1RO2A

Bifunctional dna primase/polymerase domain of orf904 from the archaeal plasmid prn1- triple mutant f50m/l107m/l110m manganese soak
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
210
structure length
210
Chain Sequence
SSERIRYAKWMLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDEEKQRFLKMIEEGYNYAIPGGQKGMVIMDFESKEKLKAWIGESALEELCRKTLCTNTVHGGIHIYVLSNDIPPHKINPLFEENGKGIIDLQSYNSYVLGLGSCVNHLHCTTDKCPWKEQNYTTCYTLYNELKEISKVDLKSLLRFLAEKGKRLGITLSKTAKEWLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein ORF904
publication title Structure of a bifunctional DNA primase-polymerase
pubmed doi rcsb
source organism Sulfolobus islandicus
molecule tags Replication
total genus 59
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09250 Prim-Pol Bifunctional DNA primase/polymerase, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.130 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1ro2A01
2.20.25.130 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1ro2A03
3.30.2250.10 Alpha Beta 2-Layer Sandwich Prim-pol fold Bifunctional DNA primase/polymerase domain 1ro2A02
1RO0A 1RO2A 1RNIA 3M1MA
chains in the Genus database with same CATH superfamily
1FDIA 3HOWI 2CG5B 1I6HI 1QVFZ 4HGYA 2M8LA 3CME1 3CCS1 4Y52I 2GTHA 2N50A 4XFXA 3CC2P 1EMVA 3GZMA 2JR6A 2EG5A 2JA6I 2PMZA 3GTKI 1KLPA 2OOYB 2LIYA 1K731 2LMLA 3G0VA 4HH4A 1WW9A 1VQMP 1Y1VI 3IFUA 5IT9f 3CCRP 5A2Qf 2JYLA 4DGLA 3CMAZ 1VQ9Z 3IX0A 4CL1A 3GTGI 5FLXf 4NB8A 3JAMf 3S14I 2MR8A 3GTPI 3F3FC 5C3EI 4A3FI 1TWFI 1Q812 3I4NI 2AFEA 2JS4A 3CCUZ 3GTQI 1E6JP 1BXIA 4MH4A 3VRLC 3J81f 5D1PA 1ZNVA 2IZ4A 1Q81Q 1QXFA 3CCMZ 3RG2A 2PM9A 2JQ4A 1M901 2FQ1A 2LTEA 2L22A 3Q20A 1WJ2A 3CPWY 3CMA1 1VQ91 1Q861 2OTLZ 1VQPP 2RHBA 1E0HA 2CQ8A 2PEOA 5HGLA 3PO2I 3CCJZ 4A93I 3GKLC 5CZDB 2VLNA 1QF8A 2OZKA 1Q821 3S1MI 3DS0A 5FLMI 2KOQA 3H0DA 3LRYA 2WPTA 2FAEA 1LQLA 5C44I 1YIJP 1HQBA 1IMQA 2JA7I 1YI2P 1YJ9Z 2FVAA 3CCM1 2BJOA 1GXGA 1Q7YQ 5IP9I 1M1KQ 2FACA 3U50C 1KQSY 3DS1A 3H47A 3BG0B 1VQ61 3OW2Z 3JAMb 2N6ZA 2BHVA 1RO4A 2PENA 3HZQA 3CCJ1 2JNYA 3CE7A 1SIWA 2XV6A 4HGZA 2KG8A 4DK1A 3J81b 1Z03A 3CMEP 2QKDA 2VUMI 3CCSP 2K92A 3CC4P 2RBLA 2WAQA 3I551 1JWHC 4H2YC 1VQMZ 2FQ2A 2QLVB 3P05A 4DQYB 4NBHA 2Y0SA 1KQSO 2EHSA 2VLOA 3KIFA 4BY7I 1NJI2 2L9FA 2RPRA 2CNRA 4IPYA 2JA8I 1FDOA 1NJIQ 2NVTI 1VQ4Z 1YHQZ 3NDIA 2GYKA 4GR2A 1YUAA 4U0EA 3Q87A 3CCEZ 1Y1WI 1NQ4A 2KR5A 3KIHA 4U0DA 2MF4A 3CXCO 1QVGO 3CXCZ 1QVGZ 1TWAI 1YJWZ 2QA4Z 2E2JI 1P9NA 3NY7B 2GZJA 3CMAP 1VQ9P 4A3LI 1M6EX 3S1RI 1VQ41 2V3VA 2LIUA 2K3RA 3PO3S 3H0GI 1RO0A 2JBGA 2J6AA 3CCE1 4PWVB 3G1GA 7CEIA 3CCUP 3LUSA 1VQ8Z 3BG1B 2JIPA 2K0YA 3RZDI 2O53A 3CCMP 2L4BA 2N98A 1YJW1 2QA41 1QVFY 2DE6A 3DPHA 2GDYA 3GTJI 1VHNA 1KD12 2OTJZ 1Y1VS 2OTLP 4A3MI 5D1OA 2H85A 3CCQZ 3GTLI 3S1NI 1KD1Q 3MGEA 2EHTA 2EIAA 5BS1A 3CCJP 3GZLA 3NDJA 1VQ81 2AVAA 4NBEA 2FQ0A 1KC8Q 3GKQA 3GTMI 1VQN1 1Q811 3MONA 1M74A 2M5RA 2EFJA 3I55P 1N8RQ 2OTJ1 1A8OA 3EJBA 1K8AQ 1L0IA 5I4TG 1QVFO 3CCQ1 4A3II 4E33A 2R93I 4AYBA 2MR7A 2LOLA 3PO3I 1IUQA 2R7ZI 2F4MA 3GTOI 1QYPA 2QNWA 2KGAA 4MD8A 2QEXZ 2BUOA 2OOXB 1Q7Y1 1TFIA 2ERHA 1VQK1 2GZGA 1ACPA 3HYBA 4XRQA 2M6NA 4MD7A 2XXMA 1D1DA 4RVGA 4MXUA 1Q7Y2 1ZB8A 3NH5A 3CCL1 5AN9F 1YJNZ 1RNIA 3MZKB 2GZEA 2R6MA 2QEX1 2Q51A 1VQ4P 4IZ6A 1YHQP 1TWCI 1JJ2Z 4NH1C 3CCEP 2JYGA 2PEKA 3CQZI 3VTNA 1W2BZ 1VQ6Z 2KWLA 4RV9A 3NH4A 2N6YA 1MZ8A 2LL8A 2DNWA 1YJWP 2QA4P 2GZFA 5HGOA 3HKZA 2KGCA 1VQ7Z 2VLPA 1NUIA 5JPAA 1M1K2 1YJN1 3J80f 5IP7I 2NAPA 4MRIA 5IT9b 3NTEA 5A2Qb 2V8KA 1VQ8P 3I55Z 3OW2O 5FLXb 3GJNA 2QRDB 3I561 1VQNP 1L1OC 3FQQA 2JIQA 1VQ71 2YU9I 2OTJP 2QR1B 2M8NA 3CD6Z 2FADA 2K93A 2RIQA 2R92I 4A3DI 1HY8A 4NEOA 3I07A 3CCQP 3TE5B 1S72Z 2P3YA 3U43A 2GZIA 3CXCY 3K7AI 1QVGY 2XZ0D 4COCA 2AKLA 2LFUA 1RLYA 2NVXI 2KOSA 1K73Q 3CCVZ 2K94A 4PXHB 2M8PA 5KP7B 2XZ1C 1KRLA 2L6EA 3VMIA 2NVQI 3EJEA 5EJDA 3P5JB 3CD61 2KODA 4NBFA 4U0CA 4F37A 4UHPB 2PEQA 2V45A 3CPWZ 1ZH1A 3G711 1S721 2JAZA 3EJDA 4E31A 4E2ZA 3G4SZ 2P28A 1M902 2N5HA 2W04A 4RVHA 1K9M1 3CCLP 4XFZA 3CCV1 2PY8A 1M90Q 1X0TA 2QEXP 4E2XA 3GTMS 2WB1A 3HOZI 5HGNA 1Q86Q 3QWUA 2QREB 1Q82Q 3G4S1 2CGQA 2AFDA 2MD9A 1VQ5Z 2GDXA 3LMOA 4A3GI 2M48A 1BAJA 4A3KI 3M1MA 2PEMA 1DV5A 1YJNP 4A3CI 5EW5E 3DS2A 4RVFA 1PFTA 2KGEA 4CA3A 1VQNZ 5F2NA 4NBDA 4A3BI 5HGMA 4BPGA 2KI7B 1VQ6P 1QRJA 2ZAEB 4NBCA 5T6BA 1UNKA 4M0IA 1YITZ 4BXXI 1S7MA 2HU9A 2VF1A 2JU2A 4BY1I 2K0DX 2VPZA 3DS4A 2VLQA 3VMHA 1VQ51 1KC82 1VQ7P 3DS3A 1Q16A 1X3WA 2FVFA 2IV2X 1TWGI 2VUGA 1N8R2 2PEIA 2KW2A 1F80D 2JB0A 2K5XA 4NB9A 1K8A2 1VKUA 1UJZA 2GTIA 5DCKA 1VQP1 1VQKZ 3NFZA 1YIT1 2B63I 3I4MI 1WZNA 1Z01A 1Y8CA 1L0HA 2AF8A 2JA5I 3H3VJ 3CD6P 2O4HA 3CCLZ 1JJ2Y 3DTJA 4QTUA 1VQOZ 2MVVA 1S72P 3VB9A 2VPYA 3J7A4 4BPHA 2LKIA 4MD9A 1M1K1 2ONTA 3TDHB 4NFRA 4NBBA 4R0MA 3F3PC 3CCVP 4H2WC 2MY5A 3G28A 3FKII 1VQLZ 4A3JI 1EOQA 3S1QI 2E2HI 1DL6A 4HKGA 2FHSC 4E2YA 3CC41 2LIWA 1VQO1 2Z45A 4XROA 3G4SP 2FVEA 2DE7A 4H2XC 3HOXI 3OW2Y 3DS5A 3CC7Z 1JJ2O 1T8KA 2DE5A 3FQMA 3S17I 4PH0A 1AA6A 2F4OA 1W2BO 2VPXA 3G6EZ 3G1IA 1I50I 5C4JI 2LPKA 3MZLB 2G2KA 3I56Z 1K83I 1VQL1 2P9XA 3S16I 4S1TA 1A43A 4NBAA 5T64A 2L0QA 1DNYA 2W03A 5LL6f 1VQ5P 1WCMI 1NJI1 3CC71 2N5IA 3EERA 3VMGA 2Q4ZA 3G6E1 2V8IA 3D6WA 2K2QA 3RG6C 2KGDA 5HVCA 2K0XA 4RVDA 4XX2A 2YADA 2QRCB 1YUKA 3EEDA 3GCFA 4MRTC 1M6NA 1YITP 2HF1A 1Z6MA 5KP6B 3S15I 3HOUI 4NBGA 2KG9A 3G71Z 5C4XI 1K732 3CCU1 4PH1A 2NVYI 1CEIA 3T4NB 2E9HA 4RS4A 3ESWA 1ML8A 5HV8A 5F2KA 2K5RA 2LEXA 2RT9A 1OR5A 4BBSI 3NH8A 2E7ZA 3IF8A 2XT1A 2OTL1 2PEJA 1VQKP 1TWHI 2KPIA 3M4OI 3D2LA 3J80b 5F2OA 2KOOA 1AF8A 2LF4A 4X6AI 3CPWO 1AYIA 3HOYI 1ZMBA 3CC2Z 4EWCA 1KD11 2Z46A 1YJ91 4DG9A 1Q862 4WYMA 4XFYA 3S2HI 1RO2A 4BBRI 2DGYA 4QKOA 1VQOP 1KC81 1GXHA 1RQFA 3CCRZ 1K30A 2ROQA 4A3EI 1Q822 2JU1A 2PK7A 1N8R1 4U0FA 1KQSZ 3WBHA 1USPB 2E1MA 1N2FA 1K8A1 3HOVI 5CM2M 3H4EA 3E2DA 3CC21 4E30A 1VQLP 2JO0A 1IMPA 1GPJA 2JUBA 4QTTA 4U0AA 2JMOA 1I3QI 2E2II 3M3YI 1VQM1 2JIRA 1FR2A 3IR7A 3CCR1 3CC7P 2PNGA 1VQPZ 4Y7NI 3G26A 5KP8B 1USPA 1NP6A 3G6EP 1R9TI 3I56P 4E32A 2V8JA 2KOPA 2OARA 3G21A 2GU2A 2JGPA 2KG6A 1YIJZ 4NOZA 4MONA 5D1OB 1YI2Z 1YHQ1 2VPWA 4QNBA 2EGTA 2GDWA 4E2WA 4GR6A 3B5IA 1SFOI 2CWOA 1Z02A 4COPA 3D9XA 1AUMA 1X3ZA 2Z44A 5T67A 2X2BA 2KORA 1EIAA 4BPFA 4U0BA 2VSQA 4TNUA 1YIJ1 2I3CA 2AYDA 1K9M2 1YI21 1ZB9A 1WIIA 2JIMA 3CMEZ 3S2DI 3CCSZ 1X3OA 3CC4Z 2NO8A 2JIOA 5BS2A 3G71P 1K9MQ 3RZOI 3B4QA 1W2BY 2IZ3A 1YJ9P 3G29A 2MVUA 1VLAA
chains in the Genus database with same CATH topology
3HOWI 1I6HI 1QVFZ 4HGYA 2M8LA 3CME1 3CCS1 4Y52I 2GTHA 4XFXA 3CC2P 2JR6A 2EG5A 2JA6I 2PMZA 3GTKI 2OOYB 2LIYA 1K731 3G0VA 4HH4A 1WW9A 1VQMP 1Y1VI 3IFUA 5IT9f 3CCRP 5A2Qf 2JYLA 4DGLA 3CMAZ 1VQ9Z 3IX0A 4CL1A 3GTGI 5FLXf 4NB8A 3JAMf 3S14I 3GTPI 3F3FC 5C3EI 4A3FI 1TWFI 1Q812 3I4NI 2JS4A 3CCUZ 3GTQI 1E6JP 4MH4A 3VRLC 3J81f 5D1PA 2IZ4A 1Q81Q 3CCMZ 2PM9A 1M901 3Q20A 3CPWY 3CMA1 1VQ91 1Q861 2OTLZ 1VQPP 2RHBA 2PEOA 5HGLA 3PO2I 3CCJZ 4A93I 1QF8A 2OZKA 1Q821 3S1MI 3DS0A 5FLMI 3H0DA 1Q7Y2 3LRYA 1LQLA 5C44I 1YIJP 2JA7I 1YI2P 1YJ9Z 3CCM1 2BJOA 1Q7YQ 5IP9I 1M1KQ 3U50C 1KQSY 3DS1A 3H47A 3BG0B 1VQ61 3OW2Z 3JAMb 2BHVA 1RO4A 2PENA 3HZQA 3CCJ1 2JNYA 2XV6A 4HGZA 4DK1A 3J81b 1Z03A 3CMEP 2QKDA 2VUMI 3CCSP 3CC4P 2RBLA 2WAQA 3I551 1JWHC 1VQMZ 2QLVB 3P05A 4DQYB 4NBHA 2Y0SA 1KQSO 3KIFA 4BY7I 1NJI2 2RPRA 4IPYA 2JA8I 1NJIQ 2NVTI 1VQ4Z 1YHQZ 3NDIA 4GR2A 1YUAA 4U0EA 3Q87A 3CCEZ 1Y1WI 3KIHA 4U0DA 3CXCO 1QVGO 3CXCZ 1QVGZ 1TWAI 1YJWZ 2QA4Z 2E2JI 1P9NA 3CMAP 1VQ9P 4A3LI 1M6EX 3S1RI 1VQ41 2K3RA 3PO3S 3H0GI 1RO0A 2J6AA 3CCE1 1VQ8Z 3G1GA 3CCUP 3LUSA 3BG1B 3RZDI 2O53A 3CCMP 1YJW1 2QA41 1QVFY 2DE6A 3DPHA 3GTJI 1KD12 2OTJZ 1Y1VS 2OTLP 4A3MI 5D1OA 2H85A 3CCQZ 3GTLI 3S1NI 1KD1Q 3MGEA 2EIAA 5BS1A 3CCJP 3NDJA 1VQ81 4NBEA 1KC8Q 3GKQA 3GTMI 1VQN1 1Q811 3MONA 1M74A 2EFJA 3I55P 1N8RQ 2OTJ1 1A8OA 1K8AQ 5I4TG 1QVFO 3CCQ1 4A3II 4E33A 2R93I 4AYBA 3PO3I 1IUQA 2R7ZI 2F4MA 3GTOI 1QYPA 2QEXZ 4MD8A 2BUOA 2OOXB 1Q7Y1 1TFIA 1VQK1 3HYBA 4XRQA 2M6NA 4MD7A 2XXMA 1D1DA 4RVGA 4MXUA 1ZB8A 3NH5A 3CCL1 5AN9F 1YJNZ 1RNIA 3MZKB 2R6MA 2QEX1 2Q51A 1VQ4P 1YHQP 1TWCI 1JJ2Z 4NH1C 3CCEP 2JYGA 2PEKA 3CQZI 3VTNA 1W2BZ 1VQ6Z 4RV9A 3NH4A 1YJWP 2QA4P 5HGOA 3HKZA 1VQ7Z 1NUIA 5JPAA 1M1K2 1YJN1 3J80f 5IP7I 4MRIA 5IT9b 3NTEA 5A2Qb 2V8KA 1VQ8P 3I55Z 3OW2O 5FLXb 2QRDB 3I561 1VQNP 1L1OC 3FQQA 1VQ71 2YU9I 2OTJP 2QR1B 2M8NA 3CD6Z 2R92I 2RIQA 4A3DI 3I07A 3CCQP 3TE5B 1S72Z 2P3YA 3CXCY 1QVGY 3K7AI 4COCA 2AKLA 2LFUA 1RLYA 2NVXI 1K73Q 3CCVZ 2M8PA 1KRLA 2L6EA 3VMIA 2NVQI 3P5JB 3CD61 2KODA 4NBFA 4U0CA 2PEQA 3CPWZ 1ZH1A 3G711 1S721 3G4SZ 4E31A 4E2ZA 2P28A 1M902 2W04A 4RVHA 1K9M1 3CCLP 4XFZA 3CCV1 2PY8A 1M90Q 1X0TA 2QEXP 4E2XA 3GTMS 2WB1A 3HOZI 5HGNA 1Q86Q 3QWUA 2QREB 1Q82Q 3G4S1 1VQ5Z 4A3GI 2M48A 1BAJA 4A3KI 3M1MA 2PEMA 1YJNP 4A3CI 3DS2A 4RVFA 1PFTA 1VQNZ 5F2NA 4NBDA 4A3BI 5HGMA 2KI7B 1VQ6P 1QRJA 2ZAEB 4NBCA 5T6BA 4M0IA 1YITZ 4BXXI 1S7MA 2HU9A 2VF1A 4BY1I 3VMHA 1VQ51 3DS4A 1KC82 1VQ7P 3DS3A 1X3WA 1TWGI 2VUGA 1N8R2 2PEIA 1K8A2 4NB9A 2GTIA 5DCKA 1VQP1 1VQKZ 3NFZA 1YIT1 2B63I 3I4MI 1Z01A 3H3VJ 2JA5I 3CD6P 2O4HA 3CCLZ 1JJ2Y 3DTJA 4QTUA 1VQOZ 1S72P 3VB9A 3J7A4 4MD9A 1M1K1 2ONTA 3TDHB 4NFRA 4NBBA 3F3PC 3CCVP 3G28A 3FKII 1VQLZ 4A3JI 1EOQA 3S1QI 2E2HI 1DL6A 3CC41 4E2YA 1VQO1 2Z45A 4XROA 3G4SP 2DE7A 3HOXI 3OW2Y 3DS5A 3CC7Z 1JJ2O 2DE5A 3FQMA 3S17I 4PH0A 2F4OA 1W2BO 3G6EZ 3G1IA 1I50I 5C4JI 3MZLB 2G2KA 3I56Z 1K83I 1VQL1 2P9XA 3S16I 4S1TA 1A43A 4NBAA 5T64A 2W03A 5LL6f 1VQ5P 1WCMI 1NJI1 3CC71 3EERA 3VMGA 2Q4ZA 3G6E1 2V8IA 3D6WA 3RG6C 4RVDA 4XX2A 2YADA 2QRCB 1YUKA 3EEDA 3GCFA 1YITP 1M6NA 2HF1A 3S15I 3HOUI 4NBGA 3G71Z 5C4XI 1K732 3CCU1 4PH1A 2NVYI 3T4NB 2E9HA 4RS4A 3ESWA 1ML8A 5F2KA 2K5RA 2RT9A 4BBSI 3NH8A 3IF8A 2XT1A 2OTL1 2PEJA 1VQKP 1TWHI 2KPIA 3M4OI 3J80b 5F2OA 4X6AI 2LF4A 3CPWO 3HOYI 1ZMBA 3CC2Z 4EWCA 1KD11 2Z46A 1YJ91 1Q862 4WYMA 4XFYA 3S2HI 1RO2A 4BBRI 2DGYA 1VQOP 1KC81 1RQFA 3CCRZ 1K30A 4A3EI 1Q822 2PK7A 1N8R1 4U0FA 1KQSZ 3WBHA 1USPB 2E1MA 1N2FA 1K8A1 3HOVI 5CM2M 3H4EA 3E2DA 3CC21 4E30A 1VQLP 2JO0A 4QTTA 2JUBA 4U0AA 2JMOA 1I3QI 2E2II 3M3YI 1VQM1 3CCR1 3CC7P 1VQPZ 4Y7NI 3G26A 1USPA 1NP6A 3G6EP 1R9TI 3I56P 4E32A 2V8JA 2OARA 3G21A 2GU2A 1YIJZ 4NOZA 4MONA 5D1OB 1YI2Z 1YHQ1 4QNBA 2EGTA 4E2WA 4GR6A 3B5IA 1SFOI 2CWOA 1Z02A 4COPA 3D9XA 1AUMA 1X3ZA 2Z44A 5T67A 1EIAA 4U0BA 4TNUA 1YIJ1 2I3CA 1K9M2 1YI21 1ZB9A 1WIIA 3CMEZ 3S2DI 3CCSZ 3CC4Z 5BS2A 3G71P 1K9MQ 3RZOI 1W2BY 2IZ3A 1YJ9P 3G29A 1VLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RO0 A;  1RO2 A;  1RNI A;  3M1M A; 
#chains in the Genus database with same CATH topology
 1FDI A;  3HOW I;  2CG5 B;  1I6H I;  1QVF Z;  4HGY A;  2M8L A;  3CME 1;  3CCS 1;  4Y52 I;  2GTH A;  2N50 A;  4XFX A;  3CC2 P;  1EMV A;  3GZM A;  2JR6 A;  2EG5 A;  2JA6 I;  2PMZ A;  3GTK I;  1KLP A;  2OOY B;  2LIY A;  1K73 1;  2LML A;  3G0V A;  4HH4 A;  1WW9 A;  1VQM P;  1Y1V I;  3IFU A;  5IT9 f;  3CCR P;  5A2Q f;  2JYL A;  4DGL A;  3CMA Z;  1VQ9 Z;  3IX0 A;  4CL1 A;  3GTG I;  5FLX f;  4NB8 A;  3JAM f;  3S14 I;  2MR8 A;  3GTP I;  3F3F C;  5C3E I;  4A3F I;  1TWF I;  1Q81 2;  3I4N I;  2AFE A;  2JS4 A;  3CCU Z;  3GTQ I;  1E6J P;  1BXI A;  4MH4 A;  3VRL C;  3J81 f;  5D1P A;  1ZNV A;  2IZ4 A;  1Q81 Q;  1QXF A;  3CCM Z;  3RG2 A;  2PM9 A;  2JQ4 A;  1M90 1;  2FQ1 A;  2LTE A;  2L22 A;  3Q20 A;  1WJ2 A;  3CPW Y;  3CMA 1;  1VQ9 1;  1Q86 1;  2OTL Z;  1VQP P;  2RHB A;  1E0H A;  2CQ8 A;  2PEO A;  5HGL A;  3PO2 I;  3CCJ Z;  4A93 I;  3GKL C;  5CZD B;  2VLN A;  1QF8 A;  2OZK A;  1Q82 1;  3S1M I;  3DS0 A;  5FLM I;  2KOQ A;  3H0D A;  3LRY A;  2WPT A;  2FAE A;  1LQL A;  5C44 I;  1YIJ P;  1HQB A;  1IMQ A;  2JA7 I;  1YI2 P;  1YJ9 Z;  2FVA A;  3CCM 1;  2BJO A;  1GXG A;  1Q7Y Q;  5IP9 I;  1M1K Q;  2FAC A;  3U50 C;  1KQS Y;  3DS1 A;  3H47 A;  3BG0 B;  1VQ6 1;  3OW2 Z;  3JAM b;  2N6Z A;  2BHV A;  1RO4 A;  2PEN A;  3HZQ A;  3CCJ 1;  2JNY A;  3CE7 A;  1SIW A;  2XV6 A;  4HGZ A;  2KG8 A;  4DK1 A;  3J81 b;  1Z03 A;  3CME P;  2QKD A;  2VUM I;  3CCS P;  2K92 A;  3CC4 P;  2RBL A;  2WAQ A;  3I55 1;  1JWH C;  4H2Y C;  1VQM Z;  2FQ2 A;  2QLV B;  3P05 A;  4DQY B;  4NBH A;  2Y0S A;  1KQS O;  2EHS A;  2VLO A;  3KIF A;  4BY7 I;  1NJI 2;  2L9F A;  2RPR A;  2CNR A;  4IPY A;  2JA8 I;  1FDO A;  1NJI Q;  2NVT I;  1VQ4 Z;  1YHQ Z;  3NDI A;  2GYK A;  4GR2 A;  1YUA A;  4U0E A;  3Q87 A;  3CCE Z;  1Y1W I;  1NQ4 A;  2KR5 A;  3KIH A;  4U0D A;  2MF4 A;  3CXC O;  1QVG O;  3CXC Z;  1QVG Z;  1TWA I;  1YJW Z;  2QA4 Z;  2E2J I;  1P9N A;  3NY7 B;  2GZJ A;  3CMA P;  1VQ9 P;  4A3L I;  1M6E X;  3S1R I;  1VQ4 1;  2V3V A;  2LIU A;  2K3R A;  3PO3 S;  3H0G I;  1RO0 A;  2JBG A;  2J6A A;  3CCE 1;  4PWV B;  3G1G A;  7CEI A;  3CCU P;  3LUS A;  1VQ8 Z;  3BG1 B;  2JIP A;  2K0Y A;  3RZD I;  2O53 A;  3CCM P;  2L4B A;  2N98 A;  1YJW 1;  2QA4 1;  1QVF Y;  2DE6 A;  3DPH A;  2GDY A;  3GTJ I;  1VHN A;  1KD1 2;  2OTJ Z;  1Y1V S;  2OTL P;  4A3M I;  5D1O A;  2H85 A;  3CCQ Z;  3GTL I;  3S1N I;  1KD1 Q;  3MGE A;  2EHT A;  2EIA A;  5BS1 A;  3CCJ P;  3GZL A;  3NDJ A;  1VQ8 1;  2AVA A;  4NBE A;  2FQ0 A;  1KC8 Q;  3GKQ A;  3GTM I;  1VQN 1;  1Q81 1;  3MON A;  1M74 A;  2M5R A;  2EFJ A;  3I55 P;  1N8R Q;  2OTJ 1;  1A8O A;  3EJB A;  1K8A Q;  1L0I A;  5I4T G;  1QVF O;  3CCQ 1;  4A3I I;  4E33 A;  2R93 I;  4AYB A;  2MR7 A;  2LOL A;  3PO3 I;  1IUQ A;  2R7Z I;  2F4M A;  3GTO I;  1QYP A;  2QNW A;  2KGA A;  4MD8 A;  2QEX Z;  2BUO A;  2OOX B;  1Q7Y 1;  1TFI A;  2ERH A;  1VQK 1;  2GZG A;  1ACP A;  3HYB A;  4XRQ A;  2M6N A;  4MD7 A;  2XXM A;  1D1D A;  4RVG A;  4MXU A;  1Q7Y 2;  1ZB8 A;  3NH5 A;  3CCL 1;  5AN9 F;  1YJN Z;  1RNI A;  3MZK B;  2GZE A;  2R6M A;  2QEX 1;  2Q51 A;  1VQ4 P;  4IZ6 A;  1YHQ P;  1TWC I;  1JJ2 Z;  4NH1 C;  3CCE P;  2JYG A;  2PEK A;  3CQZ I;  3VTN A;  1W2B Z;  1VQ6 Z;  2KWL A;  4RV9 A;  3NH4 A;  2N6Y A;  1MZ8 A;  2LL8 A;  2DNW A;  1YJW P;  2QA4 P;  2GZF A;  5HGO A;  3HKZ A;  2KGC A;  1VQ7 Z;  2VLP A;  1NUI A;  5JPA A;  1M1K 2;  1YJN 1;  3J80 f;  5IP7 I;  2NAP A;  4MRI A;  5IT9 b;  3NTE A;  5A2Q b;  2V8K A;  1VQ8 P;  3I55 Z;  3OW2 O;  5FLX b;  3GJN A;  2QRD B;  3I56 1;  1VQN P;  1L1O C;  3FQQ A;  2JIQ A;  1VQ7 1;  2YU9 I;  2OTJ P;  2QR1 B;  2M8N A;  3CD6 Z;  2FAD A;  2K93 A;  2RIQ A;  2R92 I;  4A3D I;  1HY8 A;  4NEO A;  3I07 A;  3CCQ P;  3TE5 B;  1S72 Z;  2P3Y A;  3U43 A;  2GZI A;  3CXC Y;  3K7A I;  1QVG Y;  2XZ0 D;  4COC A;  2AKL A;  2LFU A;  1RLY A;  2NVX I;  2KOS A;  1K73 Q;  3CCV Z;  2K94 A;  4PXH B;  2M8P A;  5KP7 B;  2XZ1 C;  1KRL A;  2L6E A;  3VMI A;  2NVQ I;  3EJE A;  5EJD A;  3P5J B;  3CD6 1;  2KOD A;  4NBF A;  4U0C A;  4F37 A;  4UHP B;  2PEQ A;  2V45 A;  3CPW Z;  1ZH1 A;  3G71 1;  1S72 1;  2JAZ A;  3EJD A;  4E31 A;  4E2Z A;  3G4S Z;  2P28 A;  1M90 2;  2N5H A;  2W04 A;  4RVH A;  1K9M 1;  3CCL P;  4XFZ A;  3CCV 1;  2PY8 A;  1M90 Q;  1X0T A;  2QEX P;  4E2X A;  3GTM S;  2WB1 A;  3HOZ I;  5HGN A;  1Q86 Q;  3QWU A;  2QRE B;  1Q82 Q;  3G4S 1;  2CGQ A;  2AFD A;  2MD9 A;  1VQ5 Z;  2GDX A;  3LMO A;  4A3G I;  2M48 A;  1BAJ A;  4A3K I;  3M1M A;  2PEM A;  1DV5 A;  1YJN P;  4A3C I;  5EW5 E;  3DS2 A;  4RVF A;  1PFT A;  2KGE A;  4CA3 A;  1VQN Z;  5F2N A;  4NBD A;  4A3B I;  5HGM A;  4BPG A;  2KI7 B;  1VQ6 P;  1QRJ A;  2ZAE B;  4NBC A;  5T6B A;  1UNK A;  4M0I A;  1YIT Z;  4BXX I;  1S7M A;  2HU9 A;  2VF1 A;  2JU2 A;  4BY1 I;  2K0D X;  2VPZ A;  3DS4 A;  2VLQ A;  3VMH A;  1VQ5 1;  1KC8 2;  1VQ7 P;  3DS3 A;  1Q16 A;  1X3W A;  2FVF A;  2IV2 X;  1TWG I;  2VUG A;  1N8R 2;  2PEI A;  2KW2 A;  1F80 D;  2JB0 A;  2K5X A;  4NB9 A;  1K8A 2;  1VKU A;  1UJZ A;  2GTI A;  5DCK A;  1VQP 1;  1VQK Z;  3NFZ A;  1YIT 1;  2B63 I;  3I4M I;  1WZN A;  1Z01 A;  1Y8C A;  1L0H A;  2AF8 A;  2JA5 I;  3H3V J;  3CD6 P;  2O4H A;  3CCL Z;  1JJ2 Y;  3DTJ A;  4QTU A;  1VQO Z;  2MVV A;  1S72 P;  3VB9 A;  2VPY A;  3J7A 4;  4BPH A;  2LKI A;  4MD9 A;  1M1K 1;  2ONT A;  3TDH B;  4NFR A;  4NBB A;  4R0M A;  3F3P C;  3CCV P;  4H2W C;  2MY5 A;  3G28 A;  3FKI I;  1VQL Z;  4A3J I;  1EOQ A;  3S1Q I;  2E2H I;  1DL6 A;  4HKG A;  2FHS C;  4E2Y A;  3CC4 1;  2LIW A;  1VQO 1;  2Z45 A;  4XRO A;  3G4S P;  2FVE A;  2DE7 A;  4H2X C;  3HOX I;  3OW2 Y;  3DS5 A;  3CC7 Z;  1JJ2 O;  1T8K A;  2DE5 A;  3FQM A;  3S17 I;  4PH0 A;  1AA6 A;  2F4O A;  1W2B O;  2VPX A;  3G6E Z;  3G1I A;  1I50 I;  5C4J I;  2LPK A;  3MZL B;  2G2K A;  3I56 Z;  1K83 I;  1VQL 1;  2P9X A;  3S16 I;  4S1T A;  1A43 A;  4NBA A;  5T64 A;  2L0Q A;  1DNY A;  2W03 A;  5LL6 f;  1VQ5 P;  1WCM I;  1NJI 1;  3CC7 1;  2N5I A;  3EER A;  3VMG A;  2Q4Z A;  3G6E 1;  2V8I A;  3D6W A;  2K2Q A;  3RG6 C;  2KGD A;  5HVC A;  2K0X A;  4RVD A;  4XX2 A;  2YAD A;  2QRC B;  1YUK A;  3EED A;  3GCF A;  4MRT C;  1M6N A;  1YIT P;  2HF1 A;  1Z6M A;  5KP6 B;  3S15 I;  3HOU I;  4NBG A;  2KG9 A;  3G71 Z;  5C4X I;  1K73 2;  3CCU 1;  4PH1 A;  2NVY I;  1CEI A;  3T4N B;  2E9H A;  4RS4 A;  3ESW A;  1ML8 A;  5HV8 A;  5F2K A;  2K5R A;  2LEX A;  2RT9 A;  1OR5 A;  4BBS I;  3NH8 A;  2E7Z A;  3IF8 A;  2XT1 A;  2OTL 1;  2PEJ A;  1VQK P;  1TWH I;  2KPI A;  3M4O I;  3D2L A;  3J80 b;  5F2O A;  2KOO A;  1AF8 A;  2LF4 A;  4X6A I;  3CPW O;  1AYI A;  3HOY I;  1ZMB A;  3CC2 Z;  4EWC A;  1KD1 1;  2Z46 A;  1YJ9 1;  4DG9 A;  1Q86 2;  4WYM A;  4XFY A;  3S2H I;  1RO2 A;  4BBR I;  2DGY A;  4QKO A;  1VQO P;  1KC8 1;  1GXH A;  1RQF A;  3CCR Z;  1K30 A;  2ROQ A;  4A3E I;  1Q82 2;  2JU1 A;  2PK7 A;  1N8R 1;  4U0F A;  1KQS Z;  3WBH A;  1USP B;  2E1M A;  1N2F A;  1K8A 1;  3HOV I;  5CM2 M;  3H4E A;  3E2D A;  3CC2 1;  4E30 A;  1VQL P;  2JO0 A;  1IMP A;  1GPJ A;  2JUB A;  4QTT A;  4U0A A;  2JMO A;  1I3Q I;  2E2I I;  3M3Y I;  1VQM 1;  2JIR A;  1FR2 A;  3IR7 A;  3CCR 1;  3CC7 P;  2PNG A;  1VQP Z;  4Y7N I;  3G26 A;  5KP8 B;  1USP A;  1NP6 A;  3G6E P;  1R9T I;  3I56 P;  4E32 A;  2V8J A;  2KOP A;  2OAR A;  3G21 A;  2GU2 A;  2JGP A;  2KG6 A;  1YIJ Z;  4NOZ A;  4MON A;  5D1O B;  1YI2 Z;  1YHQ 1;  2VPW A;  4QNB A;  2EGT A;  2GDW A;  4E2W A;  4GR6 A;  3B5I A;  1SFO I;  2CWO A;  1Z02 A;  4COP A;  3D9X A;  1AUM A;  1X3Z A;  2Z44 A;  5T67 A;  2X2B A;  2KOR A;  1EIA A;  4BPF A;  4U0B A;  2VSQ A;  4TNU A;  1YIJ 1;  2I3C A;  2AYD A;  1K9M 2;  1YI2 1;  1ZB9 A;  1WII A;  2JIM A;  3CME Z;  3S2D I;  3CCS Z;  1X3O A;  3CC4 Z;  2NO8 A;  2JIO A;  5BS2 A;  3G71 P;  1K9M Q;  3RZO I;  3B4Q A;  1W2B Y;  2IZ3 A;  1YJ9 P;  3G29 A;  2MVU A;  1VLA A; 
#chains in the Genus database with same CATH homology
 3HOW I;  1I6H I;  1QVF Z;  4HGY A;  2M8L A;  3CME 1;  3CCS 1;  4Y52 I;  2GTH A;  4XFX A;  3CC2 P;  2JR6 A;  2EG5 A;  2JA6 I;  2PMZ A;  3GTK I;  2OOY B;  2LIY A;  1K73 1;  3G0V A;  4HH4 A;  1WW9 A;  1VQM P;  1Y1V I;  3IFU A;  5IT9 f;  3CCR P;  5A2Q f;  2JYL A;  4DGL A;  3CMA Z;  1VQ9 Z;  3IX0 A;  4CL1 A;  3GTG I;  5FLX f;  4NB8 A;  3JAM f;  3S14 I;  3GTP I;  3F3F C;  5C3E I;  4A3F I;  1TWF I;  1Q81 2;  3I4N I;  2JS4 A;  3CCU Z;  3GTQ I;  1E6J P;  4MH4 A;  3VRL C;  3J81 f;  5D1P A;  2IZ4 A;  1Q81 Q;  3CCM Z;  2PM9 A;  1M90 1;  3Q20 A;  3CPW Y;  3CMA 1;  1VQ9 1;  1Q86 1;  2OTL Z;  1VQP P;  2RHB A;  2PEO A;  5HGL A;  3PO2 I;  3CCJ Z;  4A93 I;  1QF8 A;  2OZK A;  1Q82 1;  3S1M I;  3DS0 A;  5FLM I;  3H0D A;  1Q7Y 2;  3LRY A;  1LQL A;  5C44 I;  1YIJ P;  2JA7 I;  1YI2 P;  1YJ9 Z;  3CCM 1;  2BJO A;  1Q7Y Q;  5IP9 I;  1M1K Q;  3U50 C;  1KQS Y;  3DS1 A;  3H47 A;  3BG0 B;  1VQ6 1;  3OW2 Z;  3JAM b;  2BHV A;  1RO4 A;  2PEN A;  3HZQ A;  3CCJ 1;  2JNY A;  2XV6 A;  4HGZ A;  4DK1 A;  3J81 b;  1Z03 A;  3CME P;  2QKD A;  2VUM I;  3CCS P;  3CC4 P;  2RBL A;  2WAQ A;  3I55 1;  1JWH C;  1VQM Z;  2QLV B;  3P05 A;  4DQY B;  4NBH A;  2Y0S A;  1KQS O;  3KIF A;  4BY7 I;  1NJI 2;  2RPR A;  4IPY A;  2JA8 I;  1NJI Q;  2NVT I;  1VQ4 Z;  1YHQ Z;  3NDI A;  4GR2 A;  1YUA A;  4U0E A;  3Q87 A;  3CCE Z;  1Y1W I;  3KIH A;  4U0D A;  3CXC O;  1QVG O;  3CXC Z;  1QVG Z;  1TWA I;  1YJW Z;  2QA4 Z;  2E2J I;  1P9N A;  3CMA P;  1VQ9 P;  4A3L I;  1M6E X;  3S1R I;  1VQ4 1;  2K3R A;  3PO3 S;  3H0G I;  1RO0 A;  2J6A A;  3CCE 1;  1VQ8 Z;  3G1G A;  3CCU P;  3LUS A;  3BG1 B;  3RZD I;  2O53 A;  3CCM P;  1YJW 1;  2QA4 1;  1QVF Y;  2DE6 A;  3DPH A;  3GTJ I;  1KD1 2;  2OTJ Z;  1Y1V S;  2OTL P;  4A3M I;  5D1O A;  2H85 A;  3CCQ Z;  3GTL I;  3S1N I;  1KD1 Q;  3MGE A;  2EIA A;  5BS1 A;  3CCJ P;  3NDJ A;  1VQ8 1;  4NBE A;  1KC8 Q;  3GKQ A;  3GTM I;  1VQN 1;  1Q81 1;  3MON A;  1M74 A;  2EFJ A;  3I55 P;  1N8R Q;  2OTJ 1;  1A8O A;  1K8A Q;  5I4T G;  1QVF O;  3CCQ 1;  4A3I I;  4E33 A;  2R93 I;  4AYB A;  3PO3 I;  1IUQ A;  2R7Z I;  2F4M A;  3GTO I;  1QYP A;  2QEX Z;  4MD8 A;  2BUO A;  2OOX B;  1Q7Y 1;  1TFI A;  1VQK 1;  3HYB A;  4XRQ A;  2M6N A;  4MD7 A;  2XXM A;  1D1D A;  4RVG A;  4MXU A;  1ZB8 A;  3NH5 A;  3CCL 1;  5AN9 F;  1YJN Z;  1RNI A;  3MZK B;  2R6M A;  2QEX 1;  2Q51 A;  1VQ4 P;  1YHQ P;  1TWC I;  1JJ2 Z;  4NH1 C;  3CCE P;  2JYG A;  2PEK A;  3CQZ I;  3VTN A;  1W2B Z;  1VQ6 Z;  4RV9 A;  3NH4 A;  1YJW P;  2QA4 P;  5HGO A;  3HKZ A;  1VQ7 Z;  1NUI A;  5JPA A;  1M1K 2;  1YJN 1;  3J80 f;  5IP7 I;  4MRI A;  5IT9 b;  3NTE A;  5A2Q b;  2V8K A;  1VQ8 P;  3I55 Z;  3OW2 O;  5FLX b;  2QRD B;  3I56 1;  1VQN P;  1L1O C;  3FQQ A;  1VQ7 1;  2YU9 I;  2OTJ P;  2QR1 B;  2M8N A;  3CD6 Z;  2R92 I;  2RIQ A;  4A3D I;  3I07 A;  3CCQ P;  3TE5 B;  1S72 Z;  2P3Y A;  3CXC Y;  1QVG Y;  3K7A I;  4COC A;  2AKL A;  2LFU A;  1RLY A;  2NVX I;  1K73 Q;  3CCV Z;  2M8P A;  1KRL A;  2L6E A;  3VMI A;  2NVQ I;  3P5J B;  3CD6 1;  2KOD A;  4NBF A;  4U0C A;  2PEQ A;  3CPW Z;  1ZH1 A;  3G71 1;  1S72 1;  3G4S Z;  4E31 A;  4E2Z A;  2P28 A;  1M90 2;  2W04 A;  4RVH A;  1K9M 1;  3CCL P;  4XFZ A;  3CCV 1;  2PY8 A;  1M90 Q;  1X0T A;  2QEX P;  4E2X A;  3GTM S;  2WB1 A;  3HOZ I;  5HGN A;  1Q86 Q;  3QWU A;  2QRE B;  1Q82 Q;  3G4S 1;  1VQ5 Z;  4A3G I;  2M48 A;  1BAJ A;  4A3K I;  3M1M A;  2PEM A;  1YJN P;  4A3C I;  3DS2 A;  4RVF A;  1PFT A;  1VQN Z;  5F2N A;  4NBD A;  4A3B I;  5HGM A;  2KI7 B;  1VQ6 P;  1QRJ A;  2ZAE B;  4NBC A;  5T6B A;  4M0I A;  1YIT Z;  4BXX I;  1S7M A;  2HU9 A;  2VF1 A;  4BY1 I;  3VMH A;  1VQ5 1;  3DS4 A;  1KC8 2;  1VQ7 P;  3DS3 A;  1X3W A;  1TWG I;  2VUG A;  1N8R 2;  2PEI A;  1K8A 2;  4NB9 A;  2GTI A;  5DCK A;  1VQP 1;  1VQK Z;  3NFZ A;  1YIT 1;  2B63 I;  3I4M I;  1Z01 A;  3H3V J;  2JA5 I;  3CD6 P;  2O4H A;  3CCL Z;  1JJ2 Y;  3DTJ A;  4QTU A;  1VQO Z;  1S72 P;  3VB9 A;  3J7A 4;  4MD9 A;  1M1K 1;  2ONT A;  3TDH B;  4NFR A;  4NBB A;  3F3P C;  3CCV P;  3G28 A;  3FKI I;  1VQL Z;  4A3J I;  1EOQ A;  3S1Q I;  2E2H I;  1DL6 A;  3CC4 1;  4E2Y A;  1VQO 1;  2Z45 A;  4XRO A;  3G4S P;  2DE7 A;  3HOX I;  3OW2 Y;  3DS5 A;  3CC7 Z;  1JJ2 O;  2DE5 A;  3FQM A;  3S17 I;  4PH0 A;  2F4O A;  1W2B O;  3G6E Z;  3G1I A;  1I50 I;  5C4J I;  3MZL B;  2G2K A;  3I56 Z;  1K83 I;  1VQL 1;  2P9X A;  3S16 I;  4S1T A;  1A43 A;  4NBA A;  5T64 A;  2W03 A;  5LL6 f;  1VQ5 P;  1WCM I;  1NJI 1;  3CC7 1;  3EER A;  3VMG A;  2Q4Z A;  3G6E 1;  2V8I A;  3D6W A;  3RG6 C;  4RVD A;  4XX2 A;  2YAD A;  2QRC B;  1YUK A;  3EED A;  3GCF A;  1YIT P;  1M6N A;  2HF1 A;  3S15 I;  3HOU I;  4NBG A;  3G71 Z;  5C4X I;  1K73 2;  3CCU 1;  4PH1 A;  2NVY I;  3T4N B;  2E9H A;  4RS4 A;  3ESW A;  1ML8 A;  5F2K A;  2K5R A;  2RT9 A;  4BBS I;  3NH8 A;  3IF8 A;  2XT1 A;  2OTL 1;  2PEJ A;  1VQK P;  1TWH I;  2KPI A;  3M4O I;  3J80 b;  5F2O A;  4X6A I;  2LF4 A;  3CPW O;  3HOY I;  1ZMB A;  3CC2 Z;  4EWC A;  1KD1 1;  2Z46 A;  1YJ9 1;  1Q86 2;  4WYM A;  4XFY A;  3S2H I;  1RO2 A;  4BBR I;  2DGY A;  1VQO P;  1KC8 1;  1RQF A;  3CCR Z;  1K30 A;  4A3E I;  1Q82 2;  2PK7 A;  1N8R 1;  4U0F A;  1KQS Z;  3WBH A;  1USP B;  2E1M A;  1N2F A;  1K8A 1;  3HOV I;  5CM2 M;  3H4E A;  3E2D A;  3CC2 1;  4E30 A;  1VQL P;  2JO0 A;  4QTT A;  2JUB A;  4U0A A;  2JMO A;  1I3Q I;  2E2I I;  3M3Y I;  1VQM 1;  3CCR 1;  3CC7 P;  1VQP Z;  4Y7N I;  3G26 A;  1USP A;  1NP6 A;  3G6E P;  1R9T I;  3I56 P;  4E32 A;  2V8J A;  2OAR A;  3G21 A;  2GU2 A;  1YIJ Z;  4NOZ A;  4MON A;  5D1O B;  1YI2 Z;  1YHQ 1;  4QNB A;  2EGT A;  4E2W A;  4GR6 A;  3B5I A;  1SFO I;  2CWO A;  1Z02 A;  4COP A;  3D9X A;  1AUM A;  1X3Z A;  2Z44 A;  5T67 A;  1EIA A;  4U0B A;  4TNU A;  1YIJ 1;  2I3C A;  1K9M 2;  1YI2 1;  1ZB9 A;  1WII A;  3CME Z;  3S2D I;  3CCS Z;  3CC4 Z;  5BS2 A;  3G71 P;  1K9M Q;  3RZO I;  1W2B Y;  2IZ3 A;  1YJ9 P;  3G29 A;  1VLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...