 I;  1WW9 A;  3G0V A;  1IUQ A;  1VQ7 P;  2KOD A;  2V8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...