3CCEP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cceP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cceP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cceP02
1M1KQ 1VQ5P 3I55P 1N8RQ 1VQ8P 1VQLP 3CCUP 1VQKP 1K8AQ 3OW2O 1YJNP 1QVFO 3CPWO 1Q81Q 1NJIQ 3CCMP 1VQNP 3G4SP 1VQ4P 1YHQP 1KD1Q 3CC2P 3CC7P 3CCEP 1JJ2O 3CD6P 2OTJP 3CCLP 1VQPP 2OTLP 1VQ6P 3CXCO 1YITP 1QVGO 1W2BO 3G6EP 3CCQP 3CMEP 1M90Q 3CCSP 3CC4P 2QEXP 3I56P 3CCJP 1VQOP 1YJWP 2QA4P 1S72P 3G71P 1K9MQ 1VQMP 1Q86Q 3CCRP 1VQ7P 3CMAP 1YIJP 1VQ9P 1YJ9P 1K73Q 1YI2P 1KC8Q 3CCVP 1KQSO 1Q82Q 1Q7YQ
chains in the Genus database with same CATH superfamily
2FXMA 4EYYQ 1KILD 2E75D 4RESB 2CG5B 1MFTA 2KS1B 1RF0C 2M8LA 1S5LX 2N50A 4XFXA 1KYOD 3AE7C 1EC5A 2J58A 2KYVA 1Y8AA 4L73A 1VQMP 3HUSA 3CCRP 2WSCJ 2P7JA 3HE4A 2MR8A 1JY3O 3L72J 2AFEA 1OW6A 1BE3G 3PHLA 1E6JP 5AVSB 1BCCG 3RG2A 1PZQA 3AE4C 2Q1KA 3Q20A 4GDOA 3KHUA 2K88A 1E0HA 1OXZA 1PPJD 3AEEC 2VLNA 1YIJP 2JWDA 5KLVG 3V2RA 2FVAA 3H6PA 2N1TA 3HD7C 1U7JA 3M91A 1PEMA 5E79H 2JDIH 3KYQA 1FE6A 2PGDA 4PJ0E 2HPCB 1PIXA 1PEOA 2E74D 5L8RJ 1M56D 1YBKA 3P05A 4H0LD 1LWUB 2WTYA 4WY4D 2IFMA 2RKLA 3A3YB 1KQLA 2Q5UA 1FDOA 3L70G 1AV1A 1SFCB 1L0LK 4LC1A 3L71D 4GR2A 3L71E 2A06D 2A06E 1JTHB 1KILA 4WVZA 4GOEA 2QSIA 3O6QA 1NO4A 1LT9A 3H1JG 1RO0A 2JBGA 7CEIA 1FZCA 1IFPA 3RK3D 3RK3E 2V7QH 4D6TD 2KOGA 3CCMP 4BRYA 2QJPC 2NPSD 1EDJA 1G1IA 4PD4E 2GUSA 3MGEA 2EIAA 3II6A 1GU4A 2OYIA 3H1ID 1IFDA 3D6YA 3H1HJ 2XV5A 1H89A 1N8RQ 3FX0A 1K8AQ 1N7LA 3KZIE 1QVFO 2O1JA 3RK2B 3M9HA 1CI6B 2LOLA 3UIAA 4KHXA 4HYTB 1HJ0A 1W2EA 1XTCC 5AW8B 2C9LY 1RE3A 1R8EA 2QNWA 5APVA 2KGAA 1NTKK 2GZGA 3HYBA 1GL2B 1MV8A 3W67A 2H8PD 3A5TA 4TLFA 5K5GB 4PV1C 2Y9ZA 1RNIA 1X79B 1L2PA 3Q5RA 1VQ4P 2H88C 1NU1D 3EFGA 1KYOI 3H1KG 2LL8A 1SS1A 4WY4A 2GZFA 5HGOA 1E5WA 2Z5HA 2K37A 1VF5B 3C8VA 1W5CE 3VMYA 5APUA 3VN0A 4K3AA 3OW2O 3VYIA 1ZN5A 3GW6A 1HY8A 1AQTA 1KORA 1M1JC 2FYUJ 3VTPC 4C7NB 2M8PA 2NPSA 4HH2A 5KP7B 4JYCA 3B5ND 1NKZB 3LW5J 2HPCA 4U0CA 1ZP0C 4NPEA 3L75D 3L75E 4K35A 1L0LG 2PY8A 2MKVA 2OYOA 2QEXP 3H1LD 2W6JH 3H1LE 4PJ0H 1FAVA 2OYHC 3GMAA 2AFDA 1JB0J 3LMOA 5CCHC 1JCDA 1BAJA 3M1MA 1DV5A 1JTHA 1RH5B 4I2LC 5HGMA 2ZAEB 3CL3D 2YIUB 3U1AA 1NTMJ 2IDBA 2GUVA 4KT0J 1Q90D 5AW7B 1EZVD 5CCGD 2FVFA 2BCCJ 1AVYA 3BRVB 3BASA 2ZYGA 4GKGA 3GHGC 2E76D 2RMZA 2Q6QA 2N9YB 3L35A 3SFDC 4PD4I 1EDLA 5H2FE 2IYPA 1SQXK 4PD4H 2ONTA 3CLQA 2FFDC 4R0MA 3CCVP 2QE7H 2G3AA 5KLIC 4JQ0D 2XKMA 5KAFE 4LLHA 2Z45A 4XROA 1J1EB 4H44C 3OJAB 2HG5D 2AXTE 3B5NA 3L72E 2CPSA 4W7ZA 1DEEG 5APQA 2OTKE 5APXA 2HFED 4L76A 4NPFX 4OWFA 5HVCA 2L91A 2K0XA 2M5AB 3M0DA 3N4XA 2SPZA 1YITP 1M6NA 1PGQA 2XU6A 1RHZB 5CMZA 5AW1B 2B87A 1OVUA 5KTBA 4C7RA 1L0NK 2PEJA 1BE3J 3TF5A 2LF4A 5AVYB 1BCCJ 1AYIA 2RN0A 5CCGA 1LTJC 1T3JA 2W83C 1RO2A 4QKOA 1IFIA 1HJBA 3QH9A 2JU1A 1MFZA 3WBHA 5KLVJ 3KQGA 1J1DB 3E2DA 1FS0E 1VQLP 3B8EB 1OX3A 1SQQK 2P1JA 5AW0B 5AVWB 3HD7D 1RQVA 2YMKA 1FR2A 3AE5C 3RGUA 4XE5B 3L74G 3G21A 4EOTA 1SQBD 1P84H 1KB9E 2P67A 2BASA 2CWOA 3V2PA 1L4AB 2Z44A 2X2BA 3L70J 4BPFA 1SVFA 4U0BA 1FZGA 3M0AA 3H1HE 1N73C 2NO8A 5BS2A 4DOJA 3RBZA 1K9MQ 2IPPA 3B4QA 2A45I 2O01N 1RF0A 1SQXG 1EZVI 1NAYA 3H1JJ 1BDDA 3HUSB 2O01H 3D6ZA 2Q7CA 3HE4B 1DD3A 1WT6A 3GZMA 4OGQB 3AE2C 2JYLA 4N3YB 4DT0A 4Z1MH 2GM4A 3RL0B 3PLNA 5H2FH 1T3UA 1G2CA 1Q81Q 4R4LA 2E5TA 2IBZG 3Q1MA 2CQ8A 2QJKC 1T2KC 2KOQA 3HD7A 3LRYA 2WPTA 2FAEA 2WSCH 2AXTH 3L4FA 1GXGA 1WMKA 2ZFCA 1WRGA 2NRGA 2M5AA 4PV1D 2PENA 3HZQA 1L0NG 3CX5H 2D2CB 1ZV8A 3OA7A 2FYUE 3CCSP 3VMXA 3H1KJ 3GG2A 4L75A 1ZOYC 2AXCA 1RY3A 2K9JA 2I8DA 1KILB 2E75B 2E76C 5AVUB 3O6QB 1LT9B 2M3EA 1SQQG 1YTZI 1AA0A 1IK9A 2KR5A 1FZCB 2CPBA 1S5LE 2XNDH 4BRYB 3V4QA 3T97A 1M6EX 3GHGB 2ZYAA 2DW3A 2K3RA 1JY3P 1SQVD 5CHXA 4PWVB 3G1GA 3CCUP 2OYIB 2K0YA 1NTME 1SQPD 2JWAA 2JKVA 1IK7A 2BCCD 3B4SA 2BCCE 1L0LJ 1YTZT 5AVXB 2JO1A 1VL2A 2EHTA 3GZLA 2W90A 1KC8Q 1TU3F 1M74A 5GTIE 5CCHD 3E1IA 1KB9H 1L0IA 5I4TG 3TK1A 1URQC 4R4MA 2MR7A 1JY2N 3KXDA 2E74B 4IOIH 3TNUA 1NU1K 2R5BA 1MZ9A 1ACPA 2WSSH 2YNYA 4H0LB 2XXMA 3M06A 1D1DA 1PPJG 5AW2B 4WY4B 1PV3A 3MIWA 1LGHB 2QJYB 2M8RA 4I7ZC 1YHQP 3CCEP 4EDFA 2PEKA 4W7YA 3MUDC 4BXLA 2N6YA 2Q3EA 1YJWP 2QA4P 1R5SA 4JYBA 2FYNC 2H89C 5JPAA 5AW3B 1NTKJ 3NFQA 4MN4C 1S3JA 3RK3B 1VQ8P 2NPSB 1M1JA 3VMZA 3FGAD 4H44D 1KFMA 1HUCA 4U3FJ 1BE3E 4COCA 1K73Q 1BCCE 3JCUH 5KJ7C 2W6BA 2L6EA 5EJDA 2ZYDA 1S1CX 2JAZA 3EJDA 1JUNA 1ZLLA 2P2UA 1U57A 2N5HA 1UIIA 3A2AA 5KLVE 2FXPA 4D6TG 2OYHA 1X0TA 5CCHA 5HGNA 2R3SA 1GW4A 1PP9J 2CGQA 3LW5H 2GDXA 1FZAA 2PEMA 5EW5E 2KSJA 4CA3A 2RH0A 2ITAA 5TISE 1CW5A 3CWBG 4BPGA 1X8YA 1QRJA 4PD4D 1N73B 3GHGA 1NTZJ 2K0DX 3DS4A 1VQ7P 2LR2A 3BCCJ 1DEBA 2VRSA 1S5LH 3B71A 2QM8A 3GF7A 2KW2A 3L70E 4N78E 1JCCA 1F80D 2JB0A 2K5XA 1LTSC 2HR3A 1UJZA 2ZJSE 5TJHA 2WZ7A 4JPZB 2W8ZA 2I1JA 3NXSA 2AF8A 1GD2E 3F5HA 2FFDA 2AEMA 3L73J 3DTJA 2W27A 3L74J 1HTLC 3H1JE 1NU1G 1YQ4C 3G9RA 3B5NB 4Y99B 2YKOA 2CK3H 2FVEA 5GTIH 3DS5A 3R2PA 2WPRA 1OW7A 1USEA 5M1BA 2LPKA 3WUVA 2P9XA 3SWFA 1KN7A 1SQXJ 4U7JA 1VQ5P 1N7SC 2N5IA 4XFJA 3AECC 1GW3A 4BWNA 2B87B 1HGVA 3RL0g 4QMAA 3SWKA 3MZWB 3P7KA 2V4HA 4N6JA 5AVTB 4TT3H 2Z4EA 5F2KA 2E76B 2KUBA 4EIJA 1LTJA 1FC2C 3TGUG 3V2NA 3VP9A 3H1KE 1PGPA 1ZMBA 2JEEA 1DX7A 1NTZK 4GOFA 1FZEA 4DG9A 4WYMA 1P84D 2IFNA 3A0BE 1P84E 1VQOP 5C39A 1OVVA 1T2KD 2ROQA 3PTZA 2WMMA 1N86A 1SQBK 2A45G 3VOPA 5EFWB 2FBWC 1EZVG 1MUUA 1QLED 1X22A 3MTUE 5DJTB 1L0NJ 3D71A 3SFEC 2JR8A 4JF7A 2B88A 1JY2P 2KOPA 1M57D 2JGPA 2PFXA 3TSIA 2KNCA 2GDWA 4RO0A 5AW6B 2FY8A 4COPA 1L0LE 5APTA 1N73A 1SQQJ 1NWQA 2VSQA 1H8AA 1LTTC 4KJMA 3S9OA 2NZ2A 2R3CA 5TISH 3AE3C 3CXHE 1LP1A 3A7OA 4YXWH 1NTKG 2MVUA 4W80A 2WSFJ 4H13C 5CJ0A 1OVRA 1UIXA 3CC2P 5BU8B 2FKWB 1G2CB 4ZKPA 1RF1C 3G0VA 3L72D 1JY2O 2BEZF 4U3FG 1QL2A 2ZT9C 3ITKA 1YYCA 3CX5D 1LJ2A 4ZMDA 3CX5E 3HD7B 1HF9A 1BXIA 3VRLC 1URQD 2R44A 2JQ4A 2FQ1A 1VQPP 4HJGH 2PEOA 3GKLC 2C9NY 3H0DA 1IMQA 1YI2P 1T8ZA 3E7KA 1PP9G 3AE9C 4YXDC 1Q7YQ 3DS1A 3H47A 2YO3A 2K9JB 4AYCA 2BHVA 3CE7A 3E1RA 1EXIA 1D7MA 1NTZG 3U1CA 2QRXA 3P8CD 2WITA 3P8MC 4H2YC 3P8CE 2FQ2A 1NVOA 3BCCG 1KV4A 1KQSO 2EHSA 1AJYA 2POHA 3N7NA 2L9FA 2LKMA 1SQVK 2XZRA 1NJIQ 3T97B 2QJPB 4U0EA 1SQPK 1NQ4A 4U0DA 2MF4A 3CXCO 3R4YA 3L73G 4ZNCA 2QVAA 1P84I 4DZOA 3NY7B 2GZJA 3CMAP 1GZLA 3MP7B 3A0BH 3GF3A 1KB9D 1IJDB 2Q9IA 2LIUA 5KJ7D 4GODA 1LWUC 1M7LA 1NHLA 2L4BA 3H32B 4IL6E 1SFCC 3S1KA 1VHNA 4D6TJ 2M3BA 3H1HD 1KD1Q 5BS1A 2L5GB 2Y9YA 3TNUB 1URQA 1BGYG 4PV1B 3H1IJ 3L74D 3L74E 3BATA 1YQ3C 3LIEA 3PH0A 2IZ0A 1J2JB 1GMJA 3CWBJ 2BUOA 3CXHI 1N2DC 4JBZA 3CXHH 1AFOA 3MUDA 3RK2C 2R32A 3BRTB 5APYA 1SQXE 3WMM0 3W68A 2DNWA 2WSEJ 3JCUE 1KZUB 1M1JB 1JO5A 1NU1J 2K1AA 3HE5A 1GL2C 2Y0EA 1RQUA 3FXDA 3CX5I 2I1KA 1VQNP 2YKQA 2HYNA 2OTJP 2FADA 2K93A 2FYUD 1A02J 5KJ7A 3U43A 2GZIA 3C9IA 2E5YA 2XZ0D 1VF5C 2OYHB 2IX7C 5KKZC 2LXBA 2XZ1C 3Q2YA 2ZXXA 2KODA 1N7SD 4UHPB 2PEQA 2IBZE 2HODA 1FZFA 3JSVC 4I1LA 1SQVG 5KAIH 1T6AA 2AEFA 1SQPG 3L75J 1HVVA 1QGKB 1L0NE 2OGUA 2MD9A 3H1LJ 2FYZA 2C0WA 1Y47A 5GTHE 5BU5A 3DS2A 1NTMD 3TGUJ 2KGEA 1IFMA 3AEFC 2KI7B 1VQ6P 1UNKA 4M0IA 2W6AA 4RJTA 2VLQA 3DS3A 2FFDB 2YMYA 5CBOA 2PEIA 5KLIB 1SQQD 1SQQE 1KB9I 3H32A 5DCKA 1H88A 3L36A 3WU2H 1IFJA 3U59A 1L0HA 3PJSK 4OVNF 3CD6P 4H44B 2YIUC 4IL6H 3SWYA 1S72P 3A0HE 4BPHA 2LKIA 4H2WC 2WVRA 4ZKUA 2PP6A 2LXCB 3G28A 1KILE 1LNQA 3K5BA 3PRJA 3EFFK 3D70A 2FHSC 1FU1A 1RE4C 1FDMA 3G4SP 1KYOE 1JJ2O 1ZXGA 4PH0A 3V4WA 2B89A 5CJ4A 1N7SA 1BDCA 1ZW0A 1DNYA 4H13D 1Q2NA 3RG6C 4WWIA 2PRRA 1PGOA 2JJLA 1J1EC 2C0XA 1LTJB 4O9BA 4MRTC 1Z6MA 5KP6B 3JC22 3NMDA 1PPJE 1OFCX 3L71G 1CEIA 2A06G 1BE3D 1M8OB 2O3JA 2ZT9D 1BCCD 1LTBC 1EXJA 1OMIA 3IR9A 3HTKA 1VQKP 4YTPC 5F2OA 1AF8A 4WB4A 2M0BA 3GLMA 5AVVB 4UB6E 1H0TA 5KLVD 4XFYA 2O1KA 3QWOC 3EQ2A 2DGYA 5B66E 1X9VA 3S4RA 2WQYC 4DJGA 2KB7P 2JO0A 1IMPA 1GPJA 3H1IG 1R5LA 2KNCB 2IBZI 3Q5SA 1PFIA 1IC2A 3I56P 5AW9B 2OARA 2KG6A 1XTGB 3L70D 4QNBA 1J1DC 4N78D 3B5IA 5APWA 2P10A 1SQBJ 1SP4A 1LP1B 4D6TE 3OAKA 2WT7A 2QM7A 4LGDE 2KORA 1EIAA 4M3LA 3C1LA 5GTHH 4L74A 1GK4A 1CZQA 1K05A 1X3OA 3H1JD 1MKMA 3G71P 3EWKA 3AE6C 1Z56A 1IZNB 4WBAA 3H1IE 1YJ9P 3V2QA 3KDPB 1FDIA 2KIKA 3Q5PA 3CWBD 3CWBE 4HKZH 4Y28J 1L4AC 1RF1A 4UB8E 1SFCD 1EMVA 1ZR4A 2EG5A 1KLPA 2N9BA 2QJKB 2LMLA 5BVZA 1QL1A 2KS1A 3M9BA 2WSFH 1BGYJ 3A0HH 3HUSC 2J5UA 3V6IA 1KFNA 1ZNVA 3AE1C 3O8ZA 2LTEA 2L22A 1NU1E 4OGQC 4AQRD 1S4XA 2XDJA 3IFMA 2QG4A 1FZBA 5HGLA 3L75G 5CZDB 1KYOH 2R5DA 4A7PA 3DS0A 1HQBA 2H43A 5KKZB 3AEDC 3RL0C 1M1KQ 2GA1A 3Q3DA 2FACA 3H1LG 4NPDA 1FBMA 2N6ZA 1IFNA 5APSA 3H25A 3H1KD 3RK2D 2XV6A 3WUTA 2KG8A 5AW4B 2N1TC 3CMEP 2K92A 3CC4P 1AQ5A 4CPGA 5B5EE 2BEQD 2K9YA 1U7MA 1S2EA 1KMIZ 1GL2D 2VLOA 2WPVB 3VMAA 2CNRA 4IPYA 2P58A 2V7QJ 2GYKA 2D2CC 3MGNA 1FJKA 3KPEA 1QVGO 1OWAA 1S9KD 1S9KE 1LWUA 4UB6H 2B9BA 1VQ9P 3TGUD 1OIPA 3TGUE 1VF5D 2KP8A 1SFCA 1KILC 2E75C 2Y0CA 5DJUB 1K04A 5B66H 1L0LD 1URQB 2E43A 1LT9C 1HGZA 2N98A 2Z5IA 1BSNA 3DPHA 2GDYA 1SQVJ 1NYHA 2OTLP 1FZCC 4ASWA 4IFMA 1SQPJ 3CCJP 3IF4A 1LTGC 2AVAA 1EZVE 3CXHD 2FQ0A 3AEBC 3FXEA 3L72G 2M5RA 2EFJA 3I55P 1A8OA 3EJBA 2OYIC 1IO4A 4I7ZB 2PAJA 3NTNA 1IUQA 2Y0DA 1QX8A 2ZVOB 2KLUA 1JY3N 2FYNB 2ERHA 3MD0A 3V5BA 4XRQA 2YO2A 1RE3C 1CI6A 1JNMA 3HE5B 2GZEA 4GT1A 3AEGC 1LT1A 4IZ6A 3KZIH 2E74C 2JYGA 1GL2A 3VP8A 2KWLA 1NTKD 4UB8H 1NTKE 2FYUK 1DH3A 4AUWA 1MZ8A 2KGCA 2KLVA 2VLPA 1KQGB 4H0LC 4YPCA 2YXRB 3LIDA 4WY4C 3NTEA 1NKNA 3HRNA 3IAOA 4I6MC 5KAIE 1HH0A 3GJNA 2QJYC 2ZXEB 4U3FD 1LTIC 4U3FE 3F89A 2M8NA 1EDKA 4NEOA 1ZMEC 3CCQP 2WSEH 2HODB 3CI9A 2IZ1A 2KOSA 1A02F 2K94A 4PXHB 2KXPB 3EJEA 1OW8A 3RK3C 4F37A 1SQBG 2NPSC 3TYYA 1NTMK 4ASVA 3SSUA 3CCLP 4XFZA 1QEXA 3IN6A 1PP9D 4C7NA 1PP9E 1M90Q 1HWTC 2OQQA 1Q86Q 3L71J 3H1HG 1FOSE 1DD4A 5AW5B 1Q82Q 2H7HA 3G3ZA 5B5EH 3WU2E 2BQ1E 1YJNP 1GTWA 3ZDMA 1NTZD 1NTZE 5F2NA 3BCCD 3BCCE 2IYOA 1JMMA 2JU2A 3FWLA 1SQBE 1PL5A 1VKUA 4IFDK 1JOCA 3TDKA 2KSEA 3L73D 3L73E 1AVOA 1USDA 4B86A 2KK7A 5CBNA 2QIWA 1NGMB 2MVVA 4IFFA 2YXQB 2A45H 1RE4A 1PGJA 2WPSA 2MY5A 1N7SB 1EOQA 4HKGA 2LIWA 4H2XC 1GU5A 1OZHA 1T8KA 2WWWA 1EDIA 1BGYD 1W2BO 1BGYE 3G1IA 1SQXD 1NAFA 5AVQB 3FWNA 2FYUG 1EQ7A 1JEKA 2WPQA 2FXOA 1A43A 2L0QA 5E79E 4IL6X 3B5NC 2HLOA 2E42A 4C46A 4Y99C 1Y9BA 4RKUJ 1JMBA 3BVHA 2K2QA 1L4AD 2KGDA 5KAFH 2N1TB 3HTKB 1E79H 3AE8C 5KLVK 2KG9A 1NOHA 1LTAC 3I5CA 4PH1A 4EI2A 3M0DC 1H0TB 5HV8A 1KTMA 1OR5A 2J59M 1BSHA 2XT1A 3PP5A 1DIPA 2KOOA 2IBZD 3CPWO 4OH8B 2Q3IA 2Z46A 1G1JA 4OGQD 1GDTA 1NTMG 1SLQA 4HB1A 1NH4A 1GXHA 1K30A 2G8YA 1FJPA 3L37A 5CCGC 2BCCG 3AEAC 4U0FA 2ZVNB 3RBXA 2E1MA 1GK6A 1PEUA 3H4EA 3RL0D 1L0ND 1VDFA 3WUUA 1KQFB 4U0AA 3USSA 3P32A 5AVRB 3CC7P 2PNGA 4DCKA 3G26A 5KP8B 2N1TD 3G6EP 2MJZA 2WT7B 1FOSF 4GIFA 3M9QA 2UWJE 2AEJA 2KZJA 1HBWA 1ZRTD 3ABVC 4GR6A 1PEQA 1ZRTE 1SQVE 2KZIA 4H13B 4XA4A 1AUMA 2O01J 1SQPE 2YKPA 2D2CD 1CSBA 1RF1B 1ZR2A 1JM0A 2XNXA 2JP3A 2ZT9B 1L4AA 3G29A 3MHVA 1VPCA 5AVZB
chains in the Genus database with same CATH topology
2L6EA 1VQ5P 1RO0A 2KODA 3G1GA 3CCUP 4U0CA 2PEQA 2M8LA 3CCMP 3RG6C 4XFXA 3DPHA 3CC2P 2EG5A 3CCLP 4XFZA 2OTLP 1YITP 1M6NA 2PY8A 1M90Q 2QEXP 3G0VA 2EIAA 3MGEA 5BS1A 3CCJP 1KD1Q 5HGNA 1VQMP 1Q86Q 4PH1A 3CCRP 2JYLA 1KC8Q 5F2KA 1Q82Q 1M74A 2EFJA 3I55P 2XT1A 1N8RQ 1BAJA 3M1MA 1A8OA 1E6JP 2PEJA 2PEMA 1K8AQ 5I4TG 1VQKP 3VRLC 1YJNP 1QVFO 2BQ1E 5F2OA 3DS2A 2LF4A 3CPWO 1Q81Q 5F2NA 1ZMBA 1IUQA 3Q20A 5HGMA 2Z46A 1VQPP 1VQ6P 1QRJA 4M0IA 4WYMA 4XFYA 2PEOA 5HGLA 1RO2A 2DGYA 1VQOP 2BUOA 3DS4A 1K30A 3DS0A 1VQ7P 3H0DA 3LRYA 3DS3A 1YIJP 3HYBA 4U0FA 4XRQA 3WBHA 1YI2P 2XXMA 2E1MA 2PEIA 1D1DA 1PEUA 2M8PA 3H4EA 1Q7YQ 3E2DA 1M1KQ 3DS1A 3H47A 5DCKA 1VQLP 2JO0A 2BHVA 1RNIA 4U0AA 2PENA 3HZQA 1PEMA 1VQ4P 1YHQP 2XV6A 3CC7P 3CCEP 3CD6P 2JYGA 1PEOA 2PEKA 3G26A 3G6EP 3CMEP 3DTJA 3CCSP 3CC4P 1S72P 3I56P 1YJWP 2QA4P 2OARA 3G21A 5HGOA 3P05A 2ONTA 5JPAA 3CCVP 1KQSO 4QNBA 4GR6A 3B5IA 1PEQA 3G28A 3NTEA 2CWOA 1VQ8P 1EOQA 4COPA 3OW2O 1AUMA 4IPYA 2Z44A 1NJIQ 1VQNP 2Z45A 4XROA 3G4SP 1EIAA 4GR2A 3DS5A 4U0EA 4U0BA 1JJ2O 2OTJP 2M8NA 4U0DA 4PH0A 3CXCO 1QVGO 1W2BO 3CCQP 3G1IA 5BS2A 3G71P 1K9MQ 2P9XA 4COCA 3CMAP 1VQ9P 1YJ9P 1K73Q 3G29A 1M6EX 1A43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K Q;  1VQ5 P;  3I55 P;  1N8R Q;  1VQ8 P;  1VQL P;  3CCU P;  1VQK P;  1K8A Q;  3OW2 O;  1YJN P;  1QVF O;  3CPW O;  1Q81 Q;  1NJI Q;  3CCM P;  1VQN P;  3G4S P;  1VQ4 P;  1YHQ P;  1KD1 Q;  3CC2 P;  3CC7 P;  3CCE P;  1JJ2 O;  3CD6 P;  2OTJ P;  3CCL P;  1VQP P;  2OTL P;  1VQ6 P;  3CXC O;  1YIT P;  1QVG O;  1W2B O;  3G6E P;  3CCQ P;  3CME P;  1M90 Q;  3CCS P;  3CC4 P;  2QEX P;  3I56 P;  3CCJ P;  1VQO P;  1YJW P;  2QA4 P;  1S72 P;  3G71 P;  1K9M Q;  1VQM P;  1Q86 Q;  3CCR P;  1VQ7 P;  3CMA P;  1YIJ P;  1VQ9 P;  1YJ9 P;  1K73 Q;  1YI2 P;  1KC8 Q;  3CCV P;  1KQS O;  1Q82 Q;  1Q7Y Q; 
#chains in the Genus database with same CATH topology
 2FXM A;  4EYY Q;  1KIL D;  2E75 D;  4RES B;  2CG5 B;  1MFT A;  2KS1 B;  1RF0 C;  2M8L A;  1S5L X;  2N50 A;  4XFX A;  1KYO D;  3AE7 C;  1EC5 A;  2J58 A;  2KYV A;  1Y8A A;  4L73 A;  1VQM P;  3HUS A;  3CCR P;  2WSC J;  2P7J A;  3HE4 A;  2MR8 A;  1JY3 O;  3L72 J;  2AFE A;  1OW6 A;  1BE3 G;  3PHL A;  1E6J P;  5AVS B;  1BCC G;  3RG2 A;  1PZQ A;  3AE4 C;  2Q1K A;  3Q20 A;  4GDO A;  3KHU A;  2K88 A;  1E0H A;  1OXZ A;  1PPJ D;  3AEE C;  2VLN A;  1YIJ P;  2JWD A;  5KLV G;  3V2R A;  2FVA A;  3H6P A;  2N1T A;  3HD7 C;  1U7J A;  3M91 A;  1PEM A;  5E79 H;  2JDI H;  3KYQ A;  1FE6 A;  2PGD A;  4PJ0 E;  2HPC B;  1PIX A;  1PEO A;  2E74 D;  5L8R J;  1M56 D;  1YBK A;  3P05 A;  4H0L D;  1LWU B;  2WTY A;  4WY4 D;  2IFM A;  2RKL A;  3A3Y B;  1KQL A;  2Q5U A;  1FDO A;  3L70 G;  1AV1 A;  1SFC B;  1L0L K;  4LC1 A;  3L71 D;  4GR2 A;  3L71 E;  2A06 D;  2A06 E;  1JTH B;  1KIL A;  4WVZ A;  4GOE A;  2QSI A;  3O6Q A;  1NO4 A;  1LT9 A;  3H1J G;  1RO0 A;  2JBG A;  7CEI A;  1FZC A;  1IFP A;  3RK3 D;  3RK3 E;  2V7Q H;  4D6T D;  2KOG A;  3CCM P;  4BRY A;  2QJP C;  2NPS D;  1EDJ A;  1G1I A;  4PD4 E;  2GUS A;  3MGE A;  2EIA A;  3II6 A;  1GU4 A;  2OYI A;  3H1I D;  1IFD A;  3D6Y A;  3H1H J;  2XV5 A;  1H89 A;  1N8R Q;  3FX0 A;  1K8A Q;  1N7L A;  3KZI E;  1QVF O;  2O1J A;  3RK2 B;  3M9H A;  1CI6 B;  2LOL A;  3UIA A;  4KHX A;  4HYT B;  1HJ0 A;  1W2E A;  1XTC C;  5AW8 B;  2C9L Y;  1RE3 A;  1R8E A;  2QNW A;  5APV A;  2KGA A;  1NTK K;  2GZG A;  3HYB A;  1GL2 B;  1MV8 A;  3W67 A;  2H8P D;  3A5T A;  4TLF A;  5K5G B;  4PV1 C;  2Y9Z A;  1RNI A;  1X79 B;  1L2P A;  3Q5R A;  1VQ4 P;  2H88 C;  1NU1 D;  3EFG A;  1KYO I;  3H1K G;  2LL8 A;  1SS1 A;  4WY4 A;  2GZF A;  5HGO A;  1E5W A;  2Z5H A;  2K37 A;  1VF5 B;  3C8V A;  1W5C E;  3VMY A;  5APU A;  3VN0 A;  4K3A A;  3OW2 O;  3VYI A;  1ZN5 A;  3GW6 A;  1HY8 A;  1AQT A;  1KOR A;  1M1J C;  2FYU J;  3VTP C;  4C7N B;  2M8P A;  2NPS A;  4HH2 A;  5KP7 B;  4JYC A;  3B5N D;  1NKZ B;  3LW5 J;  2HPC A;  4U0C A;  1ZP0 C;  4NPE A;  3L75 D;  3L75 E;  4K35 A;  1L0L G;  2PY8 A;  2MKV A;  2OYO A;  2QEX P;  3H1L D;  2W6J H;  3H1L E;  4PJ0 H;  1FAV A;  2OYH C;  3GMA A;  2AFD A;  1JB0 J;  3LMO A;  5CCH C;  1JCD A;  1BAJ A;  3M1M A;  1DV5 A;  1JTH A;  1RH5 B;  4I2L C;  5HGM A;  2ZAE B;  3CL3 D;  2YIU B;  3U1A A;  1NTM J;  2IDB A;  2GUV A;  4KT0 J;  1Q90 D;  5AW7 B;  1EZV D;  5CCG D;  2FVF A;  2BCC J;  1AVY A;  3BRV B;  3BAS A;  2ZYG A;  4GKG A;  3GHG C;  2E76 D;  2RMZ A;  2Q6Q A;  2N9Y B;  3L35 A;  3SFD C;  4PD4 I;  1EDL A;  5H2F E;  2IYP A;  1SQX K;  4PD4 H;  2ONT A;  3CLQ A;  2FFD C;  4R0M A;  3CCV P;  2QE7 H;  2G3A A;  5KLI C;  4JQ0 D;  2XKM A;  5KAF E;  4LLH A;  2Z45 A;  4XRO A;  1J1E B;  4H44 C;  3OJA B;  2HG5 D;  2AXT E;  3B5N A;  3L72 E;  2CPS A;  4W7Z A;  1DEE G;  5APQ A;  2OTK E;  5APX A;  2HFE D;  4L76 A;  4NPF X;  4OWF A;  5HVC A;  2L91 A;  2K0X A;  2M5A B;  3M0D A;  3N4X A;  2SPZ A;  1YIT P;  1M6N A;  1PGQ A;  2XU6 A;  1RHZ B;  5CMZ A;  5AW1 B;  2B87 A;  1OVU A;  5KTB A;  4C7R A;  1L0N K;  2PEJ A;  1BE3 J;  3TF5 A;  2LF4 A;  5AVY B;  1BCC J;  1AYI A;  2RN0 A;  5CCG A;  1LTJ C;  1T3J A;  2W83 C;  1RO2 A;  4QKO A;  1IFI A;  1HJB A;  3QH9 A;  2JU1 A;  1MFZ A;  3WBH A;  5KLV J;  3KQG A;  1J1D B;  3E2D A;  1FS0 E;  1VQL P;  3B8E B;  1OX3 A;  1SQQ K;  2P1J A;  5AW0 B;  5AVW B;  3HD7 D;  1RQV A;  2YMK A;  1FR2 A;  3AE5 C;  3RGU A;  4XE5 B;  3L74 G;  3G21 A;  4EOT A;  1SQB D;  1P84 H;  1KB9 E;  2P67 A;  2BAS A;  2CWO A;  3V2P A;  1L4A B;  2Z44 A;  2X2B A;  3L70 J;  4BPF A;  1SVF A;  4U0B A;  1FZG A;  3M0A A;  3H1H E;  1N73 C;  2NO8 A;  5BS2 A;  4DOJ A;  3RBZ A;  1K9M Q;  2IPP A;  3B4Q A;  2A45 I;  2O01 N;  1RF0 A;  1SQX G;  1EZV I;  1NAY A;  3H1J J;  1BDD A;  3HUS B;  2O01 H;  3D6Z A;  2Q7C A;  3HE4 B;  1DD3 A;  1WT6 A;  3GZM A;  4OGQ B;  3AE2 C;  2JYL A;  4N3Y B;  4DT0 A;  4Z1M H;  2GM4 A;  3RL0 B;  3PLN A;  5H2F H;  1T3U A;  1G2C A;  1Q81 Q;  4R4L A;  2E5T A;  2IBZ G;  3Q1M A;  2CQ8 A;  2QJK C;  1T2K C;  2KOQ A;  3HD7 A;  3LRY A;  2WPT A;  2FAE A;  2WSC H;  2AXT H;  3L4F A;  1GXG A;  1WMK A;  2ZFC A;  1WRG A;  2NRG A;  2M5A A;  4PV1 D;  2PEN A;  3HZQ A;  1L0N G;  3CX5 H;  2D2C B;  1ZV8 A;  3OA7 A;  2FYU E;  3CCS P;  3VMX A;  3H1K J;  3GG2 A;  4L75 A;  1ZOY C;  2AXC A;  1RY3 A;  2K9J A;  2I8D A;  1KIL B;  2E75 B;  2E76 C;  5AVU B;  3O6Q B;  1LT9 B;  2M3E A;  1SQQ G;  1YTZ I;  1AA0 A;  1IK9 A;  2KR5 A;  1FZC B;  2CPB A;  1S5L E;  2XND H;  4BRY B;  3V4Q A;  3T97 A;  1M6E X;  3GHG B;  2ZYA A;  2DW3 A;  2K3R A;  1JY3 P;  1SQV D;  5CHX A;  4PWV B;  3G1G A;  3CCU P;  2OYI B;  2K0Y A;  1NTM E;  1SQP D;  2JWA A;  2JKV A;  1IK7 A;  2BCC D;  3B4S A;  2BCC E;  1L0L J;  1YTZ T;  5AVX B;  2JO1 A;  1VL2 A;  2EHT A;  3GZL A;  2W90 A;  1KC8 Q;  1TU3 F;  1M74 A;  5GTI E;  5CCH D;  3E1I A;  1KB9 H;  1L0I A;  5I4T G;  3TK1 A;  1URQ C;  4R4M A;  2MR7 A;  1JY2 N;  3KXD A;  2E74 B;  4IOI H;  3TNU A;  1NU1 K;  2R5B A;  1MZ9 A;  1ACP A;  2WSS H;  2YNY A;  4H0L B;  2XXM A;  3M06 A;  1D1D A;  1PPJ G;  5AW2 B;  4WY4 B;  1PV3 A;  3MIW A;  1LGH B;  2QJY B;  2M8R A;  4I7Z C;  1YHQ P;  3CCE P;  4EDF A;  2PEK A;  4W7Y A;  3MUD C;  4BXL A;  2N6Y A;  2Q3E A;  1YJW P;  2QA4 P;  1R5S A;  4JYB A;  2FYN C;  2H89 C;  5JPA A;  5AW3 B;  1NTK J;  3NFQ A;  4MN4 C;  1S3J A;  3RK3 B;  1VQ8 P;  2NPS B;  1M1J A;  3VMZ A;  3FGA D;  4H44 D;  1KFM A;  1HUC A;  4U3F J;  1BE3 E;  4COC A;  1K73 Q;  1BCC E;  3JCU H;  5KJ7 C;  2W6B A;  2L6E A;  5EJD A;  2ZYD A;  1S1C X;  2JAZ A;  3EJD A;  1JUN A;  1ZLL A;  2P2U A;  1U57 A;  2N5H A;  1UII A;  3A2A A;  5KLV E;  2FXP A;  4D6T G;  2OYH A;  1X0T A;  5CCH A;  5HGN A;  2R3S A;  1GW4 A;  1PP9 J;  2CGQ A;  3LW5 H;  2GDX A;  1FZA A;  2PEM A;  5EW5 E;  2KSJ A;  4CA3 A;  2RH0 A;  2ITA A;  5TIS E;  1CW5 A;  3CWB G;  4BPG A;  1X8Y A;  1QRJ A;  4PD4 D;  1N73 B;  3GHG A;  1NTZ J;  2K0D X;  3DS4 A;  1VQ7 P;  2LR2 A;  3BCC J;  1DEB A;  2VRS A;  1S5L H;  3B71 A;  2QM8 A;  3GF7 A;  2KW2 A;  3L70 E;  4N78 E;  1JCC A;  1F80 D;  2JB0 A;  2K5X A;  1LTS C;  2HR3 A;  1UJZ A;  2ZJS E;  5TJH A;  2WZ7 A;  4JPZ B;  2W8Z A;  2I1J A;  3NXS A;  2AF8 A;  1GD2 E;  3F5H A;  2FFD A;  2AEM A;  3L73 J;  3DTJ A;  2W27 A;  3L74 J;  1HTL C;  3H1J E;  1NU1 G;  1YQ4 C;  3G9R A;  3B5N B;  4Y99 B;  2YKO A;  2CK3 H;  2FVE A;  5GTI H;  3DS5 A;  3R2P A;  2WPR A;  1OW7 A;  1USE A;  5M1B A;  2LPK A;  3WUV A;  2P9X A;  3SWF A;  1KN7 A;  1SQX J;  4U7J A;  1VQ5 P;  1N7S C;  2N5I A;  4XFJ A;  3AEC C;  1GW3 A;  4BWN A;  2B87 B;  1HGV A;  3RL0 g;  4QMA A;  3SWK A;  3MZW B;  3P7K A;  2V4H A;  4N6J A;  5AVT B;  4TT3 H;  2Z4E A;  5F2K A;  2E76 B;  2KUB A;  4EIJ A;  1LTJ A;  1FC2 C;  3TGU G;  3V2N A;  3VP9 A;  3H1K E;  1PGP A;  1ZMB A;  2JEE A;  1DX7 A;  1NTZ K;  4GOF A;  1FZE A;  4DG9 A;  4WYM A;  1P84 D;  2IFN A;  3A0B E;  1P84 E;  1VQO P;  5C39 A;  1OVV A;  1T2K D;  2ROQ A;  3PTZ A;  2WMM A;  1N86 A;  1SQB K;  2A45 G;  3VOP A;  5EFW B;  2FBW C;  1EZV G;  1MUU A;  1QLE D;  1X22 A;  3MTU E;  5DJT B;  1L0N J;  3D71 A;  3SFE C;  2JR8 A;  4JF7 A;  2B88 A;  1JY2 P;  2KOP A;  1M57 D;  2JGP A;  2PFX A;  3TSI A;  2KNC A;  2GDW A;  4RO0 A;  5AW6 B;  2FY8 A;  4COP A;  1L0L E;  5APT A;  1N73 A;  1SQQ J;  1NWQ A;  2VSQ A;  1H8A A;  1LTT C;  4KJM A;  3S9O A;  2NZ2 A;  2R3C A;  5TIS H;  3AE3 C;  3CXH E;  1LP1 A;  3A7O A;  4YXW H;  1NTK G;  2MVU A;  4W80 A;  2WSF J;  4H13 C;  5CJ0 A;  1OVR A;  1UIX A;  3CC2 P;  5BU8 B;  2FKW B;  1G2C B;  4ZKP A;  1RF1 C;  3G0V A;  3L72 D;  1JY2 O;  2BEZ F;  4U3F G;  1QL2 A;  2ZT9 C;  3ITK A;  1YYC A;  3CX5 D;  1LJ2 A;  4ZMD A;  3CX5 E;  3HD7 B;  1HF9 A;  1BXI A;  3VRL C;  1URQ D;  2R44 A;  2JQ4 A;  2FQ1 A;  1VQP P;  4HJG H;  2PEO A;  3GKL C;  2C9N Y;  3H0D A;  1IMQ A;  1YI2 P;  1T8Z A;  3E7K A;  1PP9 G;  3AE9 C;  4YXD C;  1Q7Y Q;  3DS1 A;  3H47 A;  2YO3 A;  2K9J B;  4AYC A;  2BHV A;  3CE7 A;  3E1R A;  1EXI A;  1D7M A;  1NTZ G;  3U1C A;  2QRX A;  3P8C D;  2WIT A;  3P8M C;  4H2Y C;  3P8C E;  2FQ2 A;  1NVO A;  3BCC G;  1KV4 A;  1KQS O;  2EHS A;  1AJY A;  2POH A;  3N7N A;  2L9F A;  2LKM A;  1SQV K;  2XZR A;  1NJI Q;  3T97 B;  2QJP B;  4U0E A;  1SQP K;  1NQ4 A;  4U0D A;  2MF4 A;  3CXC O;  3R4Y A;  3L73 G;  4ZNC A;  2QVA A;  1P84 I;  4DZO A;  3NY7 B;  2GZJ A;  3CMA P;  1GZL A;  3MP7 B;  3A0B H;  3GF3 A;  1KB9 D;  1IJD B;  2Q9I A;  2LIU A;  5KJ7 D;  4GOD A;  1LWU C;  1M7L A;  1NHL A;  2L4B A;  3H32 B;  4IL6 E;  1SFC C;  3S1K A;  1VHN A;  4D6T J;  2M3B A;  3H1H D;  1KD1 Q;  5BS1 A;  2L5G B;  2Y9Y A;  3TNU B;  1URQ A;  1BGY G;  4PV1 B;  3H1I J;  3L74 D;  3L74 E;  3BAT A;  1YQ3 C;  3LIE A;  3PH0 A;  2IZ0 A;  1J2J B;  1GMJ A;  3CWB J;  2BUO A;  3CXH I;  1N2D C;  4JBZ A;  3CXH H;  1AFO A;  3MUD A;  3RK2 C;  2R32 A;  3BRT B;  5APY A;  1SQX E;  3WMM 0;  3W68 A;  2DNW A;  2WSE J;  3JCU E;  1KZU B;  1M1J B;  1JO5 A;  1NU1 J;  2K1A A;  3HE5 A;  1GL2 C;  2Y0E A;  1RQU A;  3FXD A;  3CX5 I;  2I1K A;  1VQN P;  2YKQ A;  2HYN A;  2OTJ P;  2FAD A;  2K93 A;  2FYU D;  1A02 J;  5KJ7 A;  3U43 A;  2GZI A;  3C9I A;  2E5Y A;  2XZ0 D;  1VF5 C;  2OYH B;  2IX7 C;  5KKZ C;  2LXB A;  2XZ1 C;  3Q2Y A;  2ZXX A;  2KOD A;  1N7S D;  4UHP B;  2PEQ A;  2IBZ E;  2HOD A;  1FZF A;  3JSV C;  4I1L A;  1SQV G;  5KAI H;  1T6A A;  2AEF A;  1SQP G;  3L75 J;  1HVV A;  1QGK B;  1L0N E;  2OGU A;  2MD9 A;  3H1L J;  2FYZ A;  2C0W A;  1Y47 A;  5GTH E;  5BU5 A;  3DS2 A;  1NTM D;  3TGU J;  2KGE A;  1IFM A;  3AEF C;  2KI7 B;  1VQ6 P;  1UNK A;  4M0I A;  2W6A A;  4RJT A;  2VLQ A;  3DS3 A;  2FFD B;  2YMY A;  5CBO A;  2PEI A;  5KLI B;  1SQQ D;  1SQQ E;  1KB9 I;  3H32 A;  5DCK A;  1H88 A;  3L36 A;  3WU2 H;  1IFJ A;  3U59 A;  1L0H A;  3PJS K;  4OVN F;  3CD6 P;  4H44 B;  2YIU C;  4IL6 H;  3SWY A;  1S72 P;  3A0H E;  4BPH A;  2LKI A;  4H2W C;  2WVR A;  4ZKU A;  2PP6 A;  2LXC B;  3G28 A;  1KIL E;  1LNQ A;  3K5B A;  3PRJ A;  3EFF K;  3D70 A;  2FHS C;  1FU1 A;  1RE4 C;  1FDM A;  3G4S P;  1KYO E;  1JJ2 O;  1ZXG A;  4PH0 A;  3V4W A;  2B89 A;  5CJ4 A;  1N7S A;  1BDC A;  1ZW0 A;  1DNY A;  4H13 D;  1Q2N A;  3RG6 C;  4WWI A;  2PRR A;  1PGO A;  2JJL A;  1J1E C;  2C0X A;  1LTJ B;  4O9B A;  4MRT C;  1Z6M A;  5KP6 B;  3JC2 2;  3NMD A;  1PPJ E;  1OFC X;  3L71 G;  1CEI A;  2A06 G;  1BE3 D;  1M8O B;  2O3J A;  2ZT9 D;  1BCC D;  1LTB C;  1EXJ A;  1OMI A;  3IR9 A;  3HTK A;  1VQK P;  4YTP C;  5F2O A;  1AF8 A;  4WB4 A;  2M0B A;  3GLM A;  5AVV B;  4UB6 E;  1H0T A;  5KLV D;  4XFY A;  2O1K A;  3QWO C;  3EQ2 A;  2DGY A;  5B66 E;  1X9V A;  3S4R A;  2WQY C;  4DJG A;  2KB7 P;  2JO0 A;  1IMP A;  1GPJ A;  3H1I G;  1R5L A;  2KNC B;  2IBZ I;  3Q5S A;  1PFI A;  1IC2 A;  3I56 P;  5AW9 B;  2OAR A;  2KG6 A;  1XTG B;  3L70 D;  4QNB A;  1J1D C;  4N78 D;  3B5I A;  5APW A;  2P10 A;  1SQB J;  1SP4 A;  1LP1 B;  4D6T E;  3OAK A;  2WT7 A;  2QM7 A;  4LGD E;  2KOR A;  1EIA A;  4M3L A;  3C1L A;  5GTH H;  4L74 A;  1GK4 A;  1CZQ A;  1K05 A;  1X3O A;  3H1J D;  1MKM A;  3G71 P;  3EWK A;  3AE6 C;  1Z56 A;  1IZN B;  4WBA A;  3H1I E;  1YJ9 P;  3V2Q A;  3KDP B;  1FDI A;  2KIK A;  3Q5P A;  3CWB D;  3CWB E;  4HKZ H;  4Y28 J;  1L4A C;  1RF1 A;  4UB8 E;  1SFC D;  1EMV A;  1ZR4 A;  2EG5 A;  1KLP A;  2N9B A;  2QJK B;  2LML A;  5BVZ A;  1QL1 A;  2KS1 A;  3M9B A;  2WSF H;  1BGY J;  3A0H H;  3HUS C;  2J5U A;  3V6I A;  1KFN A;  1ZNV A;  3AE1 C;  3O8Z A;  2LTE A;  2L22 A;  1NU1 E;  4OGQ C;  4AQR D;  1S4X A;  2XDJ A;  3IFM A;  2QG4 A;  1FZB A;  5HGL A;  3L75 G;  5CZD B;  1KYO H;  2R5D A;  4A7P A;  3DS0 A;  1HQB A;  2H43 A;  5KKZ B;  3AED C;  3RL0 C;  1M1K Q;  2GA1 A;  3Q3D A;  2FAC A;  3H1L G;  4NPD A;  1FBM A;  2N6Z A;  1IFN A;  5APS A;  3H25 A;  3H1K D;  3RK2 D;  2XV6 A;  3WUT A;  2KG8 A;  5AW4 B;  2N1T C;  3CME P;  2K92 A;  3CC4 P;  1AQ5 A;  4CPG A;  5B5E E;  2BEQ D;  2K9Y A;  1U7M A;  1S2E A;  1KMI Z;  1GL2 D;  2VLO A;  2WPV B;  3VMA A;  2CNR A;  4IPY A;  2P58 A;  2V7Q J;  2GYK A;  2D2C C;  3MGN A;  1FJK A;  3KPE A;  1QVG O;  1OWA A;  1S9K D;  1S9K E;  1LWU A;  4UB6 H;  2B9B A;  1VQ9 P;  3TGU D;  1OIP A;  3TGU E;  1VF5 D;  2KP8 A;  1SFC A;  1KIL C;  2E75 C;  2Y0C A;  5DJU B;  1K04 A;  5B66 H;  1L0L D;  1URQ B;  2E43 A;  1LT9 C;  1HGZ A;  2N98 A;  2Z5I A;  1BSN A;  3DPH A;  2GDY A;  1SQV J;  1NYH A;  2OTL P;  1FZC C;  4ASW A;  4IFM A;  1SQP J;  3CCJ P;  3IF4 A;  1LTG C;  2AVA A;  1EZV E;  3CXH D;  2FQ0 A;  3AEB C;  3FXE A;  3L72 G;  2M5R A;  2EFJ A;  3I55 P;  1A8O A;  3EJB A;  2OYI C;  1IO4 A;  4I7Z B;  2PAJ A;  3NTN A;  1IUQ A;  2Y0D A;  1QX8 A;  2ZVO B;  2KLU A;  1JY3 N;  2FYN B;  2ERH A;  3MD0 A;  3V5B A;  4XRQ A;  2YO2 A;  1RE3 C;  1CI6 A;  1JNM A;  3HE5 B;  2GZE A;  4GT1 A;  3AEG C;  1LT1 A;  4IZ6 A;  3KZI H;  2E74 C;  2JYG A;  1GL2 A;  3VP8 A;  2KWL A;  1NTK D;  4UB8 H;  1NTK E;  2FYU K;  1DH3 A;  4AUW A;  1MZ8 A;  2KGC A;  2KLV A;  2VLP A;  1KQG B;  4H0L C;  4YPC A;  2YXR B;  3LID A;  4WY4 C;  3NTE A;  1NKN A;  3HRN A;  3IAO A;  4I6M C;  5KAI E;  1HH0 A;  3GJN A;  2QJY C;  2ZXE B;  4U3F D;  1LTI C;  4U3F E;  3F89 A;  2M8N A;  1EDK A;  4NEO A;  1ZME C;  3CCQ P;  2WSE H;  2HOD B;  3CI9 A;  2IZ1 A;  2KOS A;  1A02 F;  2K94 A;  4PXH B;  2KXP B;  3EJE A;  1OW8 A;  3RK3 C;  4F37 A;  1SQB G;  2NPS C;  3TYY A;  1NTM K;  4ASV A;  3SSU A;  3CCL P;  4XFZ A;  1QEX A;  3IN6 A;  1PP9 D;  4C7N A;  1PP9 E;  1M90 Q;  1HWT C;  2OQQ A;  1Q86 Q;  3L71 J;  3H1H G;  1FOS E;  1DD4 A;  5AW5 B;  1Q82 Q;  2H7H A;  3G3Z A;  5B5E H;  3WU2 E;  2BQ1 E;  1YJN P;  1GTW A;  3ZDM A;  1NTZ D;  1NTZ E;  5F2N A;  3BCC D;  3BCC E;  2IYO A;  1JMM A;  2JU2 A;  3FWL A;  1SQB E;  1PL5 A;  1VKU A;  4IFD K;  1JOC A;  3TDK A;  2KSE A;  3L73 D;  3L73 E;  1AVO A;  1USD A;  4B86 A;  2KK7 A;  5CBN A;  2QIW A;  1NGM B;  2MVV A;  4IFF A;  2YXQ B;  2A45 H;  1RE4 A;  1PGJ A;  2WPS A;  2MY5 A;  1N7S B;  1EOQ A;  4HKG A;  2LIW A;  4H2X C;  1GU5 A;  1OZH A;  1T8K A;  2WWW A;  1EDI A;  1BGY D;  1W2B O;  1BGY E;  3G1I A;  1SQX D;  1NAF A;  5AVQ B;  3FWN A;  2FYU G;  1EQ7 A;  1JEK A;  2WPQ A;  2FXO A;  1A43 A;  2L0Q A;  5E79 E;  4IL6 X;  3B5N C;  2HLO A;  2E42 A;  4C46 A;  4Y99 C;  1Y9B A;  4RKU J;  1JMB A;  3BVH A;  2K2Q A;  1L4A D;  2KGD A;  5KAF H;  2N1T B;  3HTK B;  1E79 H;  3AE8 C;  5KLV K;  2KG9 A;  1NOH A;  1LTA C;  3I5C A;  4PH1 A;  4EI2 A;  3M0D C;  1H0T B;  5HV8 A;  1KTM A;  1OR5 A;  2J59 M;  1BSH A;  2XT1 A;  3PP5 A;  1DIP A;  2KOO A;  2IBZ D;  3CPW O;  4OH8 B;  2Q3I A;  2Z46 A;  1G1J A;  4OGQ D;  1GDT A;  1NTM G;  1SLQ A;  4HB1 A;  1NH4 A;  1GXH A;  1K30 A;  2G8Y A;  1FJP A;  3L37 A;  5CCG C;  2BCC G;  3AEA C;  4U0F A;  2ZVN B;  3RBX A;  2E1M A;  1GK6 A;  1PEU A;  3H4E A;  3RL0 D;  1L0N D;  1VDF A;  3WUU A;  1KQF B;  4U0A A;  3USS A;  3P32 A;  5AVR B;  3CC7 P;  2PNG A;  4DCK A;  3G26 A;  5KP8 B;  2N1T D;  3G6E P;  2MJZ A;  2WT7 B;  1FOS F;  4GIF A;  3M9Q A;  2UWJ E;  2AEJ A;  2KZJ A;  1HBW A;  1ZRT D;  3ABV C;  4GR6 A;  1PEQ A;  1ZRT E;  1SQV E;  2KZI A;  4H13 B;  4XA4 A;  1AUM A;  2O01 J;  1SQP E;  2YKP A;  2D2C D;  1CSB A;  1RF1 B;  1ZR2 A;  1JM0 A;  2XNX A;  2JP3 A;  2ZT9 B;  1L4A A;  3G29 A;  3MHV A;  1VPC A;  5AVZ B; 
#chains in the Genus database with same CATH homology
 2L6E A;  1VQ5 P;  1RO0 A;  2KOD A;  3G1G A;  3CCU P;  4U0C A;  2PEQ A;  2M8L A;  3CCM P;  3RG6 C;  4XFX A;  3DPH A;  3CC2 P;  2EG5 A;  3CCL P;  4XFZ A;  2OTL P;  1YIT P;  1M6N A;  2PY8 A;  1M90 Q;  2QEX P;  3G0V A;  2EIA A;  3MGE A;  5BS1 A;  3CCJ P;  1KD1 Q;  5HGN A;  1VQM P;  1Q86 Q;  4PH1 A;  3CCR P;  2JYL A;  1KC8 Q;  5F2K A;  1Q82 Q;  1M74 A;  2EFJ A;  3I55 P;  2XT1 A;  1N8R Q;  1BAJ A;  3M1M A;  1A8O A;  1E6J P;  2PEJ A;  2PEM A;  1K8A Q;  5I4T G;  1VQK P;  3VRL C;  1YJN P;  1QVF O;  2BQ1 E;  5F2O A;  3DS2 A;  2LF4 A;  3CPW O;  1Q81 Q;  5F2N A;  1ZMB A;  1IUQ A;  3Q20 A;  5HGM A;  2Z46 A;  1VQP P;  1VQ6 P;  1QRJ A;  4M0I A;  4WYM A;  4XFY A;  2PEO A;  5HGL A;  1RO2 A;  2DGY A;  1VQO P;  2BUO A;  3DS4 A;  1K30 A;  3DS0 A;  1VQ7 P;  3H0D A;  3LRY A;  3DS3 A;  1YIJ P;  3HYB A;  4U0F A;  4XRQ A;  3WBH A;  1YI2 P;  2XXM A;  2E1M A;  2PEI A;  1D1D A;  1PEU A;  2M8P A;  3H4E A;  1Q7Y Q;  3E2D A;  1M1K Q;  3DS1 A;  3H47 A;  5DCK A;  1VQL P;  2JO0 A;  2BHV A;  1RNI A;  4U0A A;  2PEN A;  3HZQ A;  1PEM A;  1VQ4 P;  1YHQ P;  2XV6 A;  3CC7 P;  3CCE P;  3CD6 P;  2JYG A;  1PEO A;  2PEK A;  3G26 A;  3G6E P;  3CME P;  3DTJ A;  3CCS P;  3CC4 P;  1S72 P;  3I56 P;  1YJW P;  2QA4 P;  2OAR A;  3G21 A;  5HGO A;  3P05 A;  2ONT A;  5JPA A;  3CCV P;  1KQS O;  4QNB A;  4GR6 A;  3B5I A;  1PEQ A;  3G28 A;  3NTE A;  2CWO A;  1VQ8 P;  1EOQ A;  4COP A;  3OW2 O;  1AUM A;  4IPY A;  2Z44 A;  1NJI Q;  1VQN P;  2Z45 A;  4XRO A;  3G4S P;  1EIA A;  4GR2 A;  3DS5 A;  4U0E A;  4U0B A;  1JJ2 O;  2OTJ P;  2M8N A;  4U0D A;  4PH0 A;  3CXC O;  1QVG O;  1W2B O;  3CCQ P;  3G1I A;  5BS2 A;  3G71 P;  1K9M Q;  2P9X A;  4COC A;  3CMA P;  1VQ9 P;  1YJ9 P;  1K73 Q;  3G29 A;  1M6E X;  1A43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...