1RO2A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m manganese soak
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein ORF904
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
total genus 59
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro2A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro2A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro2A02
1RO2A 1RO0A 3M1MA 1RNIA
chains in the Genus database with same CATH superfamily
2VPYA 2NO8A 2N50A 1WIIA 3G71Z 3PO2I 1VQN1 1Q822 1I3QI 4BPGA 2BJOA 4U0EA 4QTTA 2JA7I 1VQ51 3GTOI 2FQ0A 1I50I 4DGLA 3CCSZ 2JIOA 2R92I 3CC41 4NBGA 2KG6A 3VRLC 2GZIA 2L6EA 4RVFA 3CCJ1 2K3RA 1VQPZ 1VQOZ 1MZ8A 4H2XC 1EIAA 2DE6A 2K0YA 2JQ4A 1QVGY 4HKGA 1QF8A 1YHQP 2OOYB 2GZEA 1ZB8A 3GTQI 3CCS1 2CGQA 2LEXA 4X6AI 2HU9A 2VF1A 5A2Qb 1L0IA 1VQP1 1VQO1 2NVTI 2LIWA 2YU9I 1W2BO 3GTPI 3GJNA 1KC81 4PWVB 3S2HI 1X3ZA 3CCUP 2GU2A 2JUBA 1Q811 3J81b 1OR5A 1TWAI 3MONA 1VQ7Z 2I3CA 2LFUA 5T64A 2VPWA 2L9FA 4E2YA 2L4BA 2LTEA 1PFTA 3CCRP 4E32A 4RVHA 3VMGA 4CA3A 2JA5I 3HOYI 3MZKB 4U0CA 4DG9A 1YUAA 1VQ9P 2AVAA 1VQ71 3CE7A 5A2Qf 1QVGZ 2PEKA 3CCQP 3ESWA 1YJNP 2FVEA 2PEMA 2R93I 1TWHI 3HZQA 1BAJA 2KOSA 2V45A 1K732 3CCMP 3J81f 2BHVA 2GYKA 1NJIQ 2PEJA 3JAMb 3G6EZ 4A3II 4E33A 1EMVA 4E2ZA 2VLPA 2JYLA 1S72P 1Q821 1N2FA 3IFUA 2K0DX 4A3KI 4NBDA 1UJZA 4COPA 2P3YA 3G6E1 2KODA 1M74A 1WJ2A 2KGDA 3CD6P 1F80D 5EJDA 4BBSI 1K30A 3G1IA 3G1GA 3DPHA 2L22A 4GR2A 3JAMf 2VLOA 5HGMA 4BY1I 3CMAZ 4NBHA 1AUMA 1YIJ1 4M0IA 3GKQA 3H0GI 2NVYI 5D1OA 3G4SP 1USPB 1KQSZ 4NBCA 3DS3A 1TWCI 4QKOA 4XROA 3I07A 2QA4Z 3BG1B 3CMA1 2V8JA 2M8NA 1Z6MA 1QVFO 1YI2Z 2EIAA 4PXHB 4BXXI 2FAEA 2KI7B 2M48A 3F3FC 2KOOA 2VPXA 2DE5A 2CNRA 3KIFA 1M90Q 1VQ41 3G21A 2QEXP 1JJ2O 2QA41 3RG2A 3DS4A 3DS1A 3OW2O 3G29A 5JPAA 1K9MQ 3CC2Z 1YJ9P 1YI21 4CL1A 3QWUA 4BPHA 2P28A 1Q862 2VPZA 4MXUA 2DNWA 1HQBA 4QNBA 1K731 1YITZ 5KP6B 2RBLA 1HY8A 2FHSC 3NFZA 5C4XI 2OTL1 1T8KA 2N6ZA 4Y52I 2X2BA 1A43A 2AFEA 1FDIA 2JU1A 2RT9A 4U0FA 3CC4Z 3RZDI 3CCEP 2AFDA 2HF1A 2DE7A 1M1KQ 3DS2A 1SFOI 1VQMP 1IMQA 4A3BI 2R6MA 1YIT1 2KOQA 5T6BA 1VQLZ 3D9XA 1A8OA 1E6JP 3CXCO 3I56Z 3GCFA 1AF8A 1K8A2 2LPKA 1YIJP 1L1OC 2MY5A 3FQMA 4E30A 1VQNP 3PO3S 4MONA 4EWCA 3NH4A 4MD8A 4XFXA 1QXFA 1GXGA 3GZMA 1VQL1 3NY7B 1VQ5P 3H3VJ 2OARA 1Z03A 5C3EI 4PH0A 3I561 1Q7Y2 3S16I 3PO3I 3GTMS 3CCJP 2EHTA 3Q87A 1Y8CA 3G71P 2KW2A 4HH4A 3S1QI 4NB8A 3LMOA 2FQ2A 1WCMI 4E2WA 1P9NA 2YADA 3S1RI 2FQ1A 1KC8Q 3GTMI 3VTNA 2N98A 2KGAA 4NBAA 5LL6f 4AYBA 2KORA 2M8PA 2FACA 3CCSP 4MRIA 1X3WA 2EFJA 2OTJZ 2KR5A 4F37A 3M4OI 1Q81Q 3CPWO 1GPJA 1VQPP 1VQOP 1UNKA 3B4QA 4H2YC 1QYPA 5C4JI 3NDJA 1QRJA 1M6NA 2M6NA 1X3OA 1X0TA 2CWOA 3IX0A 2JIQA 3T4NB 4XX2A 2Q51A 3M3YI 2GTIA 3P5JB 3S17I 2OTJ1 1FR2A 1VQ9Z 2F4OA 1Q861 3EERA 2PEOA 2Z44A 2V8IA 3EJDA 1DV5A 2NVQI 1ZB9A 2VLQA 1YJNZ 2QREB 1RO2A 3B5IA 4RV9A 2MR8A 4DK1A 2WPTA 1N8R2 1RO4A 1VQ7P 4HGYA 1KQSY 1AA6A 1VQ91 2Y0SA 2KG8A 1YJN1 5IT9b 1Q82Q 3WBHA 3CMEZ 1RO0A 3NDIA 5DCKA 1E0HA 1WZNA 2PEQA 4A3DI 3CCM1 2EHSA 2KGEA 1K8A1 1VQ8Z 3I4MI 3G28A 3CC7Z 3FKII 1Q16A 4MD9A 3CQZI 1W2BY 3VMHA 2N6YA 4PH1A 3CME1 2FVFA 2GTHA 4TNUA 1YJWZ 4HGZA 4BBRI 3G6EP 1Q7Y1 3NH5A 1GXHA 1Y1VS 1VQ81 3CCVZ 2CQ8A 2RPRA 3CC71 2JS4A 4MD7A 3I55Z 5IT9f 4RS4A 4DQYB 1ML8A 1KD12 2PEIA 2QRCB 2K0XA 2IV2X 2JB0A 1DL6A 2BUOA 1Y1VI 2JA8I 1YJW1 1VQKZ 2N5IA 2O4HA 2MD9A 3KIHA 1RNIA 4H2WC 1VQ4Z 3GTGI 1SIWA 2N5HA 3CCV1 2NAPA 3MZLB 3I551 2XZ0D 2QLVB 1LQLA 2JR6A 2CG5B 2EG5A 1Z02A 3G4S1 4E2XA 5EW5E 4U0BA 4XRQA 2JU2A 1VQK1 2KPIA 4A3LI 3CMAP 3LRYA 2LF4A 2JNYA 1VQ6P 2OTLZ 2MF4A 1W2BZ 3CCLZ 3HOWI 2JAZA 5D1PA 3MGEA 5KP7B 4A3FI 2ZAEB 4A93I 5CZDB 5HV8A 2JIPA 2FADA 3EJBA 1QVGO 2IZ3A 1K73Q 1N8R1 1RLYA 2QA4P 3F3PC 2XV6A 2QEX1 3BG0B 1YI2P 2OOXB 4Y7NI 3CCL1 3IF8A 4XFYA 1NUIA 2Z46A 5HGNA 2GDXA 4IPYA 4NH1C 3GZLA 2H85A 4MH4A 1IMPA 2GZJA 3GKLC 1FDOA 2RHBA 3CC2P 2E2HI 2LMLA 2Q4ZA 2Z45A 2QKDA 3I4NI 1YITP 1TWFI 4BY7I 2JGPA 4NEOA 1KLPA 1BXIA 2QNWA 5IP7I 2GZGA 1D1DA 1NJI2 2XXMA 1YHQZ 1IUQA 1QVFY 2KGCA 2KOPA 3CC4P 4A3GI 5F2OA 2WAQA 4RVGA 3GTLI 2RIQA 1KD11 3EEDA 3HKZA 2V3VA 1VQLP 2P9XA 5F2NA 3U50C 7CEIA 2W03A 3I56P 1JJ2Y 3J7A4 3EJEA 3NTEA 1CEIA 2JIRA 1KQSO 1RQFA 3OW2Y 1YHQ1 5AN9F 4NB9A 3S1MI 4COCA 2FVAA 3CCUZ 3S15I 4NOZA 3TDHB 2DGYA 2XT1A 3G711 1L0HA 2M5RA 4U0AA 2GZFA 1EOQA 2LOLA 1NP6A 3J80b 3CCRZ 3HOVI 1DNYA 3HOUI 2W04A 5IP9I 2MVVA 3H0DA 5HGLA 2QRDB 2E9HA 2J6AA 3CCU1 3HOZI 1Q86Q 4BPFA 2QR1B 3GTKI 3H47A 3HOXI 4A3JI 3CCQZ 2K5RA 2R7ZI 2MVUA 3CCR1 2E2JI 1QVFZ 1AYIA 3DS5A 3CXCY 3D2LA 2OTJP 2VUGA 3CCMZ 4MRTC 3RG6C 1M6EX 3Q20A 2B63I 3DTJA 2JYGA 2JIMA 5FLMI 2VLNA 3J80f 2XZ1C 1JJ2Z 4NBEA 3CCQ1 2PY8A 1S72Z 3HYBA 5I4TG 2WB1A 4NBBA 2JBGA 3OW2Z 2EGTA 1Y1WI 2LKIA 3IR7A 1M902 2E2II 2KWLA 2ERHA 1JWHC 1K8AQ 5FLXb 1VHNA 3LUSA 1K9M2 3VMIA 5HVCA 3CD6Z 3E2DA 1S7MA 5D1OB 4U0DA 1S721 2AYDA 2M8LA 4A3CI 1YUKA 1NJI1 2VSQA 1VKUA 1Q7YQ 4A3MI 3CPWY 2PK7A 3S1NI 4NBFA 2JO0A 1ZMBA 3NH8A 5C44I 5CM2M 3CMEP 3CXCZ 3CD61 1Z01A 1M1K2 4NFRA 3G4SZ 5HGOA 4UHPB 2IZ4A 5FLXf 3K7AI 2JA6I 1VQ8P 3CC7P 3VB9A 4XFZA 1K83I 2LIYA 4IZ6A 3FQQA 1YJWP 1TFIA 2ONTA 3S2DI 4A3EI 2K92A 1ZH1A 4R0MA 3DS0A 3CCVP 1VQ6Z 3I55P 2QEXZ 2GDWA 5BS2A 1YJ9Z 5KP8B 2AKLA 1ACPA 1VQKP 1VLAA 3CPWZ 3H4EA 1KC82 1N8RQ 1VQ4P 4GR6A 1I6HI 2K94A 2PNGA 2O53A 1VQ61 3TE5B 3P05A 1WW9A 1Q812 2AF8A 2K2QA 2K93A 3G26A 3U43A 3S14I 2JMOA 1YJ91 3G0VA 2NVXI 2KG9A 1USPA 2PMZA 5T67A 3CCEZ 4RVDA 2GDYA 1R9TI 1M901 1VQMZ 1NQ4A 2OTLP 2OZKA 2G2KA 3CCLP 2VUMI 3M1MA 3GTJI 2LIUA 1K9M1 2PM9A 2V8KA 2K5XA 1TWGI 1YIJZ 4WYMA 2PENA 3CCE1 5F2KA 5BS1A 1VQNZ 1VQM1 2L0QA 4E31A 1ZNVA 2F4MA 1KRLA 1VQ5Z 3RZOI 2E1MA 3CC21 2ROQA 3D6WA 4QTUA 2MR7A 4S1TA 3CCJZ 1M1K1 2E7ZA 1KD1Q 2LL8A
chains in the Genus database with same CATH topology
3G71Z 3PO2I 1WIIA 1VQN1 1Q822 1I3QI 2BJOA 4U0EA 4QTTA 2JA7I 1VQ51 3GTOI 1I50I 4DGLA 3CCSZ 2R92I 3CC41 4NBGA 3VRLC 2L6EA 4RVFA 3CCJ1 2K3RA 1VQPZ 1VQOZ 1EIAA 2DE6A 1QVGY 1QF8A 1YHQP 2OOYB 1ZB8A 3GTQI 3CCS1 4X6AI 2HU9A 2VF1A 5A2Qb 1VQP1 1VQO1 2NVTI 3GTPI 2YU9I 1W2BO 1KC81 3S2HI 1X3ZA 3CCUP 2GU2A 2JUBA 1Q811 3J81b 1TWAI 3MONA 1VQ7Z 2I3CA 2LFUA 5T64A 4E2YA 1PFTA 4E32A 3CCRP 2JA5I 4RVHA 3VMGA 3HOYI 3MZKB 4U0CA 1YUAA 1VQ9P 1VQ71 5A2Qf 1QVGZ 2PEKA 3CCQP 3ESWA 1YJNP 2PEMA 2R93I 1TWHI 3HZQA 1BAJA 1K732 3CCMP 3J81f 2BHVA 1NJIQ 2PEJA 3JAMb 3G6EZ 4A3II 4E33A 4E2ZA 2JYLA 1S72P 1Q821 1N2FA 3IFUA 4A3KI 4NBDA 4COPA 2P3YA 3G6E1 2KODA 1M74A 3CD6P 4BBSI 1K30A 3G1IA 3G1GA 3DPHA 4GR2A 3JAMf 5HGMA 4BY1I 3CMAZ 4NBHA 1AUMA 1YIJ1 4M0IA 3GKQA 3H0GI 2NVYI 5D1OA 3G4SP 1USPB 1KQSZ 4NBCA 3DS3A 1TWCI 4XROA 3I07A 2QA4Z 3BG1B 3CMA1 2V8JA 2M8NA 1QVFO 1YI2Z 2EIAA 4BXXI 2KI7B 2M48A 3F3FC 2DE5A 3KIFA 1M90Q 1VQ41 3G21A 2QEXP 1JJ2O 2QA41 3DS4A 3DS1A 3OW2O 3G29A 5JPAA 1K9MQ 3CC2Z 1YJ9P 1YI21 4CL1A 3QWUA 1Q862 2P28A 4MXUA 4QNBA 1K731 1YITZ 2RBLA 3NFZA 5C4XI 2OTL1 4Y52I 1A43A 2RT9A 4U0FA 3CC4Z 3RZDI 3CCEP 2HF1A 2DE7A 1M1KQ 3DS2A 1SFOI 1VQMP 4A3BI 2R6MA 1YIT1 5T6BA 1VQLZ 3D9XA 1A8OA 1E6JP 3CXCO 3I56Z 3GCFA 1K8A2 1YIJP 1L1OC 3FQMA 4E30A 1VQNP 3PO3S 4MONA 4EWCA 3NH4A 4MD8A 4XFXA 1VQL1 1VQ5P 3H3VJ 2OARA 1Z03A 5C3EI 4PH0A 3I561 1Q7Y2 3S16I 3PO3I 3GTMS 3CCJP 3Q87A 3G71P 4HH4A 3S1QI 4NB8A 1WCMI 4E2WA 1P9NA 2YADA 3S1RI 1KC8Q 3GTMI 3VTNA 5LL6f 4NBAA 4AYBA 2M8PA 3CCSP 4MRIA 1X3WA 2EFJA 2OTJZ 3M4OI 1Q81Q 3CPWO 1VQPP 1VQOP 1QYPA 5C4JI 3NDJA 1QRJA 1M6NA 2M6NA 1X0TA 3IX0A 2CWOA 3T4NB 4XX2A 2Q51A 3M3YI 2GTIA 3P5JB 3S17I 2OTJ1 1VQ9Z 2F4OA 1Q861 3EERA 2PEOA 2Z44A 2V8IA 2NVQI 1ZB9A 1YJNZ 2QREB 1RO2A 3B5IA 4RV9A 4DK1A 1N8R2 1RO4A 1VQ7P 4HGYA 1KQSY 1VQ91 2Y0SA 1YJN1 5IT9b 1Q82Q 3WBHA 3CMEZ 1RO0A 3NDIA 5DCKA 2PEQA 4A3DI 3CCM1 1K8A1 1VQ8Z 3I4MI 3G28A 3CC7Z 3FKII 4MD9A 3CQZI 1W2BY 3VMHA 4PH1A 3CME1 2GTHA 4TNUA 1YJWZ 4HGZA 4BBRI 3G6EP 1Q7Y1 3NH5A 1Y1VS 1VQ81 3CCVZ 2RPRA 3CC71 2JS4A 4MD7A 3I55Z 5IT9f 4RS4A 4DQYB 1ML8A 1KD12 2PEIA 2QRCB 1DL6A 2BUOA 1Y1VI 2JA8I 1YJW1 1VQKZ 2O4HA 3KIHA 1RNIA 1VQ4Z 3GTGI 3CCV1 3MZLB 3I551 2QLVB 1LQLA 2JR6A 2EG5A 1Z02A 3G4S1 4E2XA 4U0BA 4XRQA 1VQK1 2KPIA 4A3LI 3CMAP 3LRYA 2LF4A 2JNYA 1VQ6P 2OTLZ 1W2BZ 3CCLZ 3HOWI 5D1PA 3MGEA 4A3FI 2ZAEB 4A93I 1QVGO 2IZ3A 1K73Q 1N8R1 1RLYA 2QA4P 3F3PC 2XV6A 2QEX1 3BG0B 1YI2P 2OOXB 4Y7NI 3CCL1 3IF8A 4XFYA 1NUIA 2Z46A 5HGNA 4IPYA 4NH1C 2H85A 4MH4A 2RHBA 3CC2P 2E2HI 2Q4ZA 2Z45A 2QKDA 3I4NI 1YITP 1TWFI 4BY7I 5IP7I 1D1DA 1NJI2 2XXMA 1YHQZ 1IUQA 1QVFY 3CC4P 4A3GI 5F2OA 2WAQA 4RVGA 3GTLI 2RIQA 1KD11 3EEDA 3HKZA 1VQLP 2P9XA 5F2NA 3U50C 2W03A 3I56P 1JJ2Y 3J7A4 3NTEA 3S1MI 1KQSO 1RQFA 3OW2Y 1YHQ1 5AN9F 4NB9A 4COCA 3CCUZ 3S15I 4NOZA 3TDHB 2DGYA 2XT1A 3G711 4U0AA 1EOQA 1NP6A 3J80b 3CCRZ 3HOVI 3HOUI 2W04A 5IP9I 3H0DA 5HGLA 2QRDB 2E9HA 2J6AA 3CCU1 3HOZI 1Q86Q 2QR1B 3GTKI 3H47A 3HOXI 4A3JI 3CCQZ 2K5RA 2R7ZI 3CCR1 2E2JI 1QVFZ 3DS5A 3CXCY 2OTJP 2VUGA 3CCMZ 3RG6C 1M6EX 3Q20A 2B63I 3DTJA 2JYGA 5FLMI 3J80f 1JJ2Z 4NBEA 3CCQ1 2PY8A 1S72Z 3HYBA 5I4TG 2WB1A 4NBBA 3OW2Z 1Y1WI 2EGTA 1M902 2E2II 1JWHC 1K8AQ 5FLXb 3LUSA 1K9M2 3VMIA 3CD6Z 3E2DA 1S7MA 5D1OB 4U0DA 1S721 2M8LA 4A3CI 1YUKA 1NJI1 1Q7YQ 4A3MI 3CPWY 2PK7A 3S1NI 4NBFA 2JO0A 1ZMBA 3NH8A 5C44I 5CM2M 3CMEP 3CXCZ 3CD61 1Z01A 1M1K2 4NFRA 3G4SZ 5HGOA 2IZ4A 5FLXf 3K7AI 2JA6I 1VQ8P 3CC7P 3VB9A 4XFZA 1K83I 2LIYA 3FQQA 1YJWP 1TFIA 2ONTA 3S2DI 4A3EI 1ZH1A 3DS0A 3CCVP 1VQ6Z 3I55P 2QEXZ 5BS2A 1YJ9Z 2AKLA 1VQKP 1VLAA 3CPWZ 3H4EA 1KC82 1N8RQ 1VQ4P 4GR6A 1I6HI 2O53A 1VQ61 3TE5B 3P05A 1WW9A 1Q812 3S14I 3G26A 2JMOA 1YJ91 3G0VA 2NVXI 1USPA 2PMZA 5T67A 3CCEZ 4RVDA 1R9TI 1M901 1VQMZ 2OTLP 2OZKA 2G2KA 3CCLP 2VUMI 3M1MA 3GTJI 1K9M1 2PM9A 2V8KA 1TWGI 1YIJZ 4WYMA 2PENA 3CCE1 5F2KA 5BS1A 1VQNZ 1VQM1 4E31A 2F4MA 1KRLA 1VQ5Z 3RZOI 2E1MA 3CC21 3D6WA 4QTUA 4S1TA 3CCJZ 1M1K1 1KD1Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RO2 A;  1RO0 A;  3M1M A;  1RNI A; 
#chains in the Genus database with same CATH topology
 2VPY A;  2NO8 A;  2N50 A;  1WII A;  3G71 Z;  3PO2 I;  1VQN 1;  1Q82 2;  1I3Q I;  4BPG A;  2BJO A;  4U0E A;  4QTT A;  2JA7 I;  1VQ5 1;  3GTO I;  2FQ0 A;  1I50 I;  4DGL A;  3CCS Z;  2JIO A;  2R92 I;  3CC4 1;  4NBG A;  2KG6 A;  3VRL C;  2GZI A;  2L6E A;  4RVF A;  3CCJ 1;  2K3R A;  1VQP Z;  1VQO Z;  1MZ8 A;  4H2X C;  1EIA A;  2DE6 A;  2K0Y A;  2JQ4 A;  1QVG Y;  4HKG A;  1QF8 A;  1YHQ P;  2OOY B;  2GZE A;  1ZB8 A;  3GTQ I;  3CCS 1;  2CGQ A;  2LEX A;  4X6A I;  2HU9 A;  2VF1 A;  5A2Q b;  1L0I A;  1VQP 1;  1VQO 1;  2NVT I;  2LIW A;  2YU9 I;  1W2B O;  3GTP I;  3GJN A;  1KC8 1;  4PWV B;  3S2H I;  1X3Z A;  3CCU P;  2GU2 A;  2JUB A;  1Q81 1;  3J81 b;  1OR5 A;  1TWA I;  3MON A;  1VQ7 Z;  2I3C A;  2LFU A;  5T64 A;  2VPW A;  2L9F A;  4E2Y A;  2L4B A;  2LTE A;  1PFT A;  3CCR P;  4E32 A;  4RVH A;  3VMG A;  4CA3 A;  2JA5 I;  3HOY I;  3MZK B;  4U0C A;  4DG9 A;  1YUA A;  1VQ9 P;  2AVA A;  1VQ7 1;  3CE7 A;  5A2Q f;  1QVG Z;  2PEK A;  3CCQ P;  3ESW A;  1YJN P;  2FVE A;  2PEM A;  2R93 I;  1TWH I;  3HZQ A;  1BAJ A;  2KOS A;  2V45 A;  1K73 2;  3CCM P;  3J81 f;  2BHV A;  2GYK A;  1NJI Q;  2PEJ A;  3JAM b;  3G6E Z;  4A3I I;  4E33 A;  1EMV A;  4E2Z A;  2VLP A;  2JYL A;  1S72 P;  1Q82 1;  1N2F A;  3IFU A;  2K0D X;  4A3K I;  4NBD A;  1UJZ A;  4COP A;  2P3Y A;  3G6E 1;  2KOD A;  1M74 A;  1WJ2 A;  2KGD A;  3CD6 P;  1F80 D;  5EJD A;  4BBS I;  1K30 A;  3G1I A;  3G1G A;  3DPH A;  2L22 A;  4GR2 A;  3JAM f;  2VLO A;  5HGM A;  4BY1 I;  3CMA Z;  4NBH A;  1AUM A;  1YIJ 1;  4M0I A;  3GKQ A;  3H0G I;  2NVY I;  5D1O A;  3G4S P;  1USP B;  1KQS Z;  4NBC A;  3DS3 A;  1TWC I;  4QKO A;  4XRO A;  3I07 A;  2QA4 Z;  3BG1 B;  3CMA 1;  2V8J A;  2M8N A;  1Z6M A;  1QVF O;  1YI2 Z;  2EIA A;  4PXH B;  4BXX I;  2FAE A;  2KI7 B;  2M48 A;  3F3F C;  2KOO A;  2VPX A;  2DE5 A;  2CNR A;  3KIF A;  1M90 Q;  1VQ4 1;  3G21 A;  2QEX P;  1JJ2 O;  2QA4 1;  3RG2 A;  3DS4 A;  3DS1 A;  3OW2 O;  3G29 A;  5JPA A;  1K9M Q;  3CC2 Z;  1YJ9 P;  1YI2 1;  4CL1 A;  3QWU A;  4BPH A;  2P28 A;  1Q86 2;  2VPZ A;  4MXU A;  2DNW A;  1HQB A;  4QNB A;  1K73 1;  1YIT Z;  5KP6 B;  2RBL A;  1HY8 A;  2FHS C;  3NFZ A;  5C4X I;  2OTL 1;  1T8K A;  2N6Z A;  4Y52 I;  2X2B A;  1A43 A;  2AFE A;  1FDI A;  2JU1 A;  2RT9 A;  4U0F A;  3CC4 Z;  3RZD I;  3CCE P;  2AFD A;  2HF1 A;  2DE7 A;  1M1K Q;  3DS2 A;  1SFO I;  1VQM P;  1IMQ A;  4A3B I;  2R6M A;  1YIT 1;  2KOQ A;  5T6B A;  1VQL Z;  3D9X A;  1A8O A;  1E6J P;  3CXC O;  3I56 Z;  3GCF A;  1AF8 A;  1K8A 2;  2LPK A;  1YIJ P;  1L1O C;  2MY5 A;  3FQM A;  4E30 A;  1VQN P;  3PO3 S;  4MON A;  4EWC A;  3NH4 A;  4MD8 A;  4XFX A;  1QXF A;  1GXG A;  3GZM A;  1VQL 1;  3NY7 B;  1VQ5 P;  3H3V J;  2OAR A;  1Z03 A;  5C3E I;  4PH0 A;  3I56 1;  1Q7Y 2;  3S16 I;  3PO3 I;  3GTM S;  3CCJ P;  2EHT A;  3Q87 A;  1Y8C A;  3G71 P;  2KW2 A;  4HH4 A;  3S1Q I;  4NB8 A;  3LMO A;  2FQ2 A;  1WCM I;  4E2W A;  1P9N A;  2YAD A;  3S1R I;  2FQ1 A;  1KC8 Q;  3GTM I;  3VTN A;  2N98 A;  2KGA A;  4NBA A;  5LL6 f;  4AYB A;  2KOR A;  2M8P A;  2FAC A;  3CCS P;  4MRI A;  1X3W A;  2EFJ A;  2OTJ Z;  2KR5 A;  4F37 A;  3M4O I;  1Q81 Q;  3CPW O;  1GPJ A;  1VQP P;  1VQO P;  1UNK A;  3B4Q A;  4H2Y C;  1QYP A;  5C4J I;  3NDJ A;  1QRJ A;  1M6N A;  2M6N A;  1X3O A;  1X0T A;  2CWO A;  3IX0 A;  2JIQ A;  3T4N B;  4XX2 A;  2Q51 A;  3M3Y I;  2GTI A;  3P5J B;  3S17 I;  2OTJ 1;  1FR2 A;  1VQ9 Z;  2F4O A;  1Q86 1;  3EER A;  2PEO A;  2Z44 A;  2V8I A;  3EJD A;  1DV5 A;  2NVQ I;  1ZB9 A;  2VLQ A;  1YJN Z;  2QRE B;  1RO2 A;  3B5I A;  4RV9 A;  2MR8 A;  4DK1 A;  2WPT A;  1N8R 2;  1RO4 A;  1VQ7 P;  4HGY A;  1KQS Y;  1AA6 A;  1VQ9 1;  2Y0S A;  2KG8 A;  1YJN 1;  5IT9 b;  1Q82 Q;  3WBH A;  3CME Z;  1RO0 A;  3NDI A;  5DCK A;  1E0H A;  1WZN A;  2PEQ A;  4A3D I;  3CCM 1;  2EHS A;  2KGE A;  1K8A 1;  1VQ8 Z;  3I4M I;  3G28 A;  3CC7 Z;  3FKI I;  1Q16 A;  4MD9 A;  3CQZ I;  1W2B Y;  3VMH A;  2N6Y A;  4PH1 A;  3CME 1;  2FVF A;  2GTH A;  4TNU A;  1YJW Z;  4HGZ A;  4BBR I;  3G6E P;  1Q7Y 1;  3NH5 A;  1GXH A;  1Y1V S;  1VQ8 1;  3CCV Z;  2CQ8 A;  2RPR A;  3CC7 1;  2JS4 A;  4MD7 A;  3I55 Z;  5IT9 f;  4RS4 A;  4DQY B;  1ML8 A;  1KD1 2;  2PEI A;  2QRC B;  2K0X A;  2IV2 X;  2JB0 A;  1DL6 A;  2BUO A;  1Y1V I;  2JA8 I;  1YJW 1;  1VQK Z;  2N5I A;  2O4H A;  2MD9 A;  3KIH A;  1RNI A;  4H2W C;  1VQ4 Z;  3GTG I;  1SIW A;  2N5H A;  3CCV 1;  2NAP A;  3MZL B;  3I55 1;  2XZ0 D;  2QLV B;  1LQL A;  2JR6 A;  2CG5 B;  2EG5 A;  1Z02 A;  3G4S 1;  4E2X A;  5EW5 E;  4U0B A;  4XRQ A;  2JU2 A;  1VQK 1;  2KPI A;  4A3L I;  3CMA P;  3LRY A;  2LF4 A;  2JNY A;  1VQ6 P;  2OTL Z;  2MF4 A;  1W2B Z;  3CCL Z;  3HOW I;  2JAZ A;  5D1P A;  3MGE A;  5KP7 B;  4A3F I;  2ZAE B;  4A93 I;  5CZD B;  5HV8 A;  2JIP A;  2FAD A;  3EJB A;  1QVG O;  2IZ3 A;  1K73 Q;  1N8R 1;  1RLY A;  2QA4 P;  3F3P C;  2XV6 A;  2QEX 1;  3BG0 B;  1YI2 P;  2OOX B;  4Y7N I;  3CCL 1;  3IF8 A;  4XFY A;  1NUI A;  2Z46 A;  5HGN A;  2GDX A;  4IPY A;  4NH1 C;  3GZL A;  2H85 A;  4MH4 A;  1IMP A;  2GZJ A;  3GKL C;  1FDO A;  2RHB A;  3CC2 P;  2E2H I;  2LML A;  2Q4Z A;  2Z45 A;  2QKD A;  3I4N I;  1YIT P;  1TWF I;  4BY7 I;  2JGP A;  4NEO A;  1KLP A;  1BXI A;  2QNW A;  5IP7 I;  2GZG A;  1D1D A;  1NJI 2;  2XXM A;  1YHQ Z;  1IUQ A;  1QVF Y;  2KGC A;  2KOP A;  3CC4 P;  4A3G I;  5F2O A;  2WAQ A;  4RVG A;  3GTL I;  2RIQ A;  1KD1 1;  3EED A;  3HKZ A;  2V3V A;  1VQL P;  2P9X A;  5F2N A;  3U50 C;  7CEI A;  2W03 A;  3I56 P;  1JJ2 Y;  3J7A 4;  3EJE A;  3NTE A;  1CEI A;  2JIR A;  1KQS O;  1RQF A;  3OW2 Y;  1YHQ 1;  5AN9 F;  4NB9 A;  3S1M I;  4COC A;  2FVA A;  3CCU Z;  3S15 I;  4NOZ A;  3TDH B;  2DGY A;  2XT1 A;  3G71 1;  1L0H A;  2M5R A;  4U0A A;  2GZF A;  1EOQ A;  2LOL A;  1NP6 A;  3J80 b;  3CCR Z;  3HOV I;  1DNY A;  3HOU I;  2W04 A;  5IP9 I;  2MVV A;  3H0D A;  5HGL A;  2QRD B;  2E9H A;  2J6A A;  3CCU 1;  3HOZ I;  1Q86 Q;  4BPF A;  2QR1 B;  3GTK I;  3H47 A;  3HOX I;  4A3J I;  3CCQ Z;  2K5R A;  2R7Z I;  2MVU A;  3CCR 1;  2E2J I;  1QVF Z;  1AYI A;  3DS5 A;  3CXC Y;  3D2L A;  2OTJ P;  2VUG A;  3CCM Z;  4MRT C;  3RG6 C;  1M6E X;  3Q20 A;  2B63 I;  3DTJ A;  2JYG A;  2JIM A;  5FLM I;  2VLN A;  3J80 f;  2XZ1 C;  1JJ2 Z;  4NBE A;  3CCQ 1;  2PY8 A;  1S72 Z;  3HYB A;  5I4T G;  2WB1 A;  4NBB A;  2JBG A;  3OW2 Z;  2EGT A;  1Y1W I;  2LKI A;  3IR7 A;  1M90 2;  2E2I I;  2KWL A;  2ERH A;  1JWH C;  1K8A Q;  5FLX b;  1VHN A;  3LUS A;  1K9M 2;  3VMI A;  5HVC A;  3CD6 Z;  3E2D A;  1S7M A;  5D1O B;  4U0D A;  1S72 1;  2AYD A;  2M8L A;  4A3C I;  1YUK A;  1NJI 1;  2VSQ A;  1VKU A;  1Q7Y Q;  4A3M I;  3CPW Y;  2PK7 A;  3S1N I;  4NBF A;  2JO0 A;  1ZMB A;  3NH8 A;  5C44 I;  5CM2 M;  3CME P;  3CXC Z;  3CD6 1;  1Z01 A;  1M1K 2;  4NFR A;  3G4S Z;  5HGO A;  4UHP B;  2IZ4 A;  5FLX f;  3K7A I;  2JA6 I;  1VQ8 P;  3CC7 P;  3VB9 A;  4XFZ A;  1K83 I;  2LIY A;  4IZ6 A;  3FQQ A;  1YJW P;  1TFI A;  2ONT A;  3S2D I;  4A3E I;  2K92 A;  1ZH1 A;  4R0M A;  3DS0 A;  3CCV P;  1VQ6 Z;  3I55 P;  2QEX Z;  2GDW A;  5BS2 A;  1YJ9 Z;  5KP8 B;  2AKL A;  1ACP A;  1VQK P;  1VLA A;  3CPW Z;  3H4E A;  1KC8 2;  1N8R Q;  1VQ4 P;  4GR6 A;  1I6H I;  2K94 A;  2PNG A;  2O53 A;  1VQ6 1;  3TE5 B;  3P05 A;  1WW9 A;  1Q81 2;  2AF8 A;  2K2Q A;  2K93 A;  3G26 A;  3U43 A;  3S14 I;  2JMO A;  1YJ9 1;  3G0V A;  2NVX I;  2KG9 A;  1USP A;  2PMZ A;  5T67 A;  3CCE Z;  4RVD A;  2GDY A;  1R9T I;  1M90 1;  1VQM Z;  1NQ4 A;  2OTL P;  2OZK A;  2G2K A;  3CCL P;  2VUM I;  3M1M A;  3GTJ I;  2LIU A;  1K9M 1;  2PM9 A;  2V8K A;  2K5X A;  1TWG I;  1YIJ Z;  4WYM A;  2PEN A;  3CCE 1;  5F2K A;  5BS1 A;  1VQN Z;  1VQM 1;  2L0Q A;  4E31 A;  1ZNV A;  2F4M A;  1KRL A;  1VQ5 Z;  3RZO I;  2E1M A;  3CC2 1;  2ROQ A;  3D6W A;  4QTU A;  2MR7 A;  4S1T A;  3CCJ Z;  1M1K 1;  2E7Z A;  1KD1 Q;  2LL8 A; 
#chains in the Genus database with same CATH homology
 3G71 Z;  3PO2 I;  1WII A;  1VQN 1;  1Q82 2;  1I3Q I;  2BJO A;  4U0E A;  4QTT A;  2JA7 I;  1VQ5 1;  3GTO I;  1I50 I;  4DGL A;  3CCS Z;  2R92 I;  3CC4 1;  4NBG A;  3VRL C;  2L6E A;  4RVF A;  3CCJ 1;  2K3R A;  1VQP Z;  1VQO Z;  1EIA A;  2DE6 A;  1QVG Y;  1QF8 A;  1YHQ P;  2OOY B;  1ZB8 A;  3GTQ I;  3CCS 1;  4X6A I;  2HU9 A;  2VF1 A;  5A2Q b;  1VQP 1;  1VQO 1;  2NVT I;  3GTP I;  2YU9 I;  1W2B O;  1KC8 1;  3S2H I;  1X3Z A;  3CCU P;  2GU2 A;  2JUB A;  1Q81 1;  3J81 b;  1TWA I;  3MON A;  1VQ7 Z;  2I3C A;  2LFU A;  5T64 A;  4E2Y A;  1PFT A;  4E32 A;  3CCR P;  2JA5 I;  4RVH A;  3VMG A;  3HOY I;  3MZK B;  4U0C A;  1YUA A;  1VQ9 P;  1VQ7 1;  5A2Q f;  1QVG Z;  2PEK A;  3CCQ P;  3ESW A;  1YJN P;  2PEM A;  2R93 I;  1TWH I;  3HZQ A;  1BAJ A;  1K73 2;  3CCM P;  3J81 f;  2BHV A;  1NJI Q;  2PEJ A;  3JAM b;  3G6E Z;  4A3I I;  4E33 A;  4E2Z A;  2JYL A;  1S72 P;  1Q82 1;  1N2F A;  3IFU A;  4A3K I;  4NBD A;  4COP A;  2P3Y A;  3G6E 1;  2KOD A;  1M74 A;  3CD6 P;  4BBS I;  1K30 A;  3G1I A;  3G1G A;  3DPH A;  4GR2 A;  3JAM f;  5HGM A;  4BY1 I;  3CMA Z;  4NBH A;  1AUM A;  1YIJ 1;  4M0I A;  3GKQ A;  3H0G I;  2NVY I;  5D1O A;  3G4S P;  1USP B;  1KQS Z;  4NBC A;  3DS3 A;  1TWC I;  4XRO A;  3I07 A;  2QA4 Z;  3BG1 B;  3CMA 1;  2V8J A;  2M8N A;  1QVF O;  1YI2 Z;  2EIA A;  4BXX I;  2KI7 B;  2M48 A;  3F3F C;  2DE5 A;  3KIF A;  1M90 Q;  1VQ4 1;  3G21 A;  2QEX P;  1JJ2 O;  2QA4 1;  3DS4 A;  3DS1 A;  3OW2 O;  3G29 A;  5JPA A;  1K9M Q;  3CC2 Z;  1YJ9 P;  1YI2 1;  4CL1 A;  3QWU A;  1Q86 2;  2P28 A;  4MXU A;  4QNB A;  1K73 1;  1YIT Z;  2RBL A;  3NFZ A;  5C4X I;  2OTL 1;  4Y52 I;  1A43 A;  2RT9 A;  4U0F A;  3CC4 Z;  3RZD I;  3CCE P;  2HF1 A;  2DE7 A;  1M1K Q;  3DS2 A;  1SFO I;  1VQM P;  4A3B I;  2R6M A;  1YIT 1;  5T6B A;  1VQL Z;  3D9X A;  1A8O A;  1E6J P;  3CXC O;  3I56 Z;  3GCF A;  1K8A 2;  1YIJ P;  1L1O C;  3FQM A;  4E30 A;  1VQN P;  3PO3 S;  4MON A;  4EWC A;  3NH4 A;  4MD8 A;  4XFX A;  1VQL 1;  1VQ5 P;  3H3V J;  2OAR A;  1Z03 A;  5C3E I;  4PH0 A;  3I56 1;  1Q7Y 2;  3S16 I;  3PO3 I;  3GTM S;  3CCJ P;  3Q87 A;  3G71 P;  4HH4 A;  3S1Q I;  4NB8 A;  1WCM I;  4E2W A;  1P9N A;  2YAD A;  3S1R I;  1KC8 Q;  3GTM I;  3VTN A;  5LL6 f;  4NBA A;  4AYB A;  2M8P A;  3CCS P;  4MRI A;  1X3W A;  2EFJ A;  2OTJ Z;  3M4O I;  1Q81 Q;  3CPW O;  1VQP P;  1VQO P;  1QYP A;  5C4J I;  3NDJ A;  1QRJ A;  1M6N A;  2M6N A;  1X0T A;  3IX0 A;  2CWO A;  3T4N B;  4XX2 A;  2Q51 A;  3M3Y I;  2GTI A;  3P5J B;  3S17 I;  2OTJ 1;  1VQ9 Z;  2F4O A;  1Q86 1;  3EER A;  2PEO A;  2Z44 A;  2V8I A;  2NVQ I;  1ZB9 A;  1YJN Z;  2QRE B;  1RO2 A;  3B5I A;  4RV9 A;  4DK1 A;  1N8R 2;  1RO4 A;  1VQ7 P;  4HGY A;  1KQS Y;  1VQ9 1;  2Y0S A;  1YJN 1;  5IT9 b;  1Q82 Q;  3WBH A;  3CME Z;  1RO0 A;  3NDI A;  5DCK A;  2PEQ A;  4A3D I;  3CCM 1;  1K8A 1;  1VQ8 Z;  3I4M I;  3G28 A;  3CC7 Z;  3FKI I;  4MD9 A;  3CQZ I;  1W2B Y;  3VMH A;  4PH1 A;  3CME 1;  2GTH A;  4TNU A;  1YJW Z;  4HGZ A;  4BBR I;  3G6E P;  1Q7Y 1;  3NH5 A;  1Y1V S;  1VQ8 1;  3CCV Z;  2RPR A;  3CC7 1;  2JS4 A;  4MD7 A;  3I55 Z;  5IT9 f;  4RS4 A;  4DQY B;  1ML8 A;  1KD1 2;  2PEI A;  2QRC B;  1DL6 A;  2BUO A;  1Y1V I;  2JA8 I;  1YJW 1;  1VQK Z;  2O4H A;  3KIH A;  1RNI A;  1VQ4 Z;  3GTG I;  3CCV 1;  3MZL B;  3I55 1;  2QLV B;  1LQL A;  2JR6 A;  2EG5 A;  1Z02 A;  3G4S 1;  4E2X A;  4U0B A;  4XRQ A;  1VQK 1;  2KPI A;  4A3L I;  3CMA P;  3LRY A;  2LF4 A;  2JNY A;  1VQ6 P;  2OTL Z;  1W2B Z;  3CCL Z;  3HOW I;  5D1P A;  3MGE A;  4A3F I;  2ZAE B;  4A93 I;  1QVG O;  2IZ3 A;  1K73 Q;  1N8R 1;  1RLY A;  2QA4 P;  3F3P C;  2XV6 A;  2QEX 1;  3BG0 B;  1YI2 P;  2OOX B;  4Y7N I;  3CCL 1;  3IF8 A;  4XFY A;  1NUI A;  2Z46 A;  5HGN A;  4IPY A;  4NH1 C;  2H85 A;  4MH4 A;  2RHB A;  3CC2 P;  2E2H I;  2Q4Z A;  2Z45 A;  2QKD A;  3I4N I;  1YIT P;  1TWF I;  4BY7 I;  5IP7 I;  1D1D A;  1NJI 2;  2XXM A;  1YHQ Z;  1IUQ A;  1QVF Y;  3CC4 P;  4A3G I;  5F2O A;  2WAQ A;  4RVG A;  3GTL I;  2RIQ A;  1KD1 1;  3EED A;  3HKZ A;  1VQL P;  2P9X A;  5F2N A;  3U50 C;  2W03 A;  3I56 P;  1JJ2 Y;  3J7A 4;  3NTE A;  3S1M I;  1KQS O;  1RQF A;  3OW2 Y;  1YHQ 1;  5AN9 F;  4NB9 A;  4COC A;  3CCU Z;  3S15 I;  4NOZ A;  3TDH B;  2DGY A;  2XT1 A;  3G71 1;  4U0A A;  1EOQ A;  1NP6 A;  3J80 b;  3CCR Z;  3HOV I;  3HOU I;  2W04 A;  5IP9 I;  3H0D A;  5HGL A;  2QRD B;  2E9H A;  2J6A A;  3CCU 1;  3HOZ I;  1Q86 Q;  2QR1 B;  3GTK I;  3H47 A;  3HOX I;  4A3J I;  3CCQ Z;  2K5R A;  2R7Z I;  3CCR 1;  2E2J I;  1QVF Z;  3DS5 A;  3CXC Y;  2OTJ P;  2VUG A;  3CCM Z;  3RG6 C;  1M6E X;  3Q20 A;  2B63 I;  3DTJ A;  2JYG A;  5FLM I;  3J80 f;  1JJ2 Z;  4NBE A;  3CCQ 1;  2PY8 A;  1S72 Z;  3HYB A;  5I4T G;  2WB1 A;  4NBB A;  3OW2 Z;  1Y1W I;  2EGT A;  1M90 2;  2E2I I;  1JWH C;  1K8A Q;  5FLX b;  3LUS A;  1K9M 2;  3VMI A;  3CD6 Z;  3E2D A;  1S7M A;  5D1O B;  4U0D A;  1S72 1;  2M8L A;  4A3C I;  1YUK A;  1NJI 1;  1Q7Y Q;  4A3M I;  3CPW Y;  2PK7 A;  3S1N I;  4NBF A;  2JO0 A;  1ZMB A;  3NH8 A;  5C44 I;  5CM2 M;  3CME P;  3CXC Z;  3CD6 1;  1Z01 A;  1M1K 2;  4NFR A;  3G4S Z;  5HGO A;  2IZ4 A;  5FLX f;  3K7A I;  2JA6 I;  1VQ8 P;  3CC7 P;  3VB9 A;  4XFZ A;  1K83 I;  2LIY A;  3FQQ A;  1YJW P;  1TFI A;  2ONT A;  3S2D I;  4A3E I;  1ZH1 A;  3DS0 A;  3CCV P;  1VQ6 Z;  3I55 P;  2QEX Z;  5BS2 A;  1YJ9 Z;  2AKL A;  1VQK P;  1VLA A;  3CPW Z;  3H4E A;  1KC8 2;  1N8R Q;  1VQ4 P;  4GR6 A;  1I6H I;  2O53 A;  1VQ6 1;  3TE5 B;  3P05 A;  1WW9 A;  1Q81 2;  3S14 I;  3G26 A;  2JMO A;  1YJ9 1;  3G0V A;  2NVX I;  1USP A;  2PMZ A;  5T67 A;  3CCE Z;  4RVD A;  1R9T I;  1M90 1;  1VQM Z;  2OTL P;  2OZK A;  2G2K A;  3CCL P;  2VUM I;  3M1M A;  3GTJ I;  1K9M 1;  2PM9 A;  2V8K A;  1TWG I;  1YIJ Z;  4WYM A;  2PEN A;  3CCE 1;  5F2K A;  5BS1 A;  1VQN Z;  1VQM 1;  4E31 A;  2F4M A;  1KRL A;  1VQ5 Z;  3RZO I;  2E1M A;  3CC2 1;  3D6W A;  4QTU A;  4S1T A;  3CCJ Z;  1M1K 1;  1KD1 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...