1RO2A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m manganese soak
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
molecule keywords hypothetical protein ORF904
total genus 59
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro2A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro2A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro2A02
3M1MA 1RO0A 1RNIA 1RO2A
chains in the Genus database with same CATH superfamily
2ERHA 2FADA 4XRQA 3CCJP 2AFEA 3BG1B 1VQ8Z 2ROQA 2V8IA 3G21A 4CA3A 3EJDA 1YJWP 4MD9A 1Z03A 1KD11 2Q51A 3I551 1VQ91 2NVTI 1Y1VI 3G6E1 4XFYA 2V3VA 1VQ5Z 2KI7B 3CCVP 4DG9A 1YJNP 3RZOI 1BAJA 4A3LI 2KG9A 2RIQA 3CCQP 3JAMb 1ZB9A 2K94A 1QYPA 3I56Z 1K8AQ 1SIWA 2OTLP 4PXHB 3QWUA 1RQFA 4MXUA 2XT1A 3Q20A 4Y7NI 3TDHB 1VQK1 3CMA1 2GTIA 2Y0SA 2NAPA 4U0EA 1VQ6Z 4RVHA 2PENA 2VPYA 3H47A 5FLXf 2KGEA 2GZFA 3G29A 3VB9A 3CCJ1 1VLAA 4IZ6A 1FR2A 1M1K1 1VQNZ 3CCL1 3CXCZ 2QRCB 3NFZA 5HGNA 3MZKB 1E0HA 2OOXB 2MVVA 4RVDA 4A3II 1YIT1 5IT9b 2FHSC 3EJBA 1Y1WI 4U0AA 4A3FI 4DQYB 3PO2I 1I3QI 3E2DA 4IPYA 5HV8A 1JJ2O 4XX2A 2JYGA 4MRTC 1EMVA 1FDIA 2JUBA 1K8A2 1W2BY 3GTGI 3S1QI 2PMZA 1YHQ1 5DCKA 1VQP1 3GTQI 2O4HA 3G4SP 2QEXP 3CC7Z 3CD6P 4E32A 2EHTA 3GZMA 3J7A4 1Q7Y1 3B4QA 2N50A 3S16I 2DNWA 5EJDA 4X6AI 2CNRA 3CCLP 2ZAEB 3CD6Z 4UHPB 3D2LA 1IMPA 2RHBA 3CC7P 3H4EA 2L22A 1KD12 3CMEP 2J6AA 1M74A 2W04A 1KLPA 3IF8A 4H2WC 1Q81Q 3H0GI 2PEQA 1QVFO 1WCMI 3HOYI 2CQ8A 1QVFZ 2M8NA 3FKII 4U0CA 2PM9A 3BG0B 5IT9f 2F4MA 3VMIA 3F3FC 3VTNA 1YITZ 4NBAA 3M4OI 3S1MI 3CCSZ 2JGPA 1YJN1 4BPFA 1USPB 4H2YC 1KD1Q 4PWVB 2I3CA 4DGLA 2RBLA 1N8RQ 1TWCI 2O53A 3RG2A 4NBHA 2OTL1 3ESWA 1YJWZ 3OW2O 2GYKA 1TWGI 2QREB 3OW2Y 1UJZA 2GZIA 2JIOA 4QTTA 2AYDA 1K731 3HZQA 3CC2P 3CC2Z 3DTJA 1Z01A 3GKLC 1YI2P 2LPKA 1T8KA 2FQ0A 4XFZA 2JU1A 1K30A 3DS5A 3CC71 1QVFY 2VUMI 1WW9A 2JMOA 2KG6A 2VUGA 5CM2M 1BXIA 3IX0A 1M902 2LEXA 2N5IA 4NBFA 1VQ41 2N98A 4QKOA 2R6MA 1YITP 3CCQZ 5HGMA 3OW2Z 2L9FA 3D9XA 2LL8A 3CCEZ 4A93I 1M901 1VQ5P 2LIWA 2WB1A 4RS4A 1QXFA 3U43A 2OARA 2K93A 2PNGA 2PEJA 1YUKA 2QR1B 2JA6I 3S1RI 4M0IA 1S7MA 4BY1I 3CCUZ 1KQSY 1VQL1 4MONA 3G4S1 2JIPA 2QEX1 1K732 1TWHI 1MZ8A 3M3YI 2GDWA 3CC21 1X3OA 1WZNA 1YI21 2FQ2A 2LIYA 5C4XI 2HU9A 3GTLI 3HOZI 3CCR1 3IFUA 3TE5B 1Q862 4NH1C 4U0FA 2GTHA 2E1MA 2K0XA 1Q822 2L6EA 2P28A 1YUAA 4A3BI 2KG8A 3CME1 4E2WA 4GR2A 2XZ0D 2FQ1A 1QF8A 2JR6A 2JS4A 1S72Z 1L0HA 2MY5A 2JA8I 1DL6A 2E7ZA 2WAQA 1Y8CA 4COPA 4BXXI 2PK7A 2K0DX 1A8OA 1A43A 2VPXA 3DPHA 5F2KA 4CL1A 1M6NA 4PH0A 2JIRA 2KR5A 4QTUA 1VQLZ 2IZ4A 3PO3S 1VQ81 2H85A 4NB8A 2AFDA 2R93I 3HOWI 3G1GA 2LF4A 4NBBA 3DS2A 1X3WA 2AVAA 1KC82 2CGQA 3CCRP 3G1IA 1R9TI 1EIAA 2Z45A 3PO3I 1VQ7P 1NUIA 2OTLZ 2JIMA 3NH5A 4A3MI 2M8LA 1AYIA 2Z44A 4F37A 4R0MA 3CCSP 3FQQA 4E31A 5KP6B 3MONA 1VQ4P 2V8JA 2QNWA 4U0BA 3CCVZ 3VRLC 5T64A 3KIHA 5A2Qf 3S14I 3HOXI 3G6EZ 1NJIQ 3G26A 2KW2A 4WYMA 1RNIA 2KGDA 2E9HA 2GZGA 3NDIA 1AA6A 1VQ51 4S1TA 1JWHC 3K7AI 3CMEZ 3CCJZ 1IMQA 1ZH1A 2PEMA 2K92A 1AF8A 1YJ9P 1VQ8P 1QRJA 2LMLA 3CCLZ 3DS4A 3S2HI 3I561 1VQLP 2FACA 2CWOA 4NFRA 4HKGA 2GZEA 2LOLA 3CCEP 2VPZA 2N6YA 3CPWO 3RG6C 2Q4ZA 2AKLA 2N5HA 3LRYA 1I50I 4COCA 3GKQA 3J81f 2W03A 3CCM1 1Q861 1TWAI 3J80b 1RO2A 3WBHA 3CC4P 1L1OC 2BUOA 1M90Q 1VHNA 3P5JB 2MF4A 4E30A 1VQPZ 1VQMZ 1UNKA 1M1KQ 1USPA 4MD8A 2JA5I 5HGLA 2PEKA 4MD7A 2K5RA 5C44I 2PEOA 2GDXA 4E2ZA 3G28A 2MR7A 3Q87A 2QA41 1YJ91 3CXCO 1RO4A 1K9M1 2Z46A 2DE7A 1RLYA 2P9XA 5F2NA 3HKZA 5HVCA 2KORA 3F3PC 2EG5A 3CCE1 5BS1A 4NOZA 2XZ1C 3CCMZ 1Q7YQ 2NVXI 2BHVA 1PFTA 3GTPI 3I07A 2K3RA 1VQ71 1TWFI 3CQZI 1Q7Y2 2DE5A 3JAMf 3CCS1 3GTMI 2QRDB 4NBEA 1I6HI 5AN9F 2KOSA 2VLQA 3B5IA 3EEDA 5I4TG 1Q811 4PH1A 1VQNP 2YADA 2E2II 5HGOA 1IUQA 1NQ4A 2VLOA 1WIIA 3VMHA 2QA4Z 2QA4P 1ZMBA 3S2DI 1YI2Z 2WPTA 1KC81 2KOOA 1VQM1 2KGCA 2CG5B 2AF8A 2DGYA 3HYBA 4H2XC 2P3YA 1SFOI 3RZDI 2L0QA 2JB0A 2V8KA 3CE7A 1YIJZ 3I56P 4E2YA 2KOPA 2JO0A 4BPGA 1VQ4Z 4HGZA 3J80f 2V45A 2K5XA 4NBCA 2YU9I 1S721 2G2KA 2M8PA 2VPWA 2MVUA 1VKUA 1P9NA 3CCMP 2DE6A 2LIUA 2VLNA 2VLPA 3G711 1K8A1 1KQSO 1DNYA 1YIJP 3KIFA 2OTJZ 3CC41 4A3EI 3EERA 1X3ZA 2IZ3A 2KGAA 2EGTA 1N2FA 1VQ61 1N8R1 5BS2A 2JA7I 3GCFA 3S17I 4A3CI 1Q821 3NY7B 2PY8A 3S15I 1K9M2 2L4BA 4E2XA 5D1OA 1VQO1 1QVGY 3CCUP 1NJI2 5D1PA 1W2BZ 3DS1A 5T67A 3T4NB 4GR6A 5IP7I 2KWLA 1KQSZ 3S1NI 1ML8A 1WJ2A 2GU2A 2R7ZI 1Z02A 2OOYB 2VF1A 2FVFA 2JNYA 3DS0A 4A3JI 2QKDA 2QEXZ 3I4NI 1S72P 2KODA 2E2HI 2B63I 3EJEA 3GTMS 1YHQZ 1QVGZ 4A3KI 1HY8A 1KRLA 3LUSA 1M6EX 1GXHA 5KP7B 1K83I 4NEOA 1W2BO 4Y52I 1YIJ1 3HOVI 2K2QA 1ZB8A 4XFXA 2FVAA 1TFIA 2JU2A 3NH8A 2X2BA 2M48A 1DV5A 1Z6MA 2NVQI 1NJI1 1VQN1 4BY7I 2LFUA 4RV9A 2JYLA 3NH4A 3G71Z 1D1DA 4NBDA 2IV2X 2LKIA 4EWCA 4U0DA 2F4OA 3CC4Z 2JQ4A 2OTJP 1NP6A 3CXCY 1VQMP 2EHSA 2KOQA 1X0TA 4HH4A 3H0DA 4QNBA 4MRIA 3DS3A 1RO0A 2OZKA 2PEIA 1VQOZ 1YJNZ 2K0YA 3GJNA 3HOUI 1AUMA 1OR5A 2ONTA 3GTKI 2GZJA 3NDJA 5CZDB 5F2OA 3CPWZ 5IP9I 1YJW1 3G0VA 3G71P 3U50C 2LTEA 2NO8A 1L0IA 2R92I 3I4MI 1FDOA 5LL6f 3CPWY 3IR7A 1VQ6P 2MD9A 4NBGA 3CCV1 1JJ2Y 3LMOA 1K73Q 1VQKZ 1EOQA 3GZLA 3FQMA 1CEIA 3MZLB 1ACPA 1VQOP 4A3GI 2OTJ1 3CCU1 5JPAA 2VSQA 3GTJI 2EFJA 2M5RA 3G4SZ 5C3EI 4BBRI 2BJOA 2JIQA 1QVGO 4NB9A 4A3DI 2MR8A 2NVYI 5D1OB 1VQ7Z 2XV6A 1LQLA 2RT9A 1HQBA 2FAEA 3I55Z 5FLMI 1VQ9Z 3D6WA 2RPRA 3J81b 1GXGA 4RVFA 1Q82Q 1F80D 3M1MA 3CCRZ 2JBGA 2XXMA 1Q86Q 4XROA 2M6NA 2N6ZA 3NTEA 4TNUA 1YJ9Z 5FLXb 4BBSI 3VMGA 1Q16A 5T6BA 5EW5E 2FVEA 3I55P 2GDYA 1VQ9P 5KP8B 3MGEA 3G6EP 3CMAZ 2E2JI 5A2Qb 1N8R2 4AYBA 2HF1A 1M1K2 1YHQP 3H3VJ 4HGYA 4MH4A 1VQPP 5C4JI 4BPHA 1ZNVA 3CCQ1 1Y1VS 1E6JP 1JJ2Z 3CD61 3P05A 1GPJA 2JAZA 1Q812 4E33A 1KC8Q 2KPIA 7CEIA 3GTOI 2EIAA 2QLVB 1VQKP 3CMAP 1K9MQ 4RVGA 4DK1A
chains in the Genus database with same CATH topology
3CCJP 4XRQA 3BG1B 1VQ8Z 2V8IA 3G21A 1YJWP 4MD9A 1Z03A 1KD11 2Q51A 3I551 1VQ91 2NVTI 1Y1VI 3G6E1 4XFYA 1VQ5Z 2KI7B 3CCVP 1YJNP 3RZOI 1BAJA 4A3LI 2RIQA 3CCQP 3JAMb 1ZB9A 1QYPA 3I56Z 1K8AQ 2OTLP 3QWUA 1RQFA 4MXUA 2XT1A 3Q20A 4Y7NI 3TDHB 1VQK1 3CMA1 2GTIA 2Y0SA 4U0EA 1VQ6Z 4RVHA 2PENA 3H47A 5FLXf 3G29A 3CCJ1 3VB9A 1VLAA 1M1K1 1VQNZ 3CCL1 3CXCZ 2QRCB 3NFZA 5HGNA 3MZKB 1YIT1 2OOXB 4RVDA 4A3II 5IT9b 1Y1WI 4U0AA 4A3FI 4DQYB 3PO2I 1I3QI 3E2DA 4IPYA 1JJ2O 4XX2A 2JYGA 2JUBA 1K8A2 1W2BY 3S1QI 2PMZA 1YHQ1 5DCKA 1VQP1 3GTQI 2O4HA 3G4SP 2QEXP 3CC7Z 3CD6P 4E32A 3J7A4 1Q7Y1 3S16I 4X6AI 3CCLP 2ZAEB 3CD6Z 2RHBA 3CC7P 3H4EA 1KD12 3CMEP 2J6AA 1M74A 2W04A 3IF8A 1Q81Q 3H0GI 2PEQA 1QVFO 1WCMI 3HOYI 1QVFZ 2M8NA 3FKII 4U0CA 2PM9A 3BG0B 5IT9f 2F4MA 3VMIA 3F3FC 3VTNA 1YITZ 4NBAA 3M4OI 3S1MI 3CCSZ 1YJN1 1USPB 2I3CA 1KD1Q 4DGLA 2RBLA 1N8RQ 1TWCI 2O53A 4NBHA 2OTL1 3ESWA 1YJWZ 3OW2O 1TWGI 2QREB 3OW2Y 4QTTA 1K731 3HZQA 3CC2P 3CC2Z 3DTJA 1Z01A 1YI2P 4XFZA 1K30A 3DS5A 3CC71 1QVFY 2VUMI 1WW9A 2JMOA 5CM2M 2VUGA 3IX0A 1M902 4NBFA 1VQ41 2R6MA 3CCQZ 1YITP 3OW2Z 5HGMA 3D9XA 4A93I 1M901 1VQ5P 2WB1A 4RS4A 2OARA 2JA6I 2PEJA 1YUKA 2QR1B 3S1RI 4M0IA 1S7MA 4BY1I 3CCUZ 1KQSY 1VQL1 4MONA 3G4S1 2QEX1 1K732 1TWHI 3M3YI 3CC21 1YI21 2LIYA 5C4XI 2HU9A 3GTLI 3HOZI 3CCR1 3IFUA 3TE5B 1Q862 4NH1C 4U0FA 2GTHA 2E1MA 1Q822 2L6EA 2P28A 1YUAA 4A3BI 3CME1 4E2WA 4GR2A 1QF8A 2JR6A 2JS4A 1S72Z 2JA8I 1DL6A 2WAQA 4COPA 4BXXI 2PK7A 1A8OA 1A43A 3DPHA 5F2KA 4CL1A 1M6NA 4PH0A 4QTUA 1VQLZ 2IZ4A 3PO3S 1VQ81 2H85A 4NB8A 2R93I 3HOWI 3G1GA 2LF4A 4NBBA 3DS2A 1X3WA 1KC82 3CCRP 3G1IA 1R9TI 1EIAA 2Z45A 3PO3I 1VQ7P 1NUIA 2OTLZ 3NH5A 4A3MI 2M8LA 3FQQA 2Z44A 3CCSP 4E31A 3MONA 1VQ4P 2V8JA 3CCVZ 4U0BA 3VRLC 5T64A 3KIHA 5A2Qf 3S14I 3HOXI 3G6EZ 1NJIQ 3G26A 4WYMA 2E9HA 1RNIA 3NDIA 3CCEZ 1VQ51 3GTGI 4S1TA 1JWHC 3K7AI 3CMEZ 3CCJZ 1ZH1A 2PEMA 1YJ9P 1VQ8P 1QRJA 3CCLZ 3DS4A 3S2HI 3I561 1VQLP 2CWOA 4NFRA 3CCEP 3CPWO 3RG6C 2Q4ZA 2AKLA 3LRYA 1I50I 3GKQA 4COCA 3J81f 2W03A 3CCM1 1Q861 1TWAI 3J80b 1RO2A 3WBHA 3CC4P 1L1OC 2BUOA 1M90Q 3P5JB 4E30A 1VQPZ 1VQMZ 1M1KQ 1USPA 4MD8A 2JA5I 5HGLA 2PEKA 4MD7A 2K5RA 5C44I 2PEOA 4E2ZA 3G28A 3Q87A 2QA41 1YJ91 3CXCO 1RO4A 1K9M1 2Z46A 2DE7A 1RLYA 2P9XA 5F2NA 3HKZA 3F3PC 2EG5A 3CCE1 5BS1A 4NOZA 3CCMZ 1Q7YQ 2NVXI 2BHVA 1PFTA 3GTPI 3I07A 2K3RA 1VQ71 1TWFI 3CQZI 1Q7Y2 2DE5A 3JAMf 3CCS1 3GTMI 2QRDB 4NBEA 1I6HI 5AN9F 3B5IA 3EEDA 5I4TG 1Q811 4PH1A 1VQNP 2YADA 2E2II 5HGOA 1IUQA 1WIIA 3VMHA 2QA4Z 2QA4P 1ZMBA 3S2DI 1YI2Z 1KC81 1VQM1 2DGYA 3HYBA 2P3YA 1SFOI 3RZDI 2V8KA 1YIJZ 3I56P 4E2YA 2JO0A 1VQ4Z 4HGZA 3J80f 4NBCA 2YU9I 1S721 2G2KA 2M8PA 1P9NA 2DE6A 3CCMP 3G711 1K8A1 1KQSO 1YIJP 3KIFA 2OTJZ 3CC41 4A3EI 3EERA 1X3ZA 2IZ3A 2EGTA 1N2FA 1VQ61 1N8R1 5BS2A 2JA7I 3GCFA 3S17I 4A3CI 1Q821 2PY8A 3S15I 1K9M2 4E2XA 5D1OA 1VQO1 1QVGY 3CCUP 1NJI2 5D1PA 1W2BZ 3DS1A 5T67A 3T4NB 4GR6A 5IP7I 1KQSZ 3S1NI 1ML8A 2GU2A 2R7ZI 1Z02A 2OOYB 2VF1A 2JNYA 3DS0A 4A3JI 2QKDA 2QEXZ 3I4NI 1S72P 2KODA 2E2HI 2B63I 3GTMS 1YHQZ 1QVGZ 4A3KI 3LUSA 1KRLA 1M6EX 1K83I 1W2BO 4Y52I 1YIJ1 3HOVI 1ZB8A 4XFXA 1TFIA 3NH8A 2M48A 2NVQI 1NJI1 1VQN1 4BY7I 2LFUA 4RV9A 2JYLA 3NH4A 3G71Z 1D1DA 4NBDA 4EWCA 4U0DA 2F4OA 3CC4Z 1NP6A 2OTJP 3CXCY 1VQMP 1X0TA 4HH4A 3H0DA 4QNBA 4MRIA 3DS3A 1RO0A 2OZKA 2PEIA 1VQOZ 1YJNZ 3HOUI 1AUMA 2ONTA 3GTKI 3NDJA 5F2OA 3CPWZ 5IP9I 1YJW1 3G0VA 3G71P 3U50C 2R92I 3I4MI 5LL6f 3CPWY 1VQ6P 4NBGA 3CCV1 1JJ2Y 1K73Q 1VQKZ 1EOQA 3FQMA 3MZLB 1VQOP 4A3GI 2OTJ1 3CCU1 5JPAA 3GTJI 2EFJA 3G4SZ 5C3EI 4BBRI 2BJOA 1QVGO 4NB9A 4A3DI 2NVYI 5D1OB 1VQ7Z 2XV6A 1LQLA 2RT9A 3I55Z 5FLMI 1VQ9Z 3D6WA 2RPRA 3J81b 4RVFA 1Q82Q 3CCRZ 3M1MA 2XXMA 1Q86Q 4XROA 2M6NA 3NTEA 4TNUA 1YJ9Z 5FLXb 4BBSI 3VMGA 5T6BA 3I55P 1VQ9P 3MGEA 3G6EP 3CMAZ 2E2JI 5A2Qb 1N8R2 4AYBA 2HF1A 1M1K2 1YHQP 3H3VJ 4HGYA 4MH4A 1VQPP 5C4JI 3CCQ1 1Y1VS 1E6JP 1JJ2Z 3CD61 3P05A 1Q812 4E33A 1KC8Q 2KPIA 3GTOI 2EIAA 2QLVB 1VQKP 3CMAP 1K9MQ 4RVGA 4DK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M1M A;  1RO0 A;  1RNI A;  1RO2 A; 
#chains in the Genus database with same CATH topology
 2ERH A;  2FAD A;  4XRQ A;  3CCJ P;  2AFE A;  3BG1 B;  1VQ8 Z;  2ROQ A;  2V8I A;  3G21 A;  4CA3 A;  3EJD A;  1YJW P;  4MD9 A;  1Z03 A;  1KD1 1;  2Q51 A;  3I55 1;  1VQ9 1;  2NVT I;  1Y1V I;  3G6E 1;  4XFY A;  2V3V A;  1VQ5 Z;  2KI7 B;  3CCV P;  4DG9 A;  1YJN P;  3RZO I;  1BAJ A;  4A3L I;  2KG9 A;  2RIQ A;  3CCQ P;  3JAM b;  1ZB9 A;  2K94 A;  1QYP A;  3I56 Z;  1K8A Q;  1SIW A;  2OTL P;  4PXH B;  3QWU A;  1RQF A;  4MXU A;  2XT1 A;  3Q20 A;  4Y7N I;  3TDH B;  1VQK 1;  3CMA 1;  2GTI A;  2Y0S A;  2NAP A;  4U0E A;  1VQ6 Z;  4RVH A;  2PEN A;  2VPY A;  3H47 A;  5FLX f;  2KGE A;  2GZF A;  3G29 A;  3VB9 A;  3CCJ 1;  1VLA A;  4IZ6 A;  1FR2 A;  1M1K 1;  1VQN Z;  3CCL 1;  3CXC Z;  2QRC B;  3NFZ A;  5HGN A;  3MZK B;  1E0H A;  2OOX B;  2MVV A;  4RVD A;  4A3I I;  1YIT 1;  5IT9 b;  2FHS C;  3EJB A;  1Y1W I;  4U0A A;  4A3F I;  4DQY B;  3PO2 I;  1I3Q I;  3E2D A;  4IPY A;  5HV8 A;  1JJ2 O;  4XX2 A;  2JYG A;  4MRT C;  1EMV A;  1FDI A;  2JUB A;  1K8A 2;  1W2B Y;  3GTG I;  3S1Q I;  2PMZ A;  1YHQ 1;  5DCK A;  1VQP 1;  3GTQ I;  2O4H A;  3G4S P;  2QEX P;  3CC7 Z;  3CD6 P;  4E32 A;  2EHT A;  3GZM A;  3J7A 4;  1Q7Y 1;  3B4Q A;  2N50 A;  3S16 I;  2DNW A;  5EJD A;  4X6A I;  2CNR A;  3CCL P;  2ZAE B;  3CD6 Z;  4UHP B;  3D2L A;  1IMP A;  2RHB A;  3CC7 P;  3H4E A;  2L22 A;  1KD1 2;  3CME P;  2J6A A;  1M74 A;  2W04 A;  1KLP A;  3IF8 A;  4H2W C;  1Q81 Q;  3H0G I;  2PEQ A;  1QVF O;  1WCM I;  3HOY I;  2CQ8 A;  1QVF Z;  2M8N A;  3FKI I;  4U0C A;  2PM9 A;  3BG0 B;  5IT9 f;  2F4M A;  3VMI A;  3F3F C;  3VTN A;  1YIT Z;  4NBA A;  3M4O I;  3S1M I;  3CCS Z;  2JGP A;  1YJN 1;  4BPF A;  1USP B;  4H2Y C;  1KD1 Q;  4PWV B;  2I3C A;  4DGL A;  2RBL A;  1N8R Q;  1TWC I;  2O53 A;  3RG2 A;  4NBH A;  2OTL 1;  3ESW A;  1YJW Z;  3OW2 O;  2GYK A;  1TWG I;  2QRE B;  3OW2 Y;  1UJZ A;  2GZI A;  2JIO A;  4QTT A;  2AYD A;  1K73 1;  3HZQ A;  3CC2 P;  3CC2 Z;  3DTJ A;  1Z01 A;  3GKL C;  1YI2 P;  2LPK A;  1T8K A;  2FQ0 A;  4XFZ A;  2JU1 A;  1K30 A;  3DS5 A;  3CC7 1;  1QVF Y;  2VUM I;  1WW9 A;  2JMO A;  2KG6 A;  2VUG A;  5CM2 M;  1BXI A;  3IX0 A;  1M90 2;  2LEX A;  2N5I A;  4NBF A;  1VQ4 1;  2N98 A;  4QKO A;  2R6M A;  1YIT P;  3CCQ Z;  5HGM A;  3OW2 Z;  2L9F A;  3D9X A;  2LL8 A;  3CCE Z;  4A93 I;  1M90 1;  1VQ5 P;  2LIW A;  2WB1 A;  4RS4 A;  1QXF A;  3U43 A;  2OAR A;  2K93 A;  2PNG A;  2PEJ A;  1YUK A;  2QR1 B;  2JA6 I;  3S1R I;  4M0I A;  1S7M A;  4BY1 I;  3CCU Z;  1KQS Y;  1VQL 1;  4MON A;  3G4S 1;  2JIP A;  2QEX 1;  1K73 2;  1TWH I;  1MZ8 A;  3M3Y I;  2GDW A;  3CC2 1;  1X3O A;  1WZN A;  1YI2 1;  2FQ2 A;  2LIY A;  5C4X I;  2HU9 A;  3GTL I;  3HOZ I;  3CCR 1;  3IFU A;  3TE5 B;  1Q86 2;  4NH1 C;  4U0F A;  2GTH A;  2E1M A;  2K0X A;  1Q82 2;  2L6E A;  2P28 A;  1YUA A;  4A3B I;  2KG8 A;  3CME 1;  4E2W A;  4GR2 A;  2XZ0 D;  2FQ1 A;  1QF8 A;  2JR6 A;  2JS4 A;  1S72 Z;  1L0H A;  2MY5 A;  2JA8 I;  1DL6 A;  2E7Z A;  2WAQ A;  1Y8C A;  4COP A;  4BXX I;  2PK7 A;  2K0D X;  1A8O A;  1A43 A;  2VPX A;  3DPH A;  5F2K A;  4CL1 A;  1M6N A;  4PH0 A;  2JIR A;  2KR5 A;  4QTU A;  1VQL Z;  2IZ4 A;  3PO3 S;  1VQ8 1;  2H85 A;  4NB8 A;  2AFD A;  2R93 I;  3HOW I;  3G1G A;  2LF4 A;  4NBB A;  3DS2 A;  1X3W A;  2AVA A;  1KC8 2;  2CGQ A;  3CCR P;  3G1I A;  1R9T I;  1EIA A;  2Z45 A;  3PO3 I;  1VQ7 P;  1NUI A;  2OTL Z;  2JIM A;  3NH5 A;  4A3M I;  2M8L A;  1AYI A;  2Z44 A;  4F37 A;  4R0M A;  3CCS P;  3FQQ A;  4E31 A;  5KP6 B;  3MON A;  1VQ4 P;  2V8J A;  2QNW A;  4U0B A;  3CCV Z;  3VRL C;  5T64 A;  3KIH A;  5A2Q f;  3S14 I;  3HOX I;  3G6E Z;  1NJI Q;  3G26 A;  2KW2 A;  4WYM A;  1RNI A;  2KGD A;  2E9H A;  2GZG A;  3NDI A;  1AA6 A;  1VQ5 1;  4S1T A;  1JWH C;  3K7A I;  3CME Z;  3CCJ Z;  1IMQ A;  1ZH1 A;  2PEM A;  2K92 A;  1AF8 A;  1YJ9 P;  1VQ8 P;  1QRJ A;  2LML A;  3CCL Z;  3DS4 A;  3S2H I;  3I56 1;  1VQL P;  2FAC A;  2CWO A;  4NFR A;  4HKG A;  2GZE A;  2LOL A;  3CCE P;  2VPZ A;  2N6Y A;  3CPW O;  3RG6 C;  2Q4Z A;  2AKL A;  2N5H A;  3LRY A;  1I50 I;  4COC A;  3GKQ A;  3J81 f;  2W03 A;  3CCM 1;  1Q86 1;  1TWA I;  3J80 b;  1RO2 A;  3WBH A;  3CC4 P;  1L1O C;  2BUO A;  1M90 Q;  1VHN A;  3P5J B;  2MF4 A;  4E30 A;  1VQP Z;  1VQM Z;  1UNK A;  1M1K Q;  1USP A;  4MD8 A;  2JA5 I;  5HGL A;  2PEK A;  4MD7 A;  2K5R A;  5C44 I;  2PEO A;  2GDX A;  4E2Z A;  3G28 A;  2MR7 A;  3Q87 A;  2QA4 1;  1YJ9 1;  3CXC O;  1RO4 A;  1K9M 1;  2Z46 A;  2DE7 A;  1RLY A;  2P9X A;  5F2N A;  3HKZ A;  5HVC A;  2KOR A;  3F3P C;  2EG5 A;  3CCE 1;  5BS1 A;  4NOZ A;  2XZ1 C;  3CCM Z;  1Q7Y Q;  2NVX I;  2BHV A;  1PFT A;  3GTP I;  3I07 A;  2K3R A;  1VQ7 1;  1TWF I;  3CQZ I;  1Q7Y 2;  2DE5 A;  3JAM f;  3CCS 1;  3GTM I;  2QRD B;  4NBE A;  1I6H I;  5AN9 F;  2KOS A;  2VLQ A;  3B5I A;  3EED A;  5I4T G;  1Q81 1;  4PH1 A;  1VQN P;  2YAD A;  2E2I I;  5HGO A;  1IUQ A;  1NQ4 A;  2VLO A;  1WII A;  3VMH A;  2QA4 Z;  2QA4 P;  1ZMB A;  3S2D I;  1YI2 Z;  2WPT A;  1KC8 1;  2KOO A;  1VQM 1;  2KGC A;  2CG5 B;  2AF8 A;  2DGY A;  3HYB A;  4H2X C;  2P3Y A;  1SFO I;  3RZD I;  2L0Q A;  2JB0 A;  2V8K A;  3CE7 A;  1YIJ Z;  3I56 P;  4E2Y A;  2KOP A;  2JO0 A;  4BPG A;  1VQ4 Z;  4HGZ A;  3J80 f;  2V45 A;  2K5X A;  4NBC A;  2YU9 I;  1S72 1;  2G2K A;  2M8P A;  2VPW A;  2MVU A;  1VKU A;  1P9N A;  3CCM P;  2DE6 A;  2LIU A;  2VLN A;  2VLP A;  3G71 1;  1K8A 1;  1KQS O;  1DNY A;  1YIJ P;  3KIF A;  2OTJ Z;  3CC4 1;  4A3E I;  3EER A;  1X3Z A;  2IZ3 A;  2KGA A;  2EGT A;  1N2F A;  1VQ6 1;  1N8R 1;  5BS2 A;  2JA7 I;  3GCF A;  3S17 I;  4A3C I;  1Q82 1;  3NY7 B;  2PY8 A;  3S15 I;  1K9M 2;  2L4B A;  4E2X A;  5D1O A;  1VQO 1;  1QVG Y;  3CCU P;  1NJI 2;  5D1P A;  1W2B Z;  3DS1 A;  5T67 A;  3T4N B;  4GR6 A;  5IP7 I;  2KWL A;  1KQS Z;  3S1N I;  1ML8 A;  1WJ2 A;  2GU2 A;  2R7Z I;  1Z02 A;  2OOY B;  2VF1 A;  2FVF A;  2JNY A;  3DS0 A;  4A3J I;  2QKD A;  2QEX Z;  3I4N I;  1S72 P;  2KOD A;  2E2H I;  2B63 I;  3EJE A;  3GTM S;  1YHQ Z;  1QVG Z;  4A3K I;  1HY8 A;  1KRL A;  3LUS A;  1M6E X;  1GXH A;  5KP7 B;  1K83 I;  4NEO A;  1W2B O;  4Y52 I;  1YIJ 1;  3HOV I;  2K2Q A;  1ZB8 A;  4XFX A;  2FVA A;  1TFI A;  2JU2 A;  3NH8 A;  2X2B A;  2M48 A;  1DV5 A;  1Z6M A;  2NVQ I;  1NJI 1;  1VQN 1;  4BY7 I;  2LFU A;  4RV9 A;  2JYL A;  3NH4 A;  3G71 Z;  1D1D A;  4NBD A;  2IV2 X;  2LKI A;  4EWC A;  4U0D A;  2F4O A;  3CC4 Z;  2JQ4 A;  2OTJ P;  1NP6 A;  3CXC Y;  1VQM P;  2EHS A;  2KOQ A;  1X0T A;  4HH4 A;  3H0D A;  4QNB A;  4MRI A;  3DS3 A;  1RO0 A;  2OZK A;  2PEI A;  1VQO Z;  1YJN Z;  2K0Y A;  3GJN A;  3HOU I;  1AUM A;  1OR5 A;  2ONT A;  3GTK I;  2GZJ A;  3NDJ A;  5CZD B;  5F2O A;  3CPW Z;  5IP9 I;  1YJW 1;  3G0V A;  3G71 P;  3U50 C;  2LTE A;  2NO8 A;  1L0I A;  2R92 I;  3I4M I;  1FDO A;  5LL6 f;  3CPW Y;  3IR7 A;  1VQ6 P;  2MD9 A;  4NBG A;  3CCV 1;  1JJ2 Y;  3LMO A;  1K73 Q;  1VQK Z;  1EOQ A;  3GZL A;  3FQM A;  1CEI A;  3MZL B;  1ACP A;  1VQO P;  4A3G I;  2OTJ 1;  3CCU 1;  5JPA A;  2VSQ A;  3GTJ I;  2EFJ A;  2M5R A;  3G4S Z;  5C3E I;  4BBR I;  2BJO A;  2JIQ A;  1QVG O;  4NB9 A;  4A3D I;  2MR8 A;  2NVY I;  5D1O B;  1VQ7 Z;  2XV6 A;  1LQL A;  2RT9 A;  1HQB A;  2FAE A;  3I55 Z;  5FLM I;  1VQ9 Z;  3D6W A;  2RPR A;  3J81 b;  1GXG A;  4RVF A;  1Q82 Q;  1F80 D;  3M1M A;  3CCR Z;  2JBG A;  2XXM A;  1Q86 Q;  4XRO A;  2M6N A;  2N6Z A;  3NTE A;  4TNU A;  1YJ9 Z;  5FLX b;  4BBS I;  3VMG A;  1Q16 A;  5T6B A;  5EW5 E;  2FVE A;  3I55 P;  2GDY A;  1VQ9 P;  5KP8 B;  3MGE A;  3G6E P;  3CMA Z;  2E2J I;  5A2Q b;  1N8R 2;  4AYB A;  2HF1 A;  1M1K 2;  1YHQ P;  3H3V J;  4HGY A;  4MH4 A;  1VQP P;  5C4J I;  4BPH A;  1ZNV A;  3CCQ 1;  1Y1V S;  1E6J P;  1JJ2 Z;  3CD6 1;  3P05 A;  1GPJ A;  2JAZ A;  1Q81 2;  4E33 A;  1KC8 Q;  2KPI A;  7CEI A;  3GTO I;  2EIA A;  2QLV B;  1VQK P;  3CMA P;  1K9M Q;  4RVG A;  4DK1 A; 
#chains in the Genus database with same CATH homology
 3CCJ P;  4XRQ A;  3BG1 B;  1VQ8 Z;  2V8I A;  3G21 A;  1YJW P;  4MD9 A;  1Z03 A;  1KD1 1;  2Q51 A;  3I55 1;  1VQ9 1;  2NVT I;  1Y1V I;  3G6E 1;  4XFY A;  1VQ5 Z;  2KI7 B;  3CCV P;  1YJN P;  3RZO I;  1BAJ A;  4A3L I;  2RIQ A;  3CCQ P;  3JAM b;  1ZB9 A;  1QYP A;  3I56 Z;  1K8A Q;  2OTL P;  3QWU A;  1RQF A;  4MXU A;  2XT1 A;  3Q20 A;  4Y7N I;  3TDH B;  1VQK 1;  3CMA 1;  2GTI A;  2Y0S A;  4U0E A;  1VQ6 Z;  4RVH A;  2PEN A;  3H47 A;  5FLX f;  3G29 A;  3CCJ 1;  3VB9 A;  1VLA A;  1M1K 1;  1VQN Z;  3CCL 1;  3CXC Z;  2QRC B;  3NFZ A;  5HGN A;  3MZK B;  1YIT 1;  2OOX B;  4RVD A;  4A3I I;  5IT9 b;  1Y1W I;  4U0A A;  4A3F I;  4DQY B;  3PO2 I;  1I3Q I;  3E2D A;  4IPY A;  1JJ2 O;  4XX2 A;  2JYG A;  2JUB A;  1K8A 2;  1W2B Y;  3S1Q I;  2PMZ A;  1YHQ 1;  5DCK A;  1VQP 1;  3GTQ I;  2O4H A;  3G4S P;  2QEX P;  3CC7 Z;  3CD6 P;  4E32 A;  3J7A 4;  1Q7Y 1;  3S16 I;  4X6A I;  3CCL P;  2ZAE B;  3CD6 Z;  2RHB A;  3CC7 P;  3H4E A;  1KD1 2;  3CME P;  2J6A A;  1M74 A;  2W04 A;  3IF8 A;  1Q81 Q;  3H0G I;  2PEQ A;  1QVF O;  1WCM I;  3HOY I;  1QVF Z;  2M8N A;  3FKI I;  4U0C A;  2PM9 A;  3BG0 B;  5IT9 f;  2F4M A;  3VMI A;  3F3F C;  3VTN A;  1YIT Z;  4NBA A;  3M4O I;  3S1M I;  3CCS Z;  1YJN 1;  1USP B;  2I3C A;  1KD1 Q;  4DGL A;  2RBL A;  1N8R Q;  1TWC I;  2O53 A;  4NBH A;  2OTL 1;  3ESW A;  1YJW Z;  3OW2 O;  1TWG I;  2QRE B;  3OW2 Y;  4QTT A;  1K73 1;  3HZQ A;  3CC2 P;  3CC2 Z;  3DTJ A;  1Z01 A;  1YI2 P;  4XFZ A;  1K30 A;  3DS5 A;  3CC7 1;  1QVF Y;  2VUM I;  1WW9 A;  2JMO A;  5CM2 M;  2VUG A;  3IX0 A;  1M90 2;  4NBF A;  1VQ4 1;  2R6M A;  3CCQ Z;  1YIT P;  3OW2 Z;  5HGM A;  3D9X A;  4A93 I;  1M90 1;  1VQ5 P;  2WB1 A;  4RS4 A;  2OAR A;  2JA6 I;  2PEJ A;  1YUK A;  2QR1 B;  3S1R I;  4M0I A;  1S7M A;  4BY1 I;  3CCU Z;  1KQS Y;  1VQL 1;  4MON A;  3G4S 1;  2QEX 1;  1K73 2;  1TWH I;  3M3Y I;  3CC2 1;  1YI2 1;  2LIY A;  5C4X I;  2HU9 A;  3GTL I;  3HOZ I;  3CCR 1;  3IFU A;  3TE5 B;  1Q86 2;  4NH1 C;  4U0F A;  2GTH A;  2E1M A;  1Q82 2;  2L6E A;  2P28 A;  1YUA A;  4A3B I;  3CME 1;  4E2W A;  4GR2 A;  1QF8 A;  2JR6 A;  2JS4 A;  1S72 Z;  2JA8 I;  1DL6 A;  2WAQ A;  4COP A;  4BXX I;  2PK7 A;  1A8O A;  1A43 A;  3DPH A;  5F2K A;  4CL1 A;  1M6N A;  4PH0 A;  4QTU A;  1VQL Z;  2IZ4 A;  3PO3 S;  1VQ8 1;  2H85 A;  4NB8 A;  2R93 I;  3HOW I;  3G1G A;  2LF4 A;  4NBB A;  3DS2 A;  1X3W A;  1KC8 2;  3CCR P;  3G1I A;  1R9T I;  1EIA A;  2Z45 A;  3PO3 I;  1VQ7 P;  1NUI A;  2OTL Z;  3NH5 A;  4A3M I;  2M8L A;  3FQQ A;  2Z44 A;  3CCS P;  4E31 A;  3MON A;  1VQ4 P;  2V8J A;  3CCV Z;  4U0B A;  3VRL C;  5T64 A;  3KIH A;  5A2Q f;  3S14 I;  3HOX I;  3G6E Z;  1NJI Q;  3G26 A;  4WYM A;  2E9H A;  1RNI A;  3NDI A;  3CCE Z;  1VQ5 1;  3GTG I;  4S1T A;  1JWH C;  3K7A I;  3CME Z;  3CCJ Z;  1ZH1 A;  2PEM A;  1YJ9 P;  1VQ8 P;  1QRJ A;  3CCL Z;  3DS4 A;  3S2H I;  3I56 1;  1VQL P;  2CWO A;  4NFR A;  3CCE P;  3CPW O;  3RG6 C;  2Q4Z A;  2AKL A;  3LRY A;  1I50 I;  3GKQ A;  4COC A;  3J81 f;  2W03 A;  3CCM 1;  1Q86 1;  1TWA I;  3J80 b;  1RO2 A;  3WBH A;  3CC4 P;  1L1O C;  2BUO A;  1M90 Q;  3P5J B;  4E30 A;  1VQP Z;  1VQM Z;  1M1K Q;  1USP A;  4MD8 A;  2JA5 I;  5HGL A;  2PEK A;  4MD7 A;  2K5R A;  5C44 I;  2PEO A;  4E2Z A;  3G28 A;  3Q87 A;  2QA4 1;  1YJ9 1;  3CXC O;  1RO4 A;  1K9M 1;  2Z46 A;  2DE7 A;  1RLY A;  2P9X A;  5F2N A;  3HKZ A;  3F3P C;  2EG5 A;  3CCE 1;  5BS1 A;  4NOZ A;  3CCM Z;  1Q7Y Q;  2NVX I;  2BHV A;  1PFT A;  3GTP I;  3I07 A;  2K3R A;  1VQ7 1;  1TWF I;  3CQZ I;  1Q7Y 2;  2DE5 A;  3JAM f;  3CCS 1;  3GTM I;  2QRD B;  4NBE A;  1I6H I;  5AN9 F;  3B5I A;  3EED A;  5I4T G;  1Q81 1;  4PH1 A;  1VQN P;  2YAD A;  2E2I I;  5HGO A;  1IUQ A;  1WII A;  3VMH A;  2QA4 Z;  2QA4 P;  1ZMB A;  3S2D I;  1YI2 Z;  1KC8 1;  1VQM 1;  2DGY A;  3HYB A;  2P3Y A;  1SFO I;  3RZD I;  2V8K A;  1YIJ Z;  3I56 P;  4E2Y A;  2JO0 A;  1VQ4 Z;  4HGZ A;  3J80 f;  4NBC A;  2YU9 I;  1S72 1;  2G2K A;  2M8P A;  1P9N A;  2DE6 A;  3CCM P;  3G71 1;  1K8A 1;  1KQS O;  1YIJ P;  3KIF A;  2OTJ Z;  3CC4 1;  4A3E I;  3EER A;  1X3Z A;  2IZ3 A;  2EGT A;  1N2F A;  1VQ6 1;  1N8R 1;  5BS2 A;  2JA7 I;  3GCF A;  3S17 I;  4A3C I;  1Q82 1;  2PY8 A;  3S15 I;  1K9M 2;  4E2X A;  5D1O A;  1VQO 1;  1QVG Y;  3CCU P;  1NJI 2;  5D1P A;  1W2B Z;  3DS1 A;  5T67 A;  3T4N B;  4GR6 A;  5IP7 I;  1KQS Z;  3S1N I;  1ML8 A;  2GU2 A;  2R7Z I;  1Z02 A;  2OOY B;  2VF1 A;  2JNY A;  3DS0 A;  4A3J I;  2QKD A;  2QEX Z;  3I4N I;  1S72 P;  2KOD A;  2E2H I;  2B63 I;  3GTM S;  1YHQ Z;  1QVG Z;  4A3K I;  3LUS A;  1KRL A;  1M6E X;  1K83 I;  1W2B O;  4Y52 I;  1YIJ 1;  3HOV I;  1ZB8 A;  4XFX A;  1TFI A;  3NH8 A;  2M48 A;  2NVQ I;  1NJI 1;  1VQN 1;  4BY7 I;  2LFU A;  4RV9 A;  2JYL A;  3NH4 A;  3G71 Z;  1D1D A;  4NBD A;  4EWC A;  4U0D A;  2F4O A;  3CC4 Z;  1NP6 A;  2OTJ P;  3CXC Y;  1VQM P;  1X0T A;  4HH4 A;  3H0D A;  4QNB A;  4MRI A;  3DS3 A;  1RO0 A;  2OZK A;  2PEI A;  1VQO Z;  1YJN Z;  3HOU I;  1AUM A;  2ONT A;  3GTK I;  3NDJ A;  5F2O A;  3CPW Z;  5IP9 I;  1YJW 1;  3G0V A;  3G71 P;  3U50 C;  2R92 I;  3I4M I;  5LL6 f;  3CPW Y;  1VQ6 P;  4NBG A;  3CCV 1;  1JJ2 Y;  1K73 Q;  1VQK Z;  1EOQ A;  3FQM A;  3MZL B;  1VQO P;  4A3G I;  2OTJ 1;  3CCU 1;  5JPA A;  3GTJ I;  2EFJ A;  3G4S Z;  5C3E I;  4BBR I;  2BJO A;  1QVG O;  4NB9 A;  4A3D I;  2NVY I;  5D1O B;  1VQ7 Z;  2XV6 A;  1LQL A;  2RT9 A;  3I55 Z;  5FLM I;  1VQ9 Z;  3D6W A;  2RPR A;  3J81 b;  4RVF A;  1Q82 Q;  3CCR Z;  3M1M A;  2XXM A;  1Q86 Q;  4XRO A;  2M6N A;  3NTE A;  4TNU A;  1YJ9 Z;  5FLX b;  4BBS I;  3VMG A;  5T6B A;  3I55 P;  1VQ9 P;  3MGE A;  3G6E P;  3CMA Z;  2E2J I;  5A2Q b;  1N8R 2;  4AYB A;  2HF1 A;  1M1K 2;  1YHQ P;  3H3V J;  4HGY A;  4MH4 A;  1VQP P;  5C4J I;  3CCQ 1;  1Y1V S;  1E6J P;  1JJ2 Z;  3CD6 1;  3P05 A;  1Q81 2;  4E33 A;  1KC8 Q;  2KPI A;  3GTO I;  2EIA A;  2QLV B;  1VQK P;  3CMA P;  1K9M Q;  4RVG A;  4DK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...