3CCEP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cceP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cceP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cceP02
3G4SP 1M90Q 1VQ7P 1VQOP 2QEXP 1JJ2O 3CMEP 3CC2P 3CPWO 1VQ8P 1YJNP 1VQNP 1M1KQ 3CCQP 3CC7P 1Q81Q 3CXCO 3CCSP 1VQMP 1W2BO 1QVFO 1VQLP 1KD1Q 3CCEP 3OW2O 1VQ5P 1YJWP 3CC4P 3CD6P 1KC8Q 1K8AQ 2OTJP 2QA4P 3CCJP 3G6EP 1QVGO 3I55P 3CCVP 1YJ9P 3G71P 3CCRP 1YITP 1NJIQ 1VQ9P 1K73Q 1VQKP 1YIJP 3CMAP 3I56P 1Q86Q 1VQ6P 1N8RQ 1YI2P 1S72P 2OTLP 3CCLP 3CCMP 1VQPP 1YHQP 1Q82Q 1K9MQ 1VQ4P 1KQSO 1Q7YQ 3CCUP
chains in the Genus database with same CATH superfamily
4WB4A 2LPKA 2KNCB 1Y8AA 3P05A 2N5IA 3H25A 1L0NK 1LWUC 3AEEC 3H4EA 5AVRB 1RE3C 2JGPA 1RE4A 4D6TE 3WMM0 1KILA 2ZXEB 1FC2C 1SVFA 3G9RA 4D6TD 3HZQA 3L35A 2LIUA 1QLED 1LT9B 3H1LE 3RK3C 1SQPK 1S4XA 3A5TA 2N1TB 1KC8Q 2WPVB 3MUDA 5TJHA 5AVXB 2POHA 1QL2A 2FXOA 1NGMB 4WYMA 1PPJE 2QNWA 2IBZE 1NAYA 5EW5E 4H44C 3WU2E 2L5GB 2K9JB 5CJ0A 1RH5B 2IBZD 3GF3A 2OYOA 3M0AA 1NTZD 1FZEA 3CCVP 1NU1G 2HODA 3FWNA 3VYIA 2L4BA 2W6BA 1VQ4P 2A06G 2NPSA 2PEOA 3F5HA 5KJ7D 1M90Q 3MTUE 1AV1A 3H1IJ 2B9BA 1E0HA 4KT0J 1NH4A 5F2NA 4IFMA 1FDMA 1S9KE 5H2FH 1L2PA 2FYUE 3B5ND 5APTA 5DJUB 3VN0A 1YITP 1S9KD 2QM8A 3MHVA 3TNUA 2WPRA 2HPCA 5DCKA 1AVOA 1ZR4A 1S5LH 5F2OA 1NTKE 3H1HG 3QWOC 3FXDA 5KLVG 3NXSA 4W7YA 1M6EX 2E74B 1L0NE 1FJKA 1SQQG 1NTKD 1P84E 5HGMA 2PENA 1M74A 2KOOA 1SS1A 2FVEA 2HG5D 3SWFA 4PV1B 2GDWA 3NMDA 4U3FE 1P84D 4GIFA 1GXHA 2YMYA 4BXLA 1L4AC 4NPEA 2N5HA 2ZYGA 3IF4A 5CCHC 5KAIH 3A0BH 2ZYDA 1ZMEC 2BCCE 2XU6A 2AXCA 4A7PA 3Q5PA 2XNXA 1X22A 3RG6C 1UIXA 1S1CX 3L74G 2NRGA 1X3OA 3DS2A 3HTKB 3RL0g 1LTAC 1URQC 2QEXP 2QSIA 2AEJA 1D1DA 2Q3EA 1NYHA 1SQPJ 1BCCJ 1L0LK 4DZOA 2K92A 2K94A 3JSVC 1NQ4A 2K2QA 4DOJA 3LRYA 2V7QJ 5HV8A 1NU1E 2PRRA 2FFDC 3MP7B 2KOSA 3H47A 2EHSA 1CZQA 2FYNB 3H1JE 1NU1D 2A06E 2PEIA 1AA0A 2A06D 3BATA 1BSHA 1FZCB 3HE5B 3SFDC 3U1AA 2DW3A 5CCGA 3W67A 5BS2A 4LLHA 2KI7B 2KK7A 2QJPC 4WWIA 2HYNA 2PP6A 3VMXA 5KLVE 2MR7A 1BGYG 3DS3A 2XT1A 1SFCB 4WBAA 1N7SA 1SQQE 1N73B 3H1HD 5KLVD 1QX8A 3EFFK 1M1JA 2A45I 1OX3A 4HH2A 1BXIA 3D6YA 2OYHB 1SQQD 1HH0A 2LIWA 3VRLC 2J59M 1JM0A 3M0DC 1EZVE 1LJ2A 2FHSC 1Z56A 1OVRA 1IFMA 2V7QH 4MRTC 5AW1B 1JY3N 2KSJA 2R3CA 4W7ZA 3MZWB 5APVA 2JWDA 3CX5I 1CI6A 2W27A 4IL6H 3MD0A 4H13B 2H88C 1LTTC 1SQBG 3CXHE 4GR2A 1FBMA 2O01H 3G1IA 3L74E 4K3AA 3PP5A 3L72G 3CXHD 5AW2B 2CQ8A 3GKLC 3L74D 4YTPC 5B5EH 1YJ9P 1Q90D 2E75B 3O6QA 2GUVA 4BRYA 4PD4H 1T2KC 4GKGA 4RJTA 3G4SP 2N9BA 2CNRA 2BHVA 3CWBG 1D7MA 2KS1A 1NAFA 1IMPA 4OGQB 4ZMDA 4AYCA 4WY4B 1EDLA 3HYBA 1S72P 2PY8A 1L0LJ 2Y9YA 2IPPA 2AXTH 4I7ZB 1GPJA 3G0VA 1RO0A 1GDTA 1OMIA 2GUSA 2EHTA 1U57A 1WT6A 2Q6QA 3RL0D 3MIWA 3G3ZA 2KUBA 2G8YA 2XKMA 3K5BA 1BGYE 1NTMK 5CBOA 1HGVA 2HR3A 1HWTC 2CPBA 1BGYD 2JQ4A 2ZFCA 3HD7D 2HPCB 5GTIE 1FOSF 3I55P 1AJYA 2JYLA 2M3BA 3B71A 3S4RA 5GTHH 1GL2A 1ZR2A 4COCA 2FVFA 2OYIB 1T3UA 1ZV8A 2ZAEB 3TGUJ 3GHGC 4PD4I 3H6PA 3Q20A 2FQ0A 2XZRA 2E76D 4TT3H 1X9VA 1S2EA 1J1EB 1SQBD 3L72E 5AW6B 3L75G 1T8KA 2P1JA 2Z5IA 3L72D 4IFDK 3H0DA 1EXIA 2K93A 4RESB 5APXA 3B5NB 2LKMA 3C8VA 2WSFJ 4Y99C 2IX7C 3CWBE 3H32B 4JBZA 1M8OB 3NTNA 2IYOA 3CWBD 3V2NA 2K0XA 2PEKA 1JJ2O 1JCDA 2PAJA 4DCKA 2QG4A 3AE8C 2C0XA 3E2DA 1LWUA 1EDKA 4UB6H 2ROQA 1KQFB 3PTZA 5AW3B 1HY8A 2Q9IA 1RE3A 1JCCA 5BU8B 2L0QA 3TSIA 2M0BA 1LTJB 4ZKUA 2VRSA 3WUVA 3L73E 3B8EB 1VQNP 3MGEA 4F37A 1KQLA 3HUSB 1XTCC 4NEOA 2FYZA 2QM7A 1K9MQ 1FZAA 1BE3G 3L70J 1A8OA 2L91A 2ZVOB 3BCCG 3SWYA 2MR8A 4PH0A 1LT9C 2N1TC 3PHLA 2KG8A 4DJGA 1SQXG 3N4XA 1JUNA 5KP6B 3CCUP 1SQVJ 2A45G 2M5AA 2WSCJ 1NTZK 3H1IG 3L75E 3CC7P 2BEZF 2VLOA 1Z6MA 4UB8E 1XTGB 3CD6P 5AVWB 3DS0A 2VLQA 3E1RA 3L75D 2E43A 1JY3O 1LTGC 3RGUA 2KODA 2WT7A 1KILD 1ZOYC 2KGEA 2JJLA 3T97B 1KMIZ 1KQSO 4TLFA 3H1KG 2FXMA 2G3AA 5KP8B 3AE6C 2N6ZA 4GODA 2PEJA 2AEFA 4BRYB 3S9OA 2GZIA 3WBHA 1L4AA 2JP3A 1K04A 3JC22 5K5GB 1NTKK 4GOEA 4N78D 5KKZB 5CCHA 5H2FE 2QRXA 3W68A 2E74C 4I1LA 3G71P 4H0LD 1J1DB 2WSCH 1IK9A 4PV1C 1ZN5A 2NPSD 3TDKA 1S5LE 4YXWH 2CPSA 3M06A 1FDOA 1URQA 2ZT9B 3CCQP 2P58A 4PXHB 3BVHA 2L6EA 1VF5D 1BE3E 1YJWP 1IK7A 2E5TA 1HTLC 3BCCE 1EMVA 1IFJA 1OWAA 1BE3D 1SQPG 1BCCG 4HKGA 3BCCD 1QGKB 1AQ5A 1L0HA 2FFDA 1NTZE 1HF9A 1SQXE 4D6TJ 5KAIE 1VQMP 1RF1B 2W90A 3L37A 1SQXD 2HFED 3H1IE 1QEXA 1AVYA 3TF5A 3U43A 3V2RA 2D2CD 3H1LJ 2PEQA 1K30A 3CCMP 3EJBA 3H1ID 3D6ZA 4M0IA 1YQ4C 2QIWA 3KZIH 1H8AA 1NU1K 2KYVA 4RKUJ 2H89C 5KLIB 1QVFO 3C9IA 3H1KE 3RL0B 3GLMA 2FYNC 4BPFA 1JTHB 3KHUA 4U7JA 3H1KD 3CX5D 1Q86Q 2OTLP 2KZJA 1FZCC 3RK2D 3HD7B 3M0DA 1H0TA 4L76A 3G26A 2B87A 4JF7A 3CI9A 3EJDA 2W8ZA 2YXRB 1LNQA 3TYYA 5KLVK 4XFXA 1RNIA 2JB0A 1SQQK 2FYUJ 2FQ1A 1SFCC 5AW8B 3AEAC 1N73C 2OYHC 2WPQA 2E76B 1IMQA 1KQGB 1NTKJ 1VPCA 3HE4B 2A45H 1A43A 2I1KA 1L0NJ 3PRJA 3I56P 1G2CA 1JB0J 1YI2P 3EJEA 5CCGD 3R2PA 3ZDMA 3Q3DA 3RK3B 1KFNA 2K1AA 4U3FJ 1BCCE 5AW7B 1Q2NA 4L73A 2KZIA 5KTBA 1EDIA 1M56D 4H13C 5APSA 1MFZA 3DS1A 3KDPB 1LP1B 2M8PA 1SQPD 1BCCD 3CX5H 1ZNVA 2AFEA 2I1JA 2PNGA 3EFGA 4I2LC 1N7SD 3CCRP 3ABVC 5APUA 5AVYB 3VOPA 4PJ0H 1NOHA 2ONTA 2BCCJ 4IL6E 4OVNF 2E75C 1JO5A 1E5WA 2K88A 2LF4A 2Z45A 1UIIA 2KGDA 5B5EE 2NZ2A 3NTEA 2P2UA 1KV4A 1VQ9P 4HKZH 1OIPA 2E42A 3P7KA 2IZ1A 4PD4E 4OGQC 4WY4C 1NO4A 2QJKB 4IFFA 1IUQA 4PD4D 2MF4A 3CXCO 4I7ZC 1OR5A 1PGJA 1NU1J 3RG2A 3H1HE 5AVQB 4XA4A 2ITAA 3H1JJ 2LMLA 1PP9G 1J2JB 1DNYA 4XROA 2IFNA 4XRQA 5AW5B 3G29A 3I5CA 2Z5HA 2AXTE 4JYCA 4JYBA 2CG5B 5C39A 1X79B 1PV3A 2N9YB 1GXGA 3TGUG 3BRTB 2J5UA 2Y0CA 1NKZB 3A0HH 5TISE 3IN6A 1VDFA 5KLVJ 2R32A 1USDA 3NFQA 1KORA 2AFDA 3GZMA 1HQBA 1M7LA 3EQ2A 2OYIC 2EG5A 4KJMA 3AEGC 2ZT9D 2KW2A 1X0TA 2Q7CA 2QA4P 3G6EP 3ITKA 1KILB 1SQBK 2K37A 1PL5A 5GTHE 3CCLP 1KB9H 2SPZA 3PJSK 5HVCA 1JY2N 3L4FA 1J1EC 2K0DX 5KJ7C 4N6JA 4NPFX 1FOSE 5JPAA 1QVGO 3B5NC 1NJIQ 3O8ZA 3Q1MA 1GL2D 3M9BA 3Q5SA 3V4WA 5EFWB 1JY3P 4WVZA 3JCUH 3B5IA 4IZ6A 4ASVA 3S1KA 4U0FA 2RMZA 2XXMA 3KYQA 3Q5RA 2HODB 1FU1A 4H0LB 2NO8A 2KNCA 1Y47A 2NPSB 4YXDC 2PEMA 1GD2E 2Z46A 1PP9E 1LTJC 1VF5B 1GMJA 1OVUA 2C0WA 3E7KA 3U1CA 1PP9D 3TNUB 4UB6E 5CBNA 2ZYAA 4O9BA 2FXPA 3IR9A 1LT9A 2M8NA 2N1TA 3HUSC 2FY8A 2R5BA 3L71G 3AE5C 3TGUD 1Q7YQ 2EFJA 2B87B 1SQVG 1KB9I 1R5LA 1BGYJ 1N7LA 2K9JA 4EOTA 1NKNA 1SQBE 2D2CB 4EIJA 1KN7A 3CLQA 2R44A 5CMZA 5M1BA 2JU2A 4GR6A 4DG9A 3RK3E 1IO4A 2XZ0D 5AW4B 2Y0EA 3RK3D 2AVAA 2WPTA 3P8CD 2ERHA 1F80D 1FJPA 4IPYA 3RK2B 1N8RQ 1DH3A 4H44D 1FR2A 3LIDA 2JKVA 2YO2A 2WZ7A 3L72J 3A7OA 1RF0C 1EZVI 2YXQB 2BQ1E 3M9HA 2KSEA 2MVUA 2KB7P 2Y9ZA 2L22A 2JO0A 1YQ3C 1NWQA 3II6A 3AE9C 2GA1A 3V2PA 1PGPA 1YTZT 2JBGA 4GT1A 4JPZB 3CWBJ 2GYKA 2O3JA 2P9XA 4PWVB 2DGYA 2MVVA 2V4HA 5B66H 3AEDC 5KKZC 1LTSC 2QE7H 1MV8A 4JQ0D 2Z4EA 2RN0A 2JR8A 2WPSA 1J1DC 1OW6A 2WSFH 1IFNA 3VP9A 2JYGA 3USSA 1LTBC 2JWAA 5KAFH 2P7JA 5AVZB 3HTKA 2GZJA 3L71E 1NTMJ 2YKQA 1KD1Q 1N7SB 5AVSB 1DEBA 2ZT9C 3L73J 1KYOH 1M1JB 1SQVE 3L71D 1GTWA 1PIXA 4OH8B 1L4AD 1SQVD 1USEA 3V2QA 1KFMA 3N7NA 2IZ0A 3H1LG 2WMMA 2OGUA 3KPEA 1QL1A 2XV5A 3UIAA 5EJDA 1BDDA 2FACA 2JEEA 5CCHD 1PPJG 3OA7A 4CA3A 1SQXK 1FE6A 2N98A 3DS4A 1CI6B 1KILE 4EDFA 2FBWC 1MKMA 1RF1C 1AF8A 2PFXA 1BDCA 3MGNA 5CJ4A 5APYA 3B4QA 1FAVA 1Q82Q 4LGDE 1FZCA 1URQD 3KXDA 2BASA 4U0CA 2LOLA 1M1KQ 3O6QB 2WSSH 3CCEP 2O1JA 1VQ5P 2J58A 1PGQA 5KLIC 3P32A 1VQKP 3L75J 3RL0C 4YPCA 1MFTA 1BSNA 1WRGA 2FQ2A 1SFCA 1LTIC 3OAKA 2WSEJ 4N78E 1ZLLA 1N73A 2FYUG 2KP8A 2KS1B 2KGAA 1ZRTE 1N2DC 1HVVA 2OYHA 1OZHA 3M9QA 2YKOA 3HD7C 1FZGA 1ZRTD 4R0MA 3EWKA 1K73Q 2LTEA 1KZUB 2QJYB 3VP8A 1L0NG 4NPDA 1KYOI 4HB1A 2X2BA 1EDJA 1H89A 2FADA 2XNDH 1A02F 4EYYQ 4U3FG 3B4SA 2P67A 3C1LA 3OW2O 4HYTB 2B89A 2VLPA 2E76C 2OARA 1PZQA 1VHNA 3KQGA 4L75A 2K5XA 3GJNA 2BCCG 3SFEC 2I8DA 3CPWO 1VQ8P 4W80A 4C7RA 1AQTA 4UB8H 1GU4A 1OXZA 3A0BE 2WSEH 2CK3H 2KOGA 1K8AQ 1GL2B 4H2XC 3H1LD 3R4YA 2OTKE 3FXEA 1BE3J 1YHQP 4WY4A 3BCCJ 1LT1A 1PPJD 1MZ9A 2VSQA 5HGOA 4L74A 3GG2A 2YIUB 3GF7A 1GU5A 3CX5E 1NTZJ 1JMMA 5E79H 1SQXJ 4PJ0E 1E6JP 2ZJSE 3H1JG 2WTYA 3AE2C 1T2KD 1OVVA 2R5DA 1M57D 4Z1MH 3FWLA 2QJKC 3G1GA 4ASWA 2GZEA 1CW5A 3A2AA 2FYUD 5CHXA 3H1KJ 1EC5A 1YYCA 1LWUB 1KLPA 4AQRD 2OYIA 2KG9A 4HJGH 3DS5A 1EXJA 2IDBA 1PEOA 1L0ND 2N50A 3RBZA 1M6NA 1ZMBA 1Y9BA 1EZVG 3CMAP 3AEBC 4U3FD 2M3EA 1JEKA 4R4MA 2KOPA 3WU2H 5KJ7A 1SQPE 3FX0A 1UJZA 4H2WC 2FVAA 3PH0A 1VQLP 2IYPA 4U0BA 2XDJA 2EIAA 3B5NA 3E1IA 2DNWA 2BCCD 1T6AA 3A0HE 4H44B 1RE4C 2GZGA 1KILC 2KG6A 1DV5A 5BU5A 3H32A 2W6JH 3CE7A 1L0LG 3QH9A 3CC2P 1R8EA 4U0EA 2C9LY 4N3YB 3MUDC 2CGQA 4RO0A 2H8PD 3U59A 2MD9A 4M3LA 3AEFC 1JNMA 1KB9E 2JU1A 2M5AB 1T3JA 1FS0E 2JDIH 1LTJA 3RBXA 1KB9D 3D70A 1Q81Q 1P84H 2GZFA 3LMOA 3FGAD 2WT7B 4GDOA 3H1JD 5AVVB 1LGHB 2O01J 2B88A 3G28A 4H0LC 3HUSA 1AUMA 3VMZA 3G21A 4C7NA 3V5BA 2L9FA 3JCUE 2NPSC 1OFCX 2FAEA 1PEUA 2IBZI 3GHGA 3SWKA 5I4TG 1JMBA 1GK6A 2M8RA 2QVAA 2R3SA 4ZNCA 5APWA 1HBWA 1OW7A 1VF5C 1L4AB 1VKUA 3P8MC 2LR2A 1GK4A 3GZLA 5AW0B 1ZXGA 2MY5A 3H1HJ 3BRVB 1RY3A 3LIEA 3GMAA 1SQQJ 7CEIA 4BPHA 3CCSP 3HRNA 2K3RA 4QMAA 3AE4C 1EZVD 2KXPB 4Y28J 2K0YA 4PH1A 4B86A 4K35A 3WUUA 1URQB 1H88A 2D2CC 1GW4A 2KLVA 3TK1A 2LL8A 2GDXA 3T97A 2Y0DA 4KHXA 1RF0A 1W2BO 2O01N 1N86A 2JAZA 2E1MA 1L0LE 4XFJA 5KP7B 4IOIH 2N1TD 1P84I 3L74J 1RQVA 2FFDB 1L0LD 3F89A 1PFIA 5AVTB 2OQQA 3IAOA 2ZVNB 5AVUB 3RK2C 2AF8A 4QNBA 1KTMA 2VLNA 3D71A 2KIKA 4XE5B 1DD3A 2LKIA 1NVOA 2OTJP 1IC2A 5F2KA 2XV6A 1EIAA 5AW9B 1MZ8A 1UNKA 1QRJA 2JO1A 1PEMA 2QJPB 2C9NY 2KOQA 3CL3D 2Q3IA 4GOFA 3L70G 1FZBA 2IFMA 1JY2P 1NTMG 2M5RA 3L73G 1YTZI 2KLUA 3TGUE 5TISH 2RH0A 1SLQA 5L8RJ 4CPGA 1H0TB 1K05A 2MKVA 1CSBA 5CCGC 5APQA 5BS1A 1EQ7A 1HJ0A 3CXHH 1AFOA 4LC1A 2WITA 3V6IA 2H43A 2E74D 1U7MA 3CCJP 5B66E 1PP9J 3DTJA 1R5SA 1RF1A 2Q1KA 1N7SC 1YBKA 1YIJP 1SQVK 3V4QA 4PV1D 1M1JC 1VL2A 2UWJE 2WWWA 1RHZB 3P8CE 5KAFE 1HJBA 1GZLA 1HGZA 1S5LX 1MUUA 1G2CB 1KYOE 5CZDB 2E5YA 4COPA 3Q2YA 2WQYC 4ZKPA 1KYOD 1JTHA 1SQBJ 2PGDA 4BPGA 2W6AA 3IFMA 1ZW0A 1FZFA 2W83C 3AE3C 1S3JA 1DIPA 1HUCA 1DX7A 1PGOA 2KR5A 3HD7A 2WVRA 1OW8A 2M8LA 4XFZA 2BUOA 2P10A 3BASA 3AECC 1EOQA 5DJTB 3M91A 2YMKA 3GW6A 2CWOA 3OJAB 1L0IA 4I6MC 2FKWB 4OWFA 3A3YB 2H7HA 3NY7B 1PEQA 3M1MA 3CXHI 3CC4P 5GTIH 1DEEG 2Q5UA 3DPHA 3L70E 3AE7C 5HGNA 1NTME 2YKPA 3HE4A 2GM4A 3L70D 1BAJA 2QJYC 1NTMD 1JOCA 4U0AA 2MJZA 2XZ1C 3L73D 1IFPA 1W5CE 4D6TG 2Z44A 4C7NB 2RKLA 2KGCA 1LP1A 3LW5J 2KORA 1VQ6P 4C46A 1SFCD 1NHLA 2O1KA 4UHPB 3GHGB 1VQ7P 1VQOP 3CMEP 1GW3A 3L36A 1E79H 2KWLA 4U0DA 3SSUA 4R4LA 2IBZG 1IFDA 1NTZG 3L71J 2BEQD 1GL2C 1RO2A 1TU3F 4EI2A 3VTPC 3VMYA 1SP4A 3HE5A 1AYIA 1YJNP 4H13D 1WMKA 4BWNA 4Y99B 4XFYA 1T8ZA 4MN4C 2YIUC 4H2YC 5HGLA 1CEIA 2LXCB 2K9YA 2LXBA 4DT0A 1IFIA 4AUWA 2E75D 1IJDB 3AE1C 1U7JA 3WUTA 2AEMA 1ACPA 2N6YA 1ZP0C 3KZIE 2YNYA 2ZXXA 1RQUA 3LW5H 1JY2O 2HLOA 4IL6X 1A02J 2YO3A 1DD4A 1IZNB 1G1JA 2FYUK 5E79E 3VMAA 1NTKG 1W2EA 4QKOA 1X8YA 4OGQD 2GDYA 4WY4D 1G1IA 1VQPP 5BVZA 1FDIA 3PLNA
chains in the Genus database with same CATH topology
1BAJA 2PEKA 1JJ2O 3G0VA 3CPWO 1VQ8P 1RO0A 4U0AA 1M6EX 5BS2A 3P05A 3CCSP 2LF4A 1QVFO 5HGMA 1VQLP 2PENA 2PEJA 2Z45A 4U0BA 3E2DA 1M74A 2Z44A 3DS4A 1K8AQ 2EIAA 3CCJP 5JPAA 1QVGO 3DS3A 2XT1A 3H4EA 4PH1A 3DTJA 3NTEA 1NJIQ 1VQ9P 4IPYA 1YIJP 1Q86Q 1VQ6P 1N8RQ 2OTLP 3WBHA 1YHQP 3B5IA 1Q82Q 3VRLC 1VQ7P 1VQOP 3CMEP 4U0FA 1IUQA 4U0CA 3CC2P 1VQNP 2XXMA 3HZQA 3MGEA 4U0EA 1M1KQ 5HGOA 3CXCO 3G26A 1W2BO 4U0DA 3CCEP 1VQ5P 2E1MA 1KC8Q 2BQ1E 3I55P 3G71P 2JYLA 2JO0A 4COPA 4XFXA 1VQKP 1RNIA 3RG6C 4WYMA 1E6JP 4XROA 4COCA 1RO2A 4XRQA 3DS2A 1K9MQ 2PEMA 3G29A 2QEXP 1A8OA 2Z46A 4QNBA 4GR2A 1YJNP 3G1IA 3CCQP 2P9XA 3Q20A 1Q81Q 2L6EA 4XFYA 2DGYA 1D1DA 3G1GA 2M8LA 1YJWP 2OTJP 5F2KA 3CCVP 4XFZA 2BUOA 1YJ9P 1A43A 4PH0A 2M8NA 2XV6A 1K73Q 1EIAA 3G28A 5HGLA 3I56P 1EOQA 1AUMA 1YI2P 3LRYA 3G21A 1QRJA 1VQ4P 2CWOA 1PEMA 2PEOA 1Q7YQ 3CCUP 3G4SP 1M90Q 2EFJA 2JYGA 3H47A 3H0DA 2BHVA 5F2NA 1PEUA 2EG5A 5I4TG 3DS5A 3CC7P 1VQMP 1PEOA 3DS1A 1PEQA 2PEIA 1KD1Q 3OW2O 2M8PA 3M1MA 3CC4P 3CD6P 3DS0A 2QA4P 3G6EP 3DPHA 3CCRP 1M6NA 1ZMBA 1YITP 2OARA 3CMAP 2KODA 5HGNA 3HYBA 5DCKA 2PEQA 5F2OA 1S72P 3CCLP 1K30A 4GR6A 3CCMP 2PY8A 2ONTA 1VQPP 4M0IA 1KQSO 5BS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S P;  1M90 Q;  1VQ7 P;  1VQO P;  2QEX P;  1JJ2 O;  3CME P;  3CC2 P;  3CPW O;  1VQ8 P;  1YJN P;  1VQN P;  1M1K Q;  3CCQ P;  3CC7 P;  1Q81 Q;  3CXC O;  3CCS P;  1VQM P;  1W2B O;  1QVF O;  1VQL P;  1KD1 Q;  3CCE P;  3OW2 O;  1VQ5 P;  1YJW P;  3CC4 P;  3CD6 P;  1KC8 Q;  1K8A Q;  2OTJ P;  2QA4 P;  3CCJ P;  3G6E P;  1QVG O;  3I55 P;  3CCV P;  1YJ9 P;  3G71 P;  3CCR P;  1YIT P;  1NJI Q;  1VQ9 P;  1K73 Q;  1VQK P;  1YIJ P;  3CMA P;  3I56 P;  1Q86 Q;  1VQ6 P;  1N8R Q;  1YI2 P;  1S72 P;  2OTL P;  3CCL P;  3CCM P;  1VQP P;  1YHQ P;  1Q82 Q;  1K9M Q;  1VQ4 P;  1KQS O;  1Q7Y Q;  3CCU P; 
#chains in the Genus database with same CATH topology
 4WB4 A;  2LPK A;  2KNC B;  1Y8A A;  3P05 A;  2N5I A;  3H25 A;  1L0N K;  1LWU C;  3AEE C;  3H4E A;  5AVR B;  1RE3 C;  2JGP A;  1RE4 A;  4D6T E;  3WMM 0;  1KIL A;  2ZXE B;  1FC2 C;  1SVF A;  3G9R A;  4D6T D;  3HZQ A;  3L35 A;  2LIU A;  1QLE D;  1LT9 B;  3H1L E;  3RK3 C;  1SQP K;  1S4X A;  3A5T A;  2N1T B;  1KC8 Q;  2WPV B;  3MUD A;  5TJH A;  5AVX B;  2POH A;  1QL2 A;  2FXO A;  1NGM B;  4WYM A;  1PPJ E;  2QNW A;  2IBZ E;  1NAY A;  5EW5 E;  4H44 C;  3WU2 E;  2L5G B;  2K9J B;  5CJ0 A;  1RH5 B;  2IBZ D;  3GF3 A;  2OYO A;  3M0A A;  1NTZ D;  1FZE A;  3CCV P;  1NU1 G;  2HOD A;  3FWN A;  3VYI A;  2L4B A;  2W6B A;  1VQ4 P;  2A06 G;  2NPS A;  2PEO A;  3F5H A;  5KJ7 D;  1M90 Q;  3MTU E;  1AV1 A;  3H1I J;  2B9B A;  1E0H A;  4KT0 J;  1NH4 A;  5F2N A;  4IFM A;  1FDM A;  1S9K E;  5H2F H;  1L2P A;  2FYU E;  3B5N D;  5APT A;  5DJU B;  3VN0 A;  1YIT P;  1S9K D;  2QM8 A;  3MHV A;  3TNU A;  2WPR A;  2HPC A;  5DCK A;  1AVO A;  1ZR4 A;  1S5L H;  5F2O A;  1NTK E;  3H1H G;  3QWO C;  3FXD A;  5KLV G;  3NXS A;  4W7Y A;  1M6E X;  2E74 B;  1L0N E;  1FJK A;  1SQQ G;  1NTK D;  1P84 E;  5HGM A;  2PEN A;  1M74 A;  2KOO A;  1SS1 A;  2FVE A;  2HG5 D;  3SWF A;  4PV1 B;  2GDW A;  3NMD A;  4U3F E;  1P84 D;  4GIF A;  1GXH A;  2YMY A;  4BXL A;  1L4A C;  4NPE A;  2N5H A;  2ZYG A;  3IF4 A;  5CCH C;  5KAI H;  3A0B H;  2ZYD A;  1ZME C;  2BCC E;  2XU6 A;  2AXC A;  4A7P A;  3Q5P A;  2XNX A;  1X22 A;  3RG6 C;  1UIX A;  1S1C X;  3L74 G;  2NRG A;  1X3O A;  3DS2 A;  3HTK B;  3RL0 g;  1LTA C;  1URQ C;  2QEX P;  2QSI A;  2AEJ A;  1D1D A;  2Q3E A;  1NYH A;  1SQP J;  1BCC J;  1L0L K;  4DZO A;  2K92 A;  2K94 A;  3JSV C;  1NQ4 A;  2K2Q A;  4DOJ A;  3LRY A;  2V7Q J;  5HV8 A;  1NU1 E;  2PRR A;  2FFD C;  3MP7 B;  2KOS A;  3H47 A;  2EHS A;  1CZQ A;  2FYN B;  3H1J E;  1NU1 D;  2A06 E;  2PEI A;  1AA0 A;  2A06 D;  3BAT A;  1BSH A;  1FZC B;  3HE5 B;  3SFD C;  3U1A A;  2DW3 A;  5CCG A;  3W67 A;  5BS2 A;  4LLH A;  2KI7 B;  2KK7 A;  2QJP C;  4WWI A;  2HYN A;  2PP6 A;  3VMX A;  5KLV E;  2MR7 A;  1BGY G;  3DS3 A;  2XT1 A;  1SFC B;  4WBA A;  1N7S A;  1SQQ E;  1N73 B;  3H1H D;  5KLV D;  1QX8 A;  3EFF K;  1M1J A;  2A45 I;  1OX3 A;  4HH2 A;  1BXI A;  3D6Y A;  2OYH B;  1SQQ D;  1HH0 A;  2LIW A;  3VRL C;  2J59 M;  1JM0 A;  3M0D C;  1EZV E;  1LJ2 A;  2FHS C;  1Z56 A;  1OVR A;  1IFM A;  2V7Q H;  4MRT C;  5AW1 B;  1JY3 N;  2KSJ A;  2R3C A;  4W7Z A;  3MZW B;  5APV A;  2JWD A;  3CX5 I;  1CI6 A;  2W27 A;  4IL6 H;  3MD0 A;  4H13 B;  2H88 C;  1LTT C;  1SQB G;  3CXH E;  4GR2 A;  1FBM A;  2O01 H;  3G1I A;  3L74 E;  4K3A A;  3PP5 A;  3L72 G;  3CXH D;  5AW2 B;  2CQ8 A;  3GKL C;  3L74 D;  4YTP C;  5B5E H;  1YJ9 P;  1Q90 D;  2E75 B;  3O6Q A;  2GUV A;  4BRY A;  4PD4 H;  1T2K C;  4GKG A;  4RJT A;  3G4S P;  2N9B A;  2CNR A;  2BHV A;  3CWB G;  1D7M A;  2KS1 A;  1NAF A;  1IMP A;  4OGQ B;  4ZMD A;  4AYC A;  4WY4 B;  1EDL A;  3HYB A;  1S72 P;  2PY8 A;  1L0L J;  2Y9Y A;  2IPP A;  2AXT H;  4I7Z B;  1GPJ A;  3G0V A;  1RO0 A;  1GDT A;  1OMI A;  2GUS A;  2EHT A;  1U57 A;  1WT6 A;  2Q6Q A;  3RL0 D;  3MIW A;  3G3Z A;  2KUB A;  2G8Y A;  2XKM A;  3K5B A;  1BGY E;  1NTM K;  5CBO A;  1HGV A;  2HR3 A;  1HWT C;  2CPB A;  1BGY D;  2JQ4 A;  2ZFC A;  3HD7 D;  2HPC B;  5GTI E;  1FOS F;  3I55 P;  1AJY A;  2JYL A;  2M3B A;  3B71 A;  3S4R A;  5GTH H;  1GL2 A;  1ZR2 A;  4COC A;  2FVF A;  2OYI B;  1T3U A;  1ZV8 A;  2ZAE B;  3TGU J;  3GHG C;  4PD4 I;  3H6P A;  3Q20 A;  2FQ0 A;  2XZR A;  2E76 D;  4TT3 H;  1X9V A;  1S2E A;  1J1E B;  1SQB D;  3L72 E;  5AW6 B;  3L75 G;  1T8K A;  2P1J A;  2Z5I A;  3L72 D;  4IFD K;  3H0D A;  1EXI A;  2K93 A;  4RES B;  5APX A;  3B5N B;  2LKM A;  3C8V A;  2WSF J;  4Y99 C;  2IX7 C;  3CWB E;  3H32 B;  4JBZ A;  1M8O B;  3NTN A;  2IYO A;  3CWB D;  3V2N A;  2K0X A;  2PEK A;  1JJ2 O;  1JCD A;  2PAJ A;  4DCK A;  2QG4 A;  3AE8 C;  2C0X A;  3E2D A;  1LWU A;  1EDK A;  4UB6 H;  2ROQ A;  1KQF B;  3PTZ A;  5AW3 B;  1HY8 A;  2Q9I A;  1RE3 A;  1JCC A;  5BU8 B;  2L0Q A;  3TSI A;  2M0B A;  1LTJ B;  4ZKU A;  2VRS A;  3WUV A;  3L73 E;  3B8E B;  1VQN P;  3MGE A;  4F37 A;  1KQL A;  3HUS B;  1XTC C;  4NEO A;  2FYZ A;  2QM7 A;  1K9M Q;  1FZA A;  1BE3 G;  3L70 J;  1A8O A;  2L91 A;  2ZVO B;  3BCC G;  3SWY A;  2MR8 A;  4PH0 A;  1LT9 C;  2N1T C;  3PHL A;  2KG8 A;  4DJG A;  1SQX G;  3N4X A;  1JUN A;  5KP6 B;  3CCU P;  1SQV J;  2A45 G;  2M5A A;  2WSC J;  1NTZ K;  3H1I G;  3L75 E;  3CC7 P;  2BEZ F;  2VLO A;  1Z6M A;  4UB8 E;  1XTG B;  3CD6 P;  5AVW B;  3DS0 A;  2VLQ A;  3E1R A;  3L75 D;  2E43 A;  1JY3 O;  1LTG C;  3RGU A;  2KOD A;  2WT7 A;  1KIL D;  1ZOY C;  2KGE A;  2JJL A;  3T97 B;  1KMI Z;  1KQS O;  4TLF A;  3H1K G;  2FXM A;  2G3A A;  5KP8 B;  3AE6 C;  2N6Z A;  4GOD A;  2PEJ A;  2AEF A;  4BRY B;  3S9O A;  2GZI A;  3WBH A;  1L4A A;  2JP3 A;  1K04 A;  3JC2 2;  5K5G B;  1NTK K;  4GOE A;  4N78 D;  5KKZ B;  5CCH A;  5H2F E;  2QRX A;  3W68 A;  2E74 C;  4I1L A;  3G71 P;  4H0L D;  1J1D B;  2WSC H;  1IK9 A;  4PV1 C;  1ZN5 A;  2NPS D;  3TDK A;  1S5L E;  4YXW H;  2CPS A;  3M06 A;  1FDO A;  1URQ A;  2ZT9 B;  3CCQ P;  2P58 A;  4PXH B;  3BVH A;  2L6E A;  1VF5 D;  1BE3 E;  1YJW P;  1IK7 A;  2E5T A;  1HTL C;  3BCC E;  1EMV A;  1IFJ A;  1OWA A;  1BE3 D;  1SQP G;  1BCC G;  4HKG A;  3BCC D;  1QGK B;  1AQ5 A;  1L0H A;  2FFD A;  1NTZ E;  1HF9 A;  1SQX E;  4D6T J;  5KAI E;  1VQM P;  1RF1 B;  2W90 A;  3L37 A;  1SQX D;  2HFE D;  3H1I E;  1QEX A;  1AVY A;  3TF5 A;  3U43 A;  3V2R A;  2D2C D;  3H1L J;  2PEQ A;  1K30 A;  3CCM P;  3EJB A;  3H1I D;  3D6Z A;  4M0I A;  1YQ4 C;  2QIW A;  3KZI H;  1H8A A;  1NU1 K;  2KYV A;  4RKU J;  2H89 C;  5KLI B;  1QVF O;  3C9I A;  3H1K E;  3RL0 B;  3GLM A;  2FYN C;  4BPF A;  1JTH B;  3KHU A;  4U7J A;  3H1K D;  3CX5 D;  1Q86 Q;  2OTL P;  2KZJ A;  1FZC C;  3RK2 D;  3HD7 B;  3M0D A;  1H0T A;  4L76 A;  3G26 A;  2B87 A;  4JF7 A;  3CI9 A;  3EJD A;  2W8Z A;  2YXR B;  1LNQ A;  3TYY A;  5KLV K;  4XFX A;  1RNI A;  2JB0 A;  1SQQ K;  2FYU J;  2FQ1 A;  1SFC C;  5AW8 B;  3AEA C;  1N73 C;  2OYH C;  2WPQ A;  2E76 B;  1IMQ A;  1KQG B;  1NTK J;  1VPC A;  3HE4 B;  2A45 H;  1A43 A;  2I1K A;  1L0N J;  3PRJ A;  3I56 P;  1G2C A;  1JB0 J;  1YI2 P;  3EJE A;  5CCG D;  3R2P A;  3ZDM A;  3Q3D A;  3RK3 B;  1KFN A;  2K1A A;  4U3F J;  1BCC E;  5AW7 B;  1Q2N A;  4L73 A;  2KZI A;  5KTB A;  1EDI A;  1M56 D;  4H13 C;  5APS A;  1MFZ A;  3DS1 A;  3KDP B;  1LP1 B;  2M8P A;  1SQP D;  1BCC D;  3CX5 H;  1ZNV A;  2AFE A;  2I1J A;  2PNG A;  3EFG A;  4I2L C;  1N7S D;  3CCR P;  3ABV C;  5APU A;  5AVY B;  3VOP A;  4PJ0 H;  1NOH A;  2ONT A;  2BCC J;  4IL6 E;  4OVN F;  2E75 C;  1JO5 A;  1E5W A;  2K88 A;  2LF4 A;  2Z45 A;  1UII A;  2KGD A;  5B5E E;  2NZ2 A;  3NTE A;  2P2U A;  1KV4 A;  1VQ9 P;  4HKZ H;  1OIP A;  2E42 A;  3P7K A;  2IZ1 A;  4PD4 E;  4OGQ C;  4WY4 C;  1NO4 A;  2QJK B;  4IFF A;  1IUQ A;  4PD4 D;  2MF4 A;  3CXC O;  4I7Z C;  1OR5 A;  1PGJ A;  1NU1 J;  3RG2 A;  3H1H E;  5AVQ B;  4XA4 A;  2ITA A;  3H1J J;  2LML A;  1PP9 G;  1J2J B;  1DNY A;  4XRO A;  2IFN A;  4XRQ A;  5AW5 B;  3G29 A;  3I5C A;  2Z5H A;  2AXT E;  4JYC A;  4JYB A;  2CG5 B;  5C39 A;  1X79 B;  1PV3 A;  2N9Y B;  1GXG A;  3TGU G;  3BRT B;  2J5U A;  2Y0C A;  1NKZ B;  3A0H H;  5TIS E;  3IN6 A;  1VDF A;  5KLV J;  2R32 A;  1USD A;  3NFQ A;  1KOR A;  2AFD A;  3GZM A;  1HQB A;  1M7L A;  3EQ2 A;  2OYI C;  2EG5 A;  4KJM A;  3AEG C;  2ZT9 D;  2KW2 A;  1X0T A;  2Q7C A;  2QA4 P;  3G6E P;  3ITK A;  1KIL B;  1SQB K;  2K37 A;  1PL5 A;  5GTH E;  3CCL P;  1KB9 H;  2SPZ A;  3PJS K;  5HVC A;  1JY2 N;  3L4F A;  1J1E C;  2K0D X;  5KJ7 C;  4N6J A;  4NPF X;  1FOS E;  5JPA A;  1QVG O;  3B5N C;  1NJI Q;  3O8Z A;  3Q1M A;  1GL2 D;  3M9B A;  3Q5S A;  3V4W A;  5EFW B;  1JY3 P;  4WVZ A;  3JCU H;  3B5I A;  4IZ6 A;  4ASV A;  3S1K A;  4U0F A;  2RMZ A;  2XXM A;  3KYQ A;  3Q5R A;  2HOD B;  1FU1 A;  4H0L B;  2NO8 A;  2KNC A;  1Y47 A;  2NPS B;  4YXD C;  2PEM A;  1GD2 E;  2Z46 A;  1PP9 E;  1LTJ C;  1VF5 B;  1GMJ A;  1OVU A;  2C0W A;  3E7K A;  3U1C A;  1PP9 D;  3TNU B;  4UB6 E;  5CBN A;  2ZYA A;  4O9B A;  2FXP A;  3IR9 A;  1LT9 A;  2M8N A;  2N1T A;  3HUS C;  2FY8 A;  2R5B A;  3L71 G;  3AE5 C;  3TGU D;  1Q7Y Q;  2EFJ A;  2B87 B;  1SQV G;  1KB9 I;  1R5L A;  1BGY J;  1N7L A;  2K9J A;  4EOT A;  1NKN A;  1SQB E;  2D2C B;  4EIJ A;  1KN7 A;  3CLQ A;  2R44 A;  5CMZ A;  5M1B A;  2JU2 A;  4GR6 A;  4DG9 A;  3RK3 E;  1IO4 A;  2XZ0 D;  5AW4 B;  2Y0E A;  3RK3 D;  2AVA A;  2WPT A;  3P8C D;  2ERH A;  1F80 D;  1FJP A;  4IPY A;  3RK2 B;  1N8R Q;  1DH3 A;  4H44 D;  1FR2 A;  3LID A;  2JKV A;  2YO2 A;  2WZ7 A;  3L72 J;  3A7O A;  1RF0 C;  1EZV I;  2YXQ B;  2BQ1 E;  3M9H A;  2KSE A;  2MVU A;  2KB7 P;  2Y9Z A;  2L22 A;  2JO0 A;  1YQ3 C;  1NWQ A;  3II6 A;  3AE9 C;  2GA1 A;  3V2P A;  1PGP A;  1YTZ T;  2JBG A;  4GT1 A;  4JPZ B;  3CWB J;  2GYK A;  2O3J A;  2P9X A;  4PWV B;  2DGY A;  2MVV A;  2V4H A;  5B66 H;  3AED C;  5KKZ C;  1LTS C;  2QE7 H;  1MV8 A;  4JQ0 D;  2Z4E A;  2RN0 A;  2JR8 A;  2WPS A;  1J1D C;  1OW6 A;  2WSF H;  1IFN A;  3VP9 A;  2JYG A;  3USS A;  1LTB C;  2JWA A;  5KAF H;  2P7J A;  5AVZ B;  3HTK A;  2GZJ A;  3L71 E;  1NTM J;  2YKQ A;  1KD1 Q;  1N7S B;  5AVS B;  1DEB A;  2ZT9 C;  3L73 J;  1KYO H;  1M1J B;  1SQV E;  3L71 D;  1GTW A;  1PIX A;  4OH8 B;  1L4A D;  1SQV D;  1USE A;  3V2Q A;  1KFM A;  3N7N A;  2IZ0 A;  3H1L G;  2WMM A;  2OGU A;  3KPE A;  1QL1 A;  2XV5 A;  3UIA A;  5EJD A;  1BDD A;  2FAC A;  2JEE A;  5CCH D;  1PPJ G;  3OA7 A;  4CA3 A;  1SQX K;  1FE6 A;  2N98 A;  3DS4 A;  1CI6 B;  1KIL E;  4EDF A;  2FBW C;  1MKM A;  1RF1 C;  1AF8 A;  2PFX A;  1BDC A;  3MGN A;  5CJ4 A;  5APY A;  3B4Q A;  1FAV A;  1Q82 Q;  4LGD E;  1FZC A;  1URQ D;  3KXD A;  2BAS A;  4U0C A;  2LOL A;  1M1K Q;  3O6Q B;  2WSS H;  3CCE P;  2O1J A;  1VQ5 P;  2J58 A;  1PGQ A;  5KLI C;  3P32 A;  1VQK P;  3L75 J;  3RL0 C;  4YPC A;  1MFT A;  1BSN A;  1WRG A;  2FQ2 A;  1SFC A;  1LTI C;  3OAK A;  2WSE J;  4N78 E;  1ZLL A;  1N73 A;  2FYU G;  2KP8 A;  2KS1 B;  2KGA A;  1ZRT E;  1N2D C;  1HVV A;  2OYH A;  1OZH A;  3M9Q A;  2YKO A;  3HD7 C;  1FZG A;  1ZRT D;  4R0M A;  3EWK A;  1K73 Q;  2LTE A;  1KZU B;  2QJY B;  3VP8 A;  1L0N G;  4NPD A;  1KYO I;  4HB1 A;  2X2B A;  1EDJ A;  1H89 A;  2FAD A;  2XND H;  1A02 F;  4EYY Q;  4U3F G;  3B4S A;  2P67 A;  3C1L A;  3OW2 O;  4HYT B;  2B89 A;  2VLP A;  2E76 C;  2OAR A;  1PZQ A;  1VHN A;  3KQG A;  4L75 A;  2K5X A;  3GJN A;  2BCC G;  3SFE C;  2I8D A;  3CPW O;  1VQ8 P;  4W80 A;  4C7R A;  1AQT A;  4UB8 H;  1GU4 A;  1OXZ A;  3A0B E;  2WSE H;  2CK3 H;  2KOG A;  1K8A Q;  1GL2 B;  4H2X C;  3H1L D;  3R4Y A;  2OTK E;  3FXE A;  1BE3 J;  1YHQ P;  4WY4 A;  3BCC J;  1LT1 A;  1PPJ D;  1MZ9 A;  2VSQ A;  5HGO A;  4L74 A;  3GG2 A;  2YIU B;  3GF7 A;  1GU5 A;  3CX5 E;  1NTZ J;  1JMM A;  5E79 H;  1SQX J;  4PJ0 E;  1E6J P;  2ZJS E;  3H1J G;  2WTY A;  3AE2 C;  1T2K D;  1OVV A;  2R5D A;  1M57 D;  4Z1M H;  3FWL A;  2QJK C;  3G1G A;  4ASW A;  2GZE A;  1CW5 A;  3A2A A;  2FYU D;  5CHX A;  3H1K J;  1EC5 A;  1YYC A;  1LWU B;  1KLP A;  4AQR D;  2OYI A;  2KG9 A;  4HJG H;  3DS5 A;  1EXJ A;  2IDB A;  1PEO A;  1L0N D;  2N50 A;  3RBZ A;  1M6N A;  1ZMB A;  1Y9B A;  1EZV G;  3CMA P;  3AEB C;  4U3F D;  2M3E A;  1JEK A;  4R4M A;  2KOP A;  3WU2 H;  5KJ7 A;  1SQP E;  3FX0 A;  1UJZ A;  4H2W C;  2FVA A;  3PH0 A;  1VQL P;  2IYP A;  4U0B A;  2XDJ A;  2EIA A;  3B5N A;  3E1I A;  2DNW A;  2BCC D;  1T6A A;  3A0H E;  4H44 B;  1RE4 C;  2GZG A;  1KIL C;  2KG6 A;  1DV5 A;  5BU5 A;  3H32 A;  2W6J H;  3CE7 A;  1L0L G;  3QH9 A;  3CC2 P;  1R8E A;  4U0E A;  2C9L Y;  4N3Y B;  3MUD C;  2CGQ A;  4RO0 A;  2H8P D;  3U59 A;  2MD9 A;  4M3L A;  3AEF C;  1JNM A;  1KB9 E;  2JU1 A;  2M5A B;  1T3J A;  1FS0 E;  2JDI H;  1LTJ A;  3RBX A;  1KB9 D;  3D70 A;  1Q81 Q;  1P84 H;  2GZF A;  3LMO A;  3FGA D;  2WT7 B;  4GDO A;  3H1J D;  5AVV B;  1LGH B;  2O01 J;  2B88 A;  3G28 A;  4H0L C;  3HUS A;  1AUM A;  3VMZ A;  3G21 A;  4C7N A;  3V5B A;  2L9F A;  3JCU E;  2NPS C;  1OFC X;  2FAE A;  1PEU A;  2IBZ I;  3GHG A;  3SWK A;  5I4T G;  1JMB A;  1GK6 A;  2M8R A;  2QVA A;  2R3S A;  4ZNC A;  5APW A;  1HBW A;  1OW7 A;  1VF5 C;  1L4A B;  1VKU A;  3P8M C;  2LR2 A;  1GK4 A;  3GZL A;  5AW0 B;  1ZXG A;  2MY5 A;  3H1H J;  3BRV B;  1RY3 A;  3LIE A;  3GMA A;  1SQQ J;  7CEI A;  4BPH A;  3CCS P;  3HRN A;  2K3R A;  4QMA A;  3AE4 C;  1EZV D;  2KXP B;  4Y28 J;  2K0Y A;  4PH1 A;  4B86 A;  4K35 A;  3WUU A;  1URQ B;  1H88 A;  2D2C C;  1GW4 A;  2KLV A;  3TK1 A;  2LL8 A;  2GDX A;  3T97 A;  2Y0D A;  4KHX A;  1RF0 A;  1W2B O;  2O01 N;  1N86 A;  2JAZ A;  2E1M A;  1L0L E;  4XFJ A;  5KP7 B;  4IOI H;  2N1T D;  1P84 I;  3L74 J;  1RQV A;  2FFD B;  1L0L D;  3F89 A;  1PFI A;  5AVT B;  2OQQ A;  3IAO A;  2ZVN B;  5AVU B;  3RK2 C;  2AF8 A;  4QNB A;  1KTM A;  2VLN A;  3D71 A;  2KIK A;  4XE5 B;  1DD3 A;  2LKI A;  1NVO A;  2OTJ P;  1IC2 A;  5F2K A;  2XV6 A;  1EIA A;  5AW9 B;  1MZ8 A;  1UNK A;  1QRJ A;  2JO1 A;  1PEM A;  2QJP B;  2C9N Y;  2KOQ A;  3CL3 D;  2Q3I A;  4GOF A;  3L70 G;  1FZB A;  2IFM A;  1JY2 P;  1NTM G;  2M5R A;  3L73 G;  1YTZ I;  2KLU A;  3TGU E;  5TIS H;  2RH0 A;  1SLQ A;  5L8R J;  4CPG A;  1H0T B;  1K05 A;  2MKV A;  1CSB A;  5CCG C;  5APQ A;  5BS1 A;  1EQ7 A;  1HJ0 A;  3CXH H;  1AFO A;  4LC1 A;  2WIT A;  3V6I A;  2H43 A;  2E74 D;  1U7M A;  3CCJ P;  5B66 E;  1PP9 J;  3DTJ A;  1R5S A;  1RF1 A;  2Q1K A;  1N7S C;  1YBK A;  1YIJ P;  1SQV K;  3V4Q A;  4PV1 D;  1M1J C;  1VL2 A;  2UWJ E;  2WWW A;  1RHZ B;  3P8C E;  5KAF E;  1HJB A;  1GZL A;  1HGZ A;  1S5L X;  1MUU A;  1G2C B;  1KYO E;  5CZD B;  2E5Y A;  4COP A;  3Q2Y A;  2WQY C;  4ZKP A;  1KYO D;  1JTH A;  1SQB J;  2PGD A;  4BPG A;  2W6A A;  3IFM A;  1ZW0 A;  1FZF A;  2W83 C;  3AE3 C;  1S3J A;  1DIP A;  1HUC A;  1DX7 A;  1PGO A;  2KR5 A;  3HD7 A;  2WVR A;  1OW8 A;  2M8L A;  4XFZ A;  2BUO A;  2P10 A;  3BAS A;  3AEC C;  1EOQ A;  5DJT B;  3M91 A;  2YMK A;  3GW6 A;  2CWO A;  3OJA B;  1L0I A;  4I6M C;  2FKW B;  4OWF A;  3A3Y B;  2H7H A;  3NY7 B;  1PEQ A;  3M1M A;  3CXH I;  3CC4 P;  5GTI H;  1DEE G;  2Q5U A;  3DPH A;  3L70 E;  3AE7 C;  5HGN A;  1NTM E;  2YKP A;  3HE4 A;  2GM4 A;  3L70 D;  1BAJ A;  2QJY C;  1NTM D;  1JOC A;  4U0A A;  2MJZ A;  2XZ1 C;  3L73 D;  1IFP A;  1W5C E;  4D6T G;  2Z44 A;  4C7N B;  2RKL A;  2KGC A;  1LP1 A;  3LW5 J;  2KOR A;  1VQ6 P;  4C46 A;  1SFC D;  1NHL A;  2O1K A;  4UHP B;  3GHG B;  1VQ7 P;  1VQO P;  3CME P;  1GW3 A;  3L36 A;  1E79 H;  2KWL A;  4U0D A;  3SSU A;  4R4L A;  2IBZ G;  1IFD A;  1NTZ G;  3L71 J;  2BEQ D;  1GL2 C;  1RO2 A;  1TU3 F;  4EI2 A;  3VTP C;  3VMY A;  1SP4 A;  3HE5 A;  1AYI A;  1YJN P;  4H13 D;  1WMK A;  4BWN A;  4Y99 B;  4XFY A;  1T8Z A;  4MN4 C;  2YIU C;  4H2Y C;  5HGL A;  1CEI A;  2LXC B;  2K9Y A;  2LXB A;  4DT0 A;  1IFI A;  4AUW A;  2E75 D;  1IJD B;  3AE1 C;  1U7J A;  3WUT A;  2AEM A;  1ACP A;  2N6Y A;  1ZP0 C;  3KZI E;  2YNY A;  2ZXX A;  1RQU A;  3LW5 H;  1JY2 O;  2HLO A;  4IL6 X;  1A02 J;  2YO3 A;  1DD4 A;  1IZN B;  1G1J A;  2FYU K;  5E79 E;  3VMA A;  1NTK G;  1W2E A;  4QKO A;  1X8Y A;  4OGQ D;  2GDY A;  4WY4 D;  1G1I A;  1VQP P;  5BVZ A;  1FDI A;  3PLN A; 
#chains in the Genus database with same CATH homology
 1BAJ A;  2PEK A;  1JJ2 O;  3G0V A;  3CPW O;  1VQ8 P;  1RO0 A;  4U0A A;  1M6E X;  5BS2 A;  3P05 A;  3CCS P;  2LF4 A;  1QVF O;  5HGM A;  1VQL P;  2PEN A;  2PEJ A;  2Z45 A;  4U0B A;  3E2D A;  1M74 A;  2Z44 A;  3DS4 A;  1K8A Q;  2EIA A;  3CCJ P;  5JPA A;  1QVG O;  3DS3 A;  2XT1 A;  3H4E A;  4PH1 A;  3DTJ A;  3NTE A;  1NJI Q;  1VQ9 P;  4IPY A;  1YIJ P;  1Q86 Q;  1VQ6 P;  1N8R Q;  2OTL P;  3WBH A;  1YHQ P;  3B5I A;  1Q82 Q;  3VRL C;  1VQ7 P;  1VQO P;  3CME P;  4U0F A;  1IUQ A;  4U0C A;  3CC2 P;  1VQN P;  2XXM A;  3HZQ A;  3MGE A;  4U0E A;  1M1K Q;  5HGO A;  3CXC O;  3G26 A;  1W2B O;  4U0D A;  3CCE P;  1VQ5 P;  2E1M A;  1KC8 Q;  2BQ1 E;  3I55 P;  3G71 P;  2JYL A;  2JO0 A;  4COP A;  4XFX A;  1VQK P;  1RNI A;  3RG6 C;  4WYM A;  1E6J P;  4XRO A;  4COC A;  1RO2 A;  4XRQ A;  3DS2 A;  1K9M Q;  2PEM A;  3G29 A;  2QEX P;  1A8O A;  2Z46 A;  4QNB A;  4GR2 A;  1YJN P;  3G1I A;  3CCQ P;  2P9X A;  3Q20 A;  1Q81 Q;  2L6E A;  4XFY A;  2DGY A;  1D1D A;  3G1G A;  2M8L A;  1YJW P;  2OTJ P;  5F2K A;  3CCV P;  4XFZ A;  2BUO A;  1YJ9 P;  1A43 A;  4PH0 A;  2M8N A;  2XV6 A;  1K73 Q;  1EIA A;  3G28 A;  5HGL A;  3I56 P;  1EOQ A;  1AUM A;  1YI2 P;  3LRY A;  3G21 A;  1QRJ A;  1VQ4 P;  2CWO A;  1PEM A;  2PEO A;  1Q7Y Q;  3CCU P;  3G4S P;  1M90 Q;  2EFJ A;  2JYG A;  3H47 A;  3H0D A;  2BHV A;  5F2N A;  1PEU A;  2EG5 A;  5I4T G;  3DS5 A;  3CC7 P;  1VQM P;  1PEO A;  3DS1 A;  1PEQ A;  2PEI A;  1KD1 Q;  3OW2 O;  2M8P A;  3M1M A;  3CC4 P;  3CD6 P;  3DS0 A;  2QA4 P;  3G6E P;  3DPH A;  3CCR P;  1M6N A;  1ZMB A;  1YIT P;  2OAR A;  3CMA P;  2KOD A;  5HGN A;  3HYB A;  5DCK A;  2PEQ A;  5F2O A;  1S72 P;  3CCL P;  1K30 A;  4GR6 A;  3CCM P;  2PY8 A;  2ONT A;  1VQP P;  4M0I A;  1KQS O;  5BS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...