3CCEP

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation u2535a
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3cceP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 3cceP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 3cceP02
1Q81Q 2QA4P 3CCQP 1Q7YQ 1VQMP 1W2BO 3CMAP 3CC2P 1VQKP 3CD6P 1KC8Q 1K8AQ 3CCEP 1VQNP 3CCLP 3CPWO 2OTLP 3G4SP 1YI2P 1YJ9P 1YITP 1YJNP 1VQPP 3CMEP 3CCJP 1VQOP 3OW2O 3G71P 2QEXP 3CCUP 2OTJP 1JJ2O 1VQ4P 3CCSP 1M90Q 3CCRP 1K73Q 1VQ7P 1K9MQ 1QVFO 1VQ5P 1VQLP 3I55P 1Q82Q 3I56P 3CC4P 1Q86Q 1QVGO 1KD1Q 1VQ6P 1YJWP 1YHQP 1NJIQ 3CCVP 1S72P 1KQSO 3G6EP 1YIJP 1VQ9P 1M1KQ 3CCMP 3CC7P 3CXCO 1VQ8P 1N8RQ
chains in the Genus database with same CATH superfamily
5KAIH 1AFOA 1KYOI 1BCCG 5AW3B 4JQ0D 2QJPC 2YKPA 4IL6X 4JYCA 2LMLA 5TISH 3BRTB 1BDDA 1OIPA 4QKOA 2AEFA 1LGHB 1PP9J 3H1KD 3I56P 3AE3C 2WPSA 2K1AA 1L0LG 3U59A 4DZOA 2KG6A 1SQBE 1NTKG 3L72G 3O6QA 4AUWA 2HODA 2WT7B 2KODA 1GXGA 3CCLP 1JEKA 4GT1A 1A02F 4ZMDA 5CCGA 2VLOA 2K9JB 1KFMA 2OYHB 1JUNA 1KILD 3SFEC 4L75A 1SQPG 1HJBA 1SQVJ 1G1IA 4L73A 2C9LY 4WY4A 1KTMA 3L75D 2KK7A 5AW9B 1N2DC 2JO1A 3Q5PA 2FYNB 1BCCJ 5APQA 2LXCB 1VQMP 3TSIA 2E42A 2ZXEB 1JCCA 3HTKB 1D7MA 1ZXGA 3H1IJ 2EG5A 5AW8B 1NTKJ 3DS1A 3L72J 2IZ0A 4WB4A 2FBWC 1ACPA 3AEDC 2FXMA 1NTMJ 2O1JA 1JTHB 2YIUC 5KP8B 1YJ9P 1VF5C 2HPCA 4UB6E 3JC22 2PEIA 4D6TE 2MR7A 5AVYB 3G21A 3LIDA 1MUUA 4C7NB 3G29A 2POHA 4F37A 1SQVK 2ZVNB 3CMAP 3G28A 2UWJE 1ZV8A 4WWIA 5APUA 3GZMA 2IX7C 4BXLA 2OTJP 2VSQA 3AEGC 2KOOA 1AYIA 3AEAC 4NEOA 3L71D 2GA1A 2KS1B 2BEZF 1YTZI 1G2CA 3AE7C 1YBKA 1RO2A 2E1MA 5F2NA 2MKVA 5DJTB 1VQKP 3CD6P 1HGZA 2N6YA 3DS5A 1NTKK 3GF7A 3DS0A 2W6JH 3B4QA 2EFJA 4N6JA 1NGMB 2JYGA 3CI9A 5BU8B 1NTMK 4JPZB 2W90A 4YTPC 4N78D 1F80D 1PGJA 3CX5I 2XZ0D 1DD4A 1IMQA 1M8OB 3JSVC 2QA4P 2R5DA 2J59M 1SFCA 4AQRD 3G9RA 4GOEA 1GK6A 4HJGH 2GDWA 3GZLA 2JYLA 2Y9ZA 1W5CE 3F89A 1SQQE 1UJZA 2PENA 2Z45A 1KB9I 1HJ0A 2KOSA 3PH0A 2M3BA 3L74E 3NMDA 2E43A 3MTUE 1E6JP 1U7MA 5GTHH 1S2EA 1K30A 2GDYA 3IFMA 3FXDA 1LTIC 1N7SD 1RY3A 2K0DX 1BXIA 3OW2O 4L76A 2ZT9D 4I6MC 1EIAA 2IYPA 7CEIA 3IF4A 2K94A 2N9YB 3OJAB 2OYHC 3VN0A 1FDIA 4GODA 2A45I 3AECC 2FAEA 3E2DA 2W83C 2KGDA 1ZRTE 4M3LA 5EW5E 1KILB 2FYNC 2PEJA 2QM7A 3CXHD 3P32A 2AFEA 2IBZE 5AVQB 1KYOH 3D6ZA 3TNUB 1GZLA 2Q3EA 3VRLC 2DW3A 1K04A 2LL8A 1FOSE 3H1JD 2WT7A 2V7QH 2OGUA 2DGYA 2YO3A 5KLVG 1BGYE 1IC2A 2K9JA 2OYHA 4PWVB 3AE9C 1OVUA 2K0XA 4C46A 5AVSB 5EJDA 2WSEH 2FXOA 1QLED 1VHNA 2L91A 1OW7A 3M9HA 3U1AA 2IFNA 5BVZA 4WYMA 2MVVA 3DTJA 4RO0A 2KOQA 5GTIE 2JDIH 5HGOA 5B5EH 4HH2A 2V7QJ 1VQ4P 1RH5B 1RE3A 2KGEA 1OWAA 3OA7A 2LR2A 3IAOA 1VQ6P 2X2BA 3D6YA 1CZQA 1S5LH 1VQ9P 1NAYA 2MJZA 1ZR4A 2CK3H 3EJEA 2HG5D 1QL2A 2L22A 2JAZA 2WSEJ 3CCQP 2M8LA 2LKMA 1LTBC 2K37A 1SQVE 1FS0E 1JY2O 4UB8E 3GJNA 2V4HA 2CG5B 1FDMA 3CMEP 4DCKA 2Q9IA 2LIUA 1AV1A 3CCUP 3H1HD 3HZQA 5KAFE 3PHLA 1SLQA 5BS1A 2BCCE 1LT9B 2FVEA 3JCUH 2AVAA 1PV3A 2JU2A 4C7NA 1HY8A 1JMBA 1BE3E 5HVCA 1SQXD 4PD4I 2A06D 3TGUJ 2FVFA 1EZVE 3LRYA 3USSA 4H2XC 4XFZA 1FC2C 4MN4C 1Q82Q 1NTME 1NVOA 2M5AB 5L8RJ 2Z5HA 3B5NA 1EC5A 5AVZB 2L6EA 1PP9D 5AW7B 5H2FE 2K2QA 1W2BO 1NQ4A 2K92A 2GUVA 5CCHA 1LTSC 3CPWO 1NO4A 3GLMA 1URQA 1EOQA 2JKVA 4PH0A 2FQ2A 3S4RA 1L2PA 3P8CE 1HTLC 4D6TG 3VMXA 1H88A 2CPSA 1Q7YQ 1DEBA 3P05A 5KJ7A 1T2KD 2YXRB 1BCCD 3CX5H 3C8VA 1N7SB 1X22A 4U3FG 1XTGB 1BSNA 3MGNA 1WT6A 1L4AD 2ZT9B 3GHGB 3LIEA 1JY2N 1S9KD 2OARA 3L70E 1N7LA 3R2PA 1KILC 1L0LD 3L37A 1OVRA 2N50A 1NTKD 3VMZA 3L72D 2KZJA 5B66E 3H1LE 4KHXA 3VP8A 4IFMA 1KB9H 2C0XA 1KLPA 4OGQD 1PGOA 3W67A 2E75D 1NKZB 2CWOA 2L4BA 2N98A 2ZAEB 4XROA 1NHLA 4R4MA 4ASWA 1R8EA 2IPPA 2NRGA 1WRGA 1NU1E 1RE4A 3CCRP 4U3FJ 1S4XA 3HRNA 1KILA 3KYQA 1GL2A 1RHZB 1IMPA 2GUSA 2P7JA 3AE8C 3CWBE 3BCCE 2IFMA 1MZ9A 2LXBA 1FZAA 5CHXA 3DS3A 2MD9A 2Q1KA 1G1JA 3M0AA 4IPYA 1M57D 1CEIA 1P84I 3H1JJ 3RL0g 3Q2YA 4BPGA 4WBAA 2N5HA 3PP5A 1LT9C 1EMVA 2E5YA 1MKMA 2C0WA 1QL1A 1QVFO 3MUDC 1JO5A 1ZP0C 4IL6E 3H1KE 3NY7B 4Z1MH 2WPTA 4U0BA 5TJHA 2IBZG 2Y0EA 3G3ZA 2AXTH 1LTAC 2QSIA 1YYCA 2GZEA 3SWFA 5AVWB 2O1KA 2KI7B 1JMMA 2Z44A 1KILE 3EJDA 1BGYG 1S72P 2PEOA 1LT9A 2YMKA 1PEUA 2QIWA 3LW5H 3MUDA 3HE5B 3L75E 4I2LC 2Q7CA 1BAJA 2FYZA 3BASA 1HF9A 1LWUA 2GZJA 1JJ2O 4JYBA 3EFFK 1CI6B 3W68A 1YHQP 1KQSO 1J1DB 3A0BH 2M5AA 1M90Q 3H32B 1JY3P 1SQXJ 4N3YB 4PD4H 1N7SC 2Q6QA 2KZIA 1OXZA 4KT0J 2ZVOB 1FZGA 1MFZA 3LW5J 4GKGA 3WUUA 2ZT9C 2BEQD 3GHGC 2MVUA 1YQ3C 2YMYA 4IFDK 2NZ2A 3AE4C 2N1TD 1L4AB 1HGVA 2ZYGA 4BWNA 2BCCG 2WPRA 4PV1D 1NTZG 3HD7D 1KYOD 4ZKUA 1T3JA 2LTEA 3EQ2A 1DX7A 1N7SA 1BE3G 4NPFX 4OGQB 5EFWB 2WWWA 3GHGA 1H0TB 1XTCC 3L71E 3V2PA 2QJYB 2E75B 2W8ZA 1H8AA 1PEMA 2KP8A 4PJ0H 5AW2B 3WU2H 3WBHA 1SQXK 1LTGC 1LT1A 3AEBC 5KLVD 2KR5A 2O3JA 1FJPA 3Q1MA 3A0HE 4N78E 1L0LJ 1FBMA 1L0NG 4TLFA 3M06A 1S5LX 4EI2A 1VQNP 2PGDA 3HUSB 2B87B 1SQPJ 3L73E 2HYNA 3TGUD 5KLIB 1EXIA 4BRYB 4XA4A 1M74A 3LMOA 5AW1B 3CXCO 2FQ1A 3RG2A 2YKOA 1NH4A 3NTNA 2KYVA 3PRJA 2VRSA 3L36A 5AVXB 1Q90D 3H1LG 1LP1B 2P2UA 2VLQA 1GW4A 1AVYA 2AXCA 5CZDB 1AF8A 2P9XA 1L0LK 3MGEA 2HFED 1FZEA 2CGQA 2I1JA 1P84H 4W7YA 2KXPB 1NU1G 3B71A 3CXHE 4GOFA 2GZGA 2H8PD 2WSCH 1IFJA 1SQPK 4I1LA 2ZXXA 2RMZA 1J1DC 2FYUG 3G1GA 2JB0A 3KZIE 3CCSP 1K73Q 2ZYAA 1Q86Q 2H43A 2KB7P 1IK7A 2Q5UA 1IFMA 1T2KC 1M6NA 3CX5D 1MV8A 1DEEG 2WSCJ 2D2CD 2OTLP 4QMAA 4I7ZB 1GK4A 4EDFA 2PY8A 2J58A 1L4AC 1L0IA 5E79E 1PPJE 2PP6A 1CI6A 3G1IA 4U3FD 5APYA 2N1TB 1BDCA 2P67A 3M0DC 2BHVA 3H6PA 2OYIB 5CCGD 1KB9D 3AEEC 1TU3F 3H1KG 2WVRA 1OZHA 1RO0A 4PV1B 3AE1C 5KP6B 4QNBA 4OGQC 3HD7B 3F5HA 3B5IA 4WY4D 1L0HA 2QJYC 2E75C 1LTTC 3H1HE 3E1IA 3PLNA 1L4AA 1SS1A 2GM4A 2CPBA 3WUTA 3WMM0 3RG6C 4Y99B 4NPDA 5APTA 2AFDA 3TK1A 2GZFA 2LPKA 1IFPA 1SQXE 3M9QA 3QH9A 2A06E 4U7JA 3GW6A 2KGCA 3M1MA 2B89A 3O8ZA 3HUSC 2E76D 1H0TA 3DPHA 1PP9E 1JOCA 5KLIC 2VLPA 2GDXA 2WMMA 1FOSF 2PAJA 3I55P 3HTKA 3TYYA 2KSJA 1RQVA 2Y9YA 5KAIE 1HUCA 1OVVA 1USEA 4W7ZA 5TISE 1S1CX 2IBZI 4WVZA 1QRJA 3RBXA 2L0QA 1SQBG 5KLVJ 2NPSD 5CMZA 1JTHA 3VMAA 1DH3A 1BCCE 3A3YB 1X79B 3DS4A 2QVAA 4GR6A 4M0IA 3D71A 3E1RA 1RF1B 2Y0DA 1VL2A 2P10A 3H1IE 2J5UA 4ZNCA 1S9KE 2WQYC 3A5TA 3V4WA 1A02J 1L0LE 2KNCB 5AVVB 3TDKA 1NTKE 3I5CA 3L72E 1USDA 5AW0B 2HLOA 1JM0A 4W80A 3E7KA 4U0CA 3G6EP 1M1KQ 2JGPA 1LP1A 1SFCD 2KS1A 1W2EA 3WU2E 3G26A 2ZYDA 5KP7B 1AQ5A 3GG2A 1SQBJ 1KQLA 2RH0A 2WZ7A 1VQ5P 4PD4D 1PEOA 5KLVK 2AEMA 1IO4A 3KDPB 4I7ZC 5I4TG 3GMAA 3L73G 3P8MC 2VLNA 3V2NA 2G8YA 3PJSK 2M8NA 2D2CB 2N1TC 4XFYA 4UB6H 1E79H 2OYIC 2OYOA 3O6QB 4PV1C 1LTJB 3HD7C 2GYKA 2HODB 1BSHA 2YKQA 2JQ4A 5HV8A 1ZOYC 2CQ8A 1Y47A 3G4SP 2E74D 2QEXP 3II6A 1NTZD 4WY4B 1JY3N 2WITA 3MZWB 4LC1A 2IZ1A 1SQBK 1M6EX 4ASVA 4Y99C 2FHSC 3RK3D 4K35A 4XRQA 2JBGA 4D6TJ 1X8YA 1BE3D 1SQPD 1Z56A 1M56D 3V2RA 5KTBA 3P7KA 2BUOA 1CW5A 1LNQA 1D1DA 4GDOA 1VQPP 2IDBA 2WSSH 2FACA 2YNYA 3V4QA 2KLVA 2ZJSE 1EDIA 3GF3A 3TNUA 2E76B 2AEJA 1IJDB 2SPZA 4H44D 1SQQG 1RF0C 2HPCB 1L0ND 1ZN5A 2MY5A 3EJBA 2QJKB 3L74G 3S1KA 1ZR2A 2EHTA 2CNRA 3M91A 1OX3A 2FY8A 1UNKA 4BPFA 5HGLA 5GTHE 3GKLC 2DNWA 1PPJG 3NTEA 4R0MA 2KG9A 3KXDA 2H88C 2R3SA 1EDKA 2NPSB 1JB0J 1RF1C 1RF0A 1G2CB 1EDJA 2KWLA 1AUMA 2MF4A 1YIJP 2KOGA 1PIXA 1PZQA 3H1HG 2OTKE 1SQQJ 1P84D 3Q20A 1QGKB 2M8RA 1KV4A 3L74J 3D70A 3B5ND 2I8DA 1KYOE 1VKUA 4U0AA 2XU6A 4IFFA 4OH8B 2P58A 1GU5A 4L74A 3CCMP 2Y0CA 2A06G 5CCHD 1CSBA 2N9BA 1AVOA 1SFCB 1RF1A 1GMJA 2PRRA 1URQD 2BASA 4DT0A 2JO0A 4LGDE 2XZRA 1VQOP 1A8OA 2FKWB 3S9OA 1A43A 2WSFH 1DIPA 1FZCB 1ZMBA 2P1JA 2FYUD 2N5IA 3RGUA 2PFXA 2EHSA 5KJ7D 4HYTB 5KLVE 2D2CC 3A7OA 4H13D 1ZLLA 5B5EE 1JY2P 5JPAA 1KORA 3CLQA 2MR8A 2YXQB 1LTJC 3U1CA 1T6AA 5GTIH 1SQQK 1S5LE 1SQVG 2H89C 1KD1Q 1FU1A 2WSFJ 5CCGC 1BGYJ 3RBZA 3L35A 3TGUE 3U43A 3B4SA 1FZBA 4WY4C 2R44A 4PXHB 4MRTC 2E74B 1YQ4C 2JJLA 3H1IG 4UB8H 5APWA 1PL5A 4IOIH 3CC4P 4H2WC 1GW3A 3JCUE 1Y9BA 1KMIZ 5KAFH 3AE6C 1EZVG 2ONTA 3RK3B 1LTJA 4UHPB 1NOHA 2W6AA 1NTMG 2Z46A 2XNXA 3KPEA 3Q3DA 3FX0A 3CCJP 4H0LD 3UIAA 1GL2D 1VQ7P 3QWOC 2E76C 2EIAA 1QEXA 4ZKPA 1PFIA 2QJKC 5F2KA 4NPEA 2BCCJ 1Q2NA 3FGAD 4A7PA 3Q5RA 5H2FH 4H44B 2JEEA 1NTZJ 3V5BA 2GZIA 2FVAA 2OQQA 3RL0D 1GPJA 3FWLA 1BE3J 1NJIQ 1HH0A 1IFIA 2LOLA 1N8RQ 1M1JB 5F2OA 4XFXA 2LIWA 2NPSC 2FFDB 4JF7A 5APVA 3CX5E 2JWDA 2ROQA 1HVVA 1OMIA 1FAVA 4RESB 3L70G 3MP7B 2XXMA 1SQBD 1Y8AA 5K5GB 2XZ1C 5AVTB 3SFDC 3H0DA 1L0NJ 4RKUJ 4U3FE 3B8EB 1T8ZA 2FQ0A 1KB9E 1QX8A 1DV5A 2AF8A 2RKLA 5B66H 5AW5B 5DCKA 2NPSA 1SFCC 4DG9A 3KHUA 2WTYA 3B5NB 1NTZK 4EYYQ 2ITAA 3CCVP 2K88A 1OFCX 1U7JA 2KLUA 3MIWA 2M8PA 1FR2A 1KZUB 1FZCC 2B88A 2XV6A 3CE7A 2L5GB 1URQB 1K05A 2XDJA 3H1JE 3CWBG 3BCCG 3L70J 3N7NA 4IZ6A 1KFNA 1R5SA 3KQGA 1SP4A 3H1LJ 4YPCA 5APXA 5CJ4A 1DNYA 4H13B 3CC2P 2KW2A 1J2JB 3HE5A 4D6TD 1T8KA 1FDOA 4COCA 3H4EA 3L73D 1L0NK 3G71P 1KQGB 2BQ1E 1EDLA 2KUBA 3Q5SA 4O9BA 3EFGA 1FZCA 3RK2D 1NU1J 2JU1A 3ABVC 1GXHA 2E74C 3H32A 4BPHA 3NFQA 4CPGA 2PNGA 3IR9A 1IUQA 3V2QA 1RQUA 2QM8A 3CXHI 5AW6B 1OR5A 1IK9A 1YTZT 2FYUJ 3HE4B 3RK3C 3CWBJ 1K9MQ 2Z5IA 3BCCJ 1NYHA 2H7HA 3CL3D 4YXWH 2PEQA 1AJYA 5AW4B 3DS2A 4EOTA 1MZ8A 2AXTE 4IL6H 1UIIA 2PEKA 1KC8Q 2NO8A 1NKNA 2KIKA 1MFTA 1FE6A 3L75G 4RJTA 4H0LB 1GL2B 3M0DA 1IZNB 2XNDH 4DOJA 3K5BA 2B9BA 5HGNA 2G3AA 4H44C 2KORA 5CJ0A 1ZW0A 1RE3C 3AEFC 2ERHA 2LKIA 1E0HA 3SSUA 3OAKA 1NU1K 3H1KJ 1YI2P 1JCDA 2FADA 1IFDA 3H47A 2JP3A 5HGMA 1M1JC 1SQQD 2RN0A 3A0BE 2FFDC 4U0EA 3RL0B 3L74D 1PGQA 4PD4E 2FYUK 4U0FA 2K93A 1NAFA 4HKGA 5APSA 3WUVA 3G0VA 2N6ZA 3T97B 4JBZA 1PPJD 3TGUG 3HUSA 3L75J 3M9BA 2W27A 2B87A 3VMYA 4LLHA 4HB1A 1VF5D 1FZFA 5BU5A 4HKZH 2FXPA 2K3RA 2Q3IA 4BRYA 2ZFCA 1JY3O 1H89A 1M1JA 1M7LA 1NWQA 3BATA 2I1KA 2FFDA 2E5TA 3B5NC 1ZRTD 1WMKA 3SWYA 3L71G 4EIJA 1J1EB 2XKMA 2IBZD 3A2AA 5CCHC 1NTZE 1VQLP 1URQC 3NXSA 3RK3E 4PJ0E 1BGYD 3HYBA 1SQPE 1LWUB 3ITKA 3C9IA 3EWKA 3VOPA 5KJ7C 1U57A 4H13C 4H2YC 4GIFA 5KKZB 1JNMA 1N73B 1PEQA 3IN6A 3A0HH 2KG8A 1Z6MA 3H25A 5DJUB 5CBOA 2K0YA 3L71J 2R3CA 1GU4A 4OWFA 1L0NE 1PGPA 5M1BA 2PEMA 2R32A 2O01N 1EZVI 3RK2B 1SQVD 1GD2E 1N86A 3R4YA 2K9YA 5C39A 3MHVA 3ZDMA 4XFJA 2R5BA 2BCCD 2QJPB 1HBWA 2M5RA 1ZMEC 2WPQA 3H1ID 1RE4C 5CBNA 1AA0A 1SVFA 2N1TA 3L73J 2YO2A 2QE7H 4H0LC 1RNIA 1K8AQ 1EZVD 1GL2C 2OYIA 2M0BA 4CA3A 1P84E 1NTMD 3HD7A 3HE4A 3PTZA 4TT3H 2QNWA 3H1JG 1X3OA 1Q81Q 1IFNA 3CXHH 2A45G 1E5WA 1EQ7A 5BS2A 3RL0C 2QG4A 4AYCA 5AVRB 2LF4A 3VYIA 1T3UA 3P8CD 3KZIH 4GR2A 2A45H 2FYUE 3N4XA 1S3JA 2IYOA 3AE2C 3BVHA 2KOPA 1YJNP 2HR3A 2W6BA 3SWKA 2XV5A 2Z4EA 1EXJA 2YIUB 1VF5B 2JWAA 5E79H 5AVUB 4YXDC 3CC7P 3L70D 3MD0A 1VQ8P 1J1EC 3H1LD 4K3AA 3VTPC 4PH1A 3C1LA 3FXEA 3AE5C 3T97A 2WPVB 1LJ2A 1KN7A 4R4LA 1VDFA 2K5XA 4B86A 1UIXA 1OW8A 3L4FA 1LWUC 1KQFB 4XE5B 1SQXG 1GDTA 2XT1A 1GTWA 1ZNVA 4COPA 3CCEP 1NU1D 4KJMA 2L9FA 5KKZC 2QRXA 1N73C 3BRVB 4OVNF 2KNCA 1VPCA 1R5LA 1PP9G 2JR8A 1QVGO 2O01H 2C9NY 3CWBD 2M3EA 3BCCD 1DD3A 3TF5A 3H1HJ 2KSEA 1HWTC 1YITP 3VP9A 4C7RA 3FWNA 2KGAA 4DJGA 1HQBA 3RK2C 1X0TA 1OW6A 4Y28J 1AQTA 1YJWP 1FJKA 1X9VA 3V6IA 4U0DA 1N73A 2O01J
chains in the Genus database with same CATH topology
1M6NA 3G29A 2M8PA 2CWOA 3CMAP 2Z46A 3G28A 1BAJA 1VQNP 3Q20A 4XROA 1QRJA 2OTLP 2XV6A 3G4SP 1YI2P 1YJNP 2PY8A 3CCJP 2OTJP 2QEXP 3H47A 3E2DA 1JJ2O 5HGMA 3CCRP 1VQ7P 3LRYA 2PEJA 4U0EA 4U0AA 4XFZA 1Q82Q 2EIAA 3I56P 3DS4A 1M6EX 2PEMA 1YHQP 1KQSO 3G1IA 1M74A 4XRQA 3CCMP 4GR6A 3CC7P 3CXCO 4M0IA 1M90Q 2L6EA 3VRLC 1RO2A 2E1MA 4U0FA 1VQ8P 5F2NA 2BHVA 1W2BO 3G0VA 4PH1A 2BUOA 2KODA 5F2KA 1VQKP 3CC2P 3CD6P 3DS5A 3CCLP 2DGYA 1RO0A 3CPWO 2JO0A 4COCA 3H4EA 4QNBA 3DS0A 1VQPP 1D1DA 2EFJA 1VQOP 1A8OA 3G71P 2BQ1E 3B5IA 1A43A 2JYGA 3DS3A 1EOQA 4PH0A 1ZMBA 4IPYA 1NJIQ 4U0CA 3G6EP 1M1KQ 1N8RQ 2QA4P 5F2OA 2XT1A 1Q7YQ 4XFXA 3G26A 3P05A 1VQMP 4COPA 1RNIA 1K8AQ 2P9XA 3RG6C 3CCEP 4WYMA 1IUQA 5JPAA 3DTJA 3MGEA 5HGOA 2JYLA 1VQ4P 1K9MQ 1QVFO 1VQ5P 2EG5A 1PEOA 2XXMA 1QVGO 1KD1Q 1VQ6P 2PENA 2Z45A 3M1MA 2PEQA 1VQ9P 5HGLA 3DS1A 5I4TG 1VQLP 3DS2A 3H0DA 1Q81Q 4U0BA 3CCQP 2M8LA 2PEKA 2OARA 1E6JP 3NTEA 3DPHA 1KC8Q 3HYBA 1K30A 5BS2A 1PEMA 2M8NA 1YJ9P 1YITP 3WBHA 3CMEP 3G1GA 2LF4A 3OW2O 2PEIA 3CCUP 3CCSP 4XFYA 1K73Q 3HZQA 3G21A 5DCKA 3I55P 5BS1A 3CC4P 2Z44A 1Q86Q 1YJWP 3CCVP 1S72P 1EIAA 5HGNA 1AUMA 2PEOA 1YIJP 4GR2A 1PEQA 2ONTA 4U0DA 1PEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 Q;  2QA4 P;  3CCQ P;  1Q7Y Q;  1VQM P;  1W2B O;  3CMA P;  3CC2 P;  1VQK P;  3CD6 P;  1KC8 Q;  1K8A Q;  3CCE P;  1VQN P;  3CCL P;  3CPW O;  2OTL P;  3G4S P;  1YI2 P;  1YJ9 P;  1YIT P;  1YJN P;  1VQP P;  3CME P;  3CCJ P;  1VQO P;  3OW2 O;  3G71 P;  2QEX P;  3CCU P;  2OTJ P;  1JJ2 O;  1VQ4 P;  3CCS P;  1M90 Q;  3CCR P;  1K73 Q;  1VQ7 P;  1K9M Q;  1QVF O;  1VQ5 P;  1VQL P;  3I55 P;  1Q82 Q;  3I56 P;  3CC4 P;  1Q86 Q;  1QVG O;  1KD1 Q;  1VQ6 P;  1YJW P;  1YHQ P;  1NJI Q;  3CCV P;  1S72 P;  1KQS O;  3G6E P;  1YIJ P;  1VQ9 P;  1M1K Q;  3CCM P;  3CC7 P;  3CXC O;  1VQ8 P;  1N8R Q; 
#chains in the Genus database with same CATH topology
 5KAI H;  1AFO A;  1KYO I;  1BCC G;  5AW3 B;  4JQ0 D;  2QJP C;  2YKP A;  4IL6 X;  4JYC A;  2LML A;  5TIS H;  3BRT B;  1BDD A;  1OIP A;  4QKO A;  2AEF A;  1LGH B;  1PP9 J;  3H1K D;  3I56 P;  3AE3 C;  2WPS A;  2K1A A;  1L0L G;  3U59 A;  4DZO A;  2KG6 A;  1SQB E;  1NTK G;  3L72 G;  3O6Q A;  4AUW A;  2HOD A;  2WT7 B;  2KOD A;  1GXG A;  3CCL P;  1JEK A;  4GT1 A;  1A02 F;  4ZMD A;  5CCG A;  2VLO A;  2K9J B;  1KFM A;  2OYH B;  1JUN A;  1KIL D;  3SFE C;  4L75 A;  1SQP G;  1HJB A;  1SQV J;  1G1I A;  4L73 A;  2C9L Y;  4WY4 A;  1KTM A;  3L75 D;  2KK7 A;  5AW9 B;  1N2D C;  2JO1 A;  3Q5P A;  2FYN B;  1BCC J;  5APQ A;  2LXC B;  1VQM P;  3TSI A;  2E42 A;  2ZXE B;  1JCC A;  3HTK B;  1D7M A;  1ZXG A;  3H1I J;  2EG5 A;  5AW8 B;  1NTK J;  3DS1 A;  3L72 J;  2IZ0 A;  4WB4 A;  2FBW C;  1ACP A;  3AED C;  2FXM A;  1NTM J;  2O1J A;  1JTH B;  2YIU C;  5KP8 B;  1YJ9 P;  1VF5 C;  2HPC A;  4UB6 E;  3JC2 2;  2PEI A;  4D6T E;  2MR7 A;  5AVY B;  3G21 A;  3LID A;  1MUU A;  4C7N B;  3G29 A;  2POH A;  4F37 A;  1SQV K;  2ZVN B;  3CMA P;  3G28 A;  2UWJ E;  1ZV8 A;  4WWI A;  5APU A;  3GZM A;  2IX7 C;  4BXL A;  2OTJ P;  2VSQ A;  3AEG C;  2KOO A;  1AYI A;  3AEA C;  4NEO A;  3L71 D;  2GA1 A;  2KS1 B;  2BEZ F;  1YTZ I;  1G2C A;  3AE7 C;  1YBK A;  1RO2 A;  2E1M A;  5F2N A;  2MKV A;  5DJT B;  1VQK P;  3CD6 P;  1HGZ A;  2N6Y A;  3DS5 A;  1NTK K;  3GF7 A;  3DS0 A;  2W6J H;  3B4Q A;  2EFJ A;  4N6J A;  1NGM B;  2JYG A;  3CI9 A;  5BU8 B;  1NTM K;  4JPZ B;  2W90 A;  4YTP C;  4N78 D;  1F80 D;  1PGJ A;  3CX5 I;  2XZ0 D;  1DD4 A;  1IMQ A;  1M8O B;  3JSV C;  2QA4 P;  2R5D A;  2J59 M;  1SFC A;  4AQR D;  3G9R A;  4GOE A;  1GK6 A;  4HJG H;  2GDW A;  3GZL A;  2JYL A;  2Y9Z A;  1W5C E;  3F89 A;  1SQQ E;  1UJZ A;  2PEN A;  2Z45 A;  1KB9 I;  1HJ0 A;  2KOS A;  3PH0 A;  2M3B A;  3L74 E;  3NMD A;  2E43 A;  3MTU E;  1E6J P;  1U7M A;  5GTH H;  1S2E A;  1K30 A;  2GDY A;  3IFM A;  3FXD A;  1LTI C;  1N7S D;  1RY3 A;  2K0D X;  1BXI A;  3OW2 O;  4L76 A;  2ZT9 D;  4I6M C;  1EIA A;  2IYP A;  7CEI A;  3IF4 A;  2K94 A;  2N9Y B;  3OJA B;  2OYH C;  3VN0 A;  1FDI A;  4GOD A;  2A45 I;  3AEC C;  2FAE A;  3E2D A;  2W83 C;  2KGD A;  1ZRT E;  4M3L A;  5EW5 E;  1KIL B;  2FYN C;  2PEJ A;  2QM7 A;  3CXH D;  3P32 A;  2AFE A;  2IBZ E;  5AVQ B;  1KYO H;  3D6Z A;  3TNU B;  1GZL A;  2Q3E A;  3VRL C;  2DW3 A;  1K04 A;  2LL8 A;  1FOS E;  3H1J D;  2WT7 A;  2V7Q H;  2OGU A;  2DGY A;  2YO3 A;  5KLV G;  1BGY E;  1IC2 A;  2K9J A;  2OYH A;  4PWV B;  3AE9 C;  1OVU A;  2K0X A;  4C46 A;  5AVS B;  5EJD A;  2WSE H;  2FXO A;  1QLE D;  1VHN A;  2L91 A;  1OW7 A;  3M9H A;  3U1A A;  2IFN A;  5BVZ A;  4WYM A;  2MVV A;  3DTJ A;  4RO0 A;  2KOQ A;  5GTI E;  2JDI H;  5HGO A;  5B5E H;  4HH2 A;  2V7Q J;  1VQ4 P;  1RH5 B;  1RE3 A;  2KGE A;  1OWA A;  3OA7 A;  2LR2 A;  3IAO A;  1VQ6 P;  2X2B A;  3D6Y A;  1CZQ A;  1S5L H;  1VQ9 P;  1NAY A;  2MJZ A;  1ZR4 A;  2CK3 H;  3EJE A;  2HG5 D;  1QL2 A;  2L22 A;  2JAZ A;  2WSE J;  3CCQ P;  2M8L A;  2LKM A;  1LTB C;  2K37 A;  1SQV E;  1FS0 E;  1JY2 O;  4UB8 E;  3GJN A;  2V4H A;  2CG5 B;  1FDM A;  3CME P;  4DCK A;  2Q9I A;  2LIU A;  1AV1 A;  3CCU P;  3H1H D;  3HZQ A;  5KAF E;  3PHL A;  1SLQ A;  5BS1 A;  2BCC E;  1LT9 B;  2FVE A;  3JCU H;  2AVA A;  1PV3 A;  2JU2 A;  4C7N A;  1HY8 A;  1JMB A;  1BE3 E;  5HVC A;  1SQX D;  4PD4 I;  2A06 D;  3TGU J;  2FVF A;  1EZV E;  3LRY A;  3USS A;  4H2X C;  4XFZ A;  1FC2 C;  4MN4 C;  1Q82 Q;  1NTM E;  1NVO A;  2M5A B;  5L8R J;  2Z5H A;  3B5N A;  1EC5 A;  5AVZ B;  2L6E A;  1PP9 D;  5AW7 B;  5H2F E;  2K2Q A;  1W2B O;  1NQ4 A;  2K92 A;  2GUV A;  5CCH A;  1LTS C;  3CPW O;  1NO4 A;  3GLM A;  1URQ A;  1EOQ A;  2JKV A;  4PH0 A;  2FQ2 A;  3S4R A;  1L2P A;  3P8C E;  1HTL C;  4D6T G;  3VMX A;  1H88 A;  2CPS A;  1Q7Y Q;  1DEB A;  3P05 A;  5KJ7 A;  1T2K D;  2YXR B;  1BCC D;  3CX5 H;  3C8V A;  1N7S B;  1X22 A;  4U3F G;  1XTG B;  1BSN A;  3MGN A;  1WT6 A;  1L4A D;  2ZT9 B;  3GHG B;  3LIE A;  1JY2 N;  1S9K D;  2OAR A;  3L70 E;  1N7L A;  3R2P A;  1KIL C;  1L0L D;  3L37 A;  1OVR A;  2N50 A;  1NTK D;  3VMZ A;  3L72 D;  2KZJ A;  5B66 E;  3H1L E;  4KHX A;  3VP8 A;  4IFM A;  1KB9 H;  2C0X A;  1KLP A;  4OGQ D;  1PGO A;  3W67 A;  2E75 D;  1NKZ B;  2CWO A;  2L4B A;  2N98 A;  2ZAE B;  4XRO A;  1NHL A;  4R4M A;  4ASW A;  1R8E A;  2IPP A;  2NRG A;  1WRG A;  1NU1 E;  1RE4 A;  3CCR P;  4U3F J;  1S4X A;  3HRN A;  1KIL A;  3KYQ A;  1GL2 A;  1RHZ B;  1IMP A;  2GUS A;  2P7J A;  3AE8 C;  3CWB E;  3BCC E;  2IFM A;  1MZ9 A;  2LXB A;  1FZA A;  5CHX A;  3DS3 A;  2MD9 A;  2Q1K A;  1G1J A;  3M0A A;  4IPY A;  1M57 D;  1CEI A;  1P84 I;  3H1J J;  3RL0 g;  3Q2Y A;  4BPG A;  4WBA A;  2N5H A;  3PP5 A;  1LT9 C;  1EMV A;  2E5Y A;  1MKM A;  2C0W A;  1QL1 A;  1QVF O;  3MUD C;  1JO5 A;  1ZP0 C;  4IL6 E;  3H1K E;  3NY7 B;  4Z1M H;  2WPT A;  4U0B A;  5TJH A;  2IBZ G;  2Y0E A;  3G3Z A;  2AXT H;  1LTA C;  2QSI A;  1YYC A;  2GZE A;  3SWF A;  5AVW B;  2O1K A;  2KI7 B;  1JMM A;  2Z44 A;  1KIL E;  3EJD A;  1BGY G;  1S72 P;  2PEO A;  1LT9 A;  2YMK A;  1PEU A;  2QIW A;  3LW5 H;  3MUD A;  3HE5 B;  3L75 E;  4I2L C;  2Q7C A;  1BAJ A;  2FYZ A;  3BAS A;  1HF9 A;  1LWU A;  2GZJ A;  1JJ2 O;  4JYB A;  3EFF K;  1CI6 B;  3W68 A;  1YHQ P;  1KQS O;  1J1D B;  3A0B H;  2M5A A;  1M90 Q;  3H32 B;  1JY3 P;  1SQX J;  4N3Y B;  4PD4 H;  1N7S C;  2Q6Q A;  2KZI A;  1OXZ A;  4KT0 J;  2ZVO B;  1FZG A;  1MFZ A;  3LW5 J;  4GKG A;  3WUU A;  2ZT9 C;  2BEQ D;  3GHG C;  2MVU A;  1YQ3 C;  2YMY A;  4IFD K;  2NZ2 A;  3AE4 C;  2N1T D;  1L4A B;  1HGV A;  2ZYG A;  4BWN A;  2BCC G;  2WPR A;  4PV1 D;  1NTZ G;  3HD7 D;  1KYO D;  4ZKU A;  1T3J A;  2LTE A;  3EQ2 A;  1DX7 A;  1N7S A;  1BE3 G;  4NPF X;  4OGQ B;  5EFW B;  2WWW A;  3GHG A;  1H0T B;  1XTC C;  3L71 E;  3V2P A;  2QJY B;  2E75 B;  2W8Z A;  1H8A A;  1PEM A;  2KP8 A;  4PJ0 H;  5AW2 B;  3WU2 H;  3WBH A;  1SQX K;  1LTG C;  1LT1 A;  3AEB C;  5KLV D;  2KR5 A;  2O3J A;  1FJP A;  3Q1M A;  3A0H E;  4N78 E;  1L0L J;  1FBM A;  1L0N G;  4TLF A;  3M06 A;  1S5L X;  4EI2 A;  1VQN P;  2PGD A;  3HUS B;  2B87 B;  1SQP J;  3L73 E;  2HYN A;  3TGU D;  5KLI B;  1EXI A;  4BRY B;  4XA4 A;  1M74 A;  3LMO A;  5AW1 B;  3CXC O;  2FQ1 A;  3RG2 A;  2YKO A;  1NH4 A;  3NTN A;  2KYV A;  3PRJ A;  2VRS A;  3L36 A;  5AVX B;  1Q90 D;  3H1L G;  1LP1 B;  2P2U A;  2VLQ A;  1GW4 A;  1AVY A;  2AXC A;  5CZD B;  1AF8 A;  2P9X A;  1L0L K;  3MGE A;  2HFE D;  1FZE A;  2CGQ A;  2I1J A;  1P84 H;  4W7Y A;  2KXP B;  1NU1 G;  3B71 A;  3CXH E;  4GOF A;  2GZG A;  2H8P D;  2WSC H;  1IFJ A;  1SQP K;  4I1L A;  2ZXX A;  2RMZ A;  1J1D C;  2FYU G;  3G1G A;  2JB0 A;  3KZI E;  3CCS P;  1K73 Q;  2ZYA A;  1Q86 Q;  2H43 A;  2KB7 P;  1IK7 A;  2Q5U A;  1IFM A;  1T2K C;  1M6N A;  3CX5 D;  1MV8 A;  1DEE G;  2WSC J;  2D2C D;  2OTL P;  4QMA A;  4I7Z B;  1GK4 A;  4EDF A;  2PY8 A;  2J58 A;  1L4A C;  1L0I A;  5E79 E;  1PPJ E;  2PP6 A;  1CI6 A;  3G1I A;  4U3F D;  5APY A;  2N1T B;  1BDC A;  2P67 A;  3M0D C;  2BHV A;  3H6P A;  2OYI B;  5CCG D;  1KB9 D;  3AEE C;  1TU3 F;  3H1K G;  2WVR A;  1OZH A;  1RO0 A;  4PV1 B;  3AE1 C;  5KP6 B;  4QNB A;  4OGQ C;  3HD7 B;  3F5H A;  3B5I A;  4WY4 D;  1L0H A;  2QJY C;  2E75 C;  1LTT C;  3H1H E;  3E1I A;  3PLN A;  1L4A A;  1SS1 A;  2GM4 A;  2CPB A;  3WUT A;  3WMM 0;  3RG6 C;  4Y99 B;  4NPD A;  5APT A;  2AFD A;  3TK1 A;  2GZF A;  2LPK A;  1IFP A;  1SQX E;  3M9Q A;  3QH9 A;  2A06 E;  4U7J A;  3GW6 A;  2KGC A;  3M1M A;  2B89 A;  3O8Z A;  3HUS C;  2E76 D;  1H0T A;  3DPH A;  1PP9 E;  1JOC A;  5KLI C;  2VLP A;  2GDX A;  2WMM A;  1FOS F;  2PAJ A;  3I55 P;  3HTK A;  3TYY A;  2KSJ A;  1RQV A;  2Y9Y A;  5KAI E;  1HUC A;  1OVV A;  1USE A;  4W7Z A;  5TIS E;  1S1C X;  2IBZ I;  4WVZ A;  1QRJ A;  3RBX A;  2L0Q A;  1SQB G;  5KLV J;  2NPS D;  5CMZ A;  1JTH A;  3VMA A;  1DH3 A;  1BCC E;  3A3Y B;  1X79 B;  3DS4 A;  2QVA A;  4GR6 A;  4M0I A;  3D71 A;  3E1R A;  1RF1 B;  2Y0D A;  1VL2 A;  2P10 A;  3H1I E;  2J5U A;  4ZNC A;  1S9K E;  2WQY C;  3A5T A;  3V4W A;  1A02 J;  1L0L E;  2KNC B;  5AVV B;  3TDK A;  1NTK E;  3I5C A;  3L72 E;  1USD A;  5AW0 B;  2HLO A;  1JM0 A;  4W80 A;  3E7K A;  4U0C A;  3G6E P;  1M1K Q;  2JGP A;  1LP1 A;  1SFC D;  2KS1 A;  1W2E A;  3WU2 E;  3G26 A;  2ZYD A;  5KP7 B;  1AQ5 A;  3GG2 A;  1SQB J;  1KQL A;  2RH0 A;  2WZ7 A;  1VQ5 P;  4PD4 D;  1PEO A;  5KLV K;  2AEM A;  1IO4 A;  3KDP B;  4I7Z C;  5I4T G;  3GMA A;  3L73 G;  3P8M C;  2VLN A;  3V2N A;  2G8Y A;  3PJS K;  2M8N A;  2D2C B;  2N1T C;  4XFY A;  4UB6 H;  1E79 H;  2OYI C;  2OYO A;  3O6Q B;  4PV1 C;  1LTJ B;  3HD7 C;  2GYK A;  2HOD B;  1BSH A;  2YKQ A;  2JQ4 A;  5HV8 A;  1ZOY C;  2CQ8 A;  1Y47 A;  3G4S P;  2E74 D;  2QEX P;  3II6 A;  1NTZ D;  4WY4 B;  1JY3 N;  2WIT A;  3MZW B;  4LC1 A;  2IZ1 A;  1SQB K;  1M6E X;  4ASV A;  4Y99 C;  2FHS C;  3RK3 D;  4K35 A;  4XRQ A;  2JBG A;  4D6T J;  1X8Y A;  1BE3 D;  1SQP D;  1Z56 A;  1M56 D;  3V2R A;  5KTB A;  3P7K A;  2BUO A;  1CW5 A;  1LNQ A;  1D1D A;  4GDO A;  1VQP P;  2IDB A;  2WSS H;  2FAC A;  2YNY A;  3V4Q A;  2KLV A;  2ZJS E;  1EDI A;  3GF3 A;  3TNU A;  2E76 B;  2AEJ A;  1IJD B;  2SPZ A;  4H44 D;  1SQQ G;  1RF0 C;  2HPC B;  1L0N D;  1ZN5 A;  2MY5 A;  3EJB A;  2QJK B;  3L74 G;  3S1K A;  1ZR2 A;  2EHT A;  2CNR A;  3M91 A;  1OX3 A;  2FY8 A;  1UNK A;  4BPF A;  5HGL A;  5GTH E;  3GKL C;  2DNW A;  1PPJ G;  3NTE A;  4R0M A;  2KG9 A;  3KXD A;  2H88 C;  2R3S A;  1EDK A;  2NPS B;  1JB0 J;  1RF1 C;  1RF0 A;  1G2C B;  1EDJ A;  2KWL A;  1AUM A;  2MF4 A;  1YIJ P;  2KOG A;  1PIX A;  1PZQ A;  3H1H G;  2OTK E;  1SQQ J;  1P84 D;  3Q20 A;  1QGK B;  2M8R A;  1KV4 A;  3L74 J;  3D70 A;  3B5N D;  2I8D A;  1KYO E;  1VKU A;  4U0A A;  2XU6 A;  4IFF A;  4OH8 B;  2P58 A;  1GU5 A;  4L74 A;  3CCM P;  2Y0C A;  2A06 G;  5CCH D;  1CSB A;  2N9B A;  1AVO A;  1SFC B;  1RF1 A;  1GMJ A;  2PRR A;  1URQ D;  2BAS A;  4DT0 A;  2JO0 A;  4LGD E;  2XZR A;  1VQO P;  1A8O A;  2FKW B;  3S9O A;  1A43 A;  2WSF H;  1DIP A;  1FZC B;  1ZMB A;  2P1J A;  2FYU D;  2N5I A;  3RGU A;  2PFX A;  2EHS A;  5KJ7 D;  4HYT B;  5KLV E;  2D2C C;  3A7O A;  4H13 D;  1ZLL A;  5B5E E;  1JY2 P;  5JPA A;  1KOR A;  3CLQ A;  2MR8 A;  2YXQ B;  1LTJ C;  3U1C A;  1T6A A;  5GTI H;  1SQQ K;  1S5L E;  1SQV G;  2H89 C;  1KD1 Q;  1FU1 A;  2WSF J;  5CCG C;  1BGY J;  3RBZ A;  3L35 A;  3TGU E;  3U43 A;  3B4S A;  1FZB A;  4WY4 C;  2R44 A;  4PXH B;  4MRT C;  2E74 B;  1YQ4 C;  2JJL A;  3H1I G;  4UB8 H;  5APW A;  1PL5 A;  4IOI H;  3CC4 P;  4H2W C;  1GW3 A;  3JCU E;  1Y9B A;  1KMI Z;  5KAF H;  3AE6 C;  1EZV G;  2ONT A;  3RK3 B;  1LTJ A;  4UHP B;  1NOH A;  2W6A A;  1NTM G;  2Z46 A;  2XNX A;  3KPE A;  3Q3D A;  3FX0 A;  3CCJ P;  4H0L D;  3UIA A;  1GL2 D;  1VQ7 P;  3QWO C;  2E76 C;  2EIA A;  1QEX A;  4ZKP A;  1PFI A;  2QJK C;  5F2K A;  4NPE A;  2BCC J;  1Q2N A;  3FGA D;  4A7P A;  3Q5R A;  5H2F H;  4H44 B;  2JEE A;  1NTZ J;  3V5B A;  2GZI A;  2FVA A;  2OQQ A;  3RL0 D;  1GPJ A;  3FWL A;  1BE3 J;  1NJI Q;  1HH0 A;  1IFI A;  2LOL A;  1N8R Q;  1M1J B;  5F2O A;  4XFX A;  2LIW A;  2NPS C;  2FFD B;  4JF7 A;  5APV A;  3CX5 E;  2JWD A;  2ROQ A;  1HVV A;  1OMI A;  1FAV A;  4RES B;  3L70 G;  3MP7 B;  2XXM A;  1SQB D;  1Y8A A;  5K5G B;  2XZ1 C;  5AVT B;  3SFD C;  3H0D A;  1L0N J;  4RKU J;  4U3F E;  3B8E B;  1T8Z A;  2FQ0 A;  1KB9 E;  1QX8 A;  1DV5 A;  2AF8 A;  2RKL A;  5B66 H;  5AW5 B;  5DCK A;  2NPS A;  1SFC C;  4DG9 A;  3KHU A;  2WTY A;  3B5N B;  1NTZ K;  4EYY Q;  2ITA A;  3CCV P;  2K88 A;  1OFC X;  1U7J A;  2KLU A;  3MIW A;  2M8P A;  1FR2 A;  1KZU B;  1FZC C;  2B88 A;  2XV6 A;  3CE7 A;  2L5G B;  1URQ B;  1K05 A;  2XDJ A;  3H1J E;  3CWB G;  3BCC G;  3L70 J;  3N7N A;  4IZ6 A;  1KFN A;  1R5S A;  3KQG A;  1SP4 A;  3H1L J;  4YPC A;  5APX A;  5CJ4 A;  1DNY A;  4H13 B;  3CC2 P;  2KW2 A;  1J2J B;  3HE5 A;  4D6T D;  1T8K A;  1FDO A;  4COC A;  3H4E A;  3L73 D;  1L0N K;  3G71 P;  1KQG B;  2BQ1 E;  1EDL A;  2KUB A;  3Q5S A;  4O9B A;  3EFG A;  1FZC A;  3RK2 D;  1NU1 J;  2JU1 A;  3ABV C;  1GXH A;  2E74 C;  3H32 A;  4BPH A;  3NFQ A;  4CPG A;  2PNG A;  3IR9 A;  1IUQ A;  3V2Q A;  1RQU A;  2QM8 A;  3CXH I;  5AW6 B;  1OR5 A;  1IK9 A;  1YTZ T;  2FYU J;  3HE4 B;  3RK3 C;  3CWB J;  1K9M Q;  2Z5I A;  3BCC J;  1NYH A;  2H7H A;  3CL3 D;  4YXW H;  2PEQ A;  1AJY A;  5AW4 B;  3DS2 A;  4EOT A;  1MZ8 A;  2AXT E;  4IL6 H;  1UII A;  2PEK A;  1KC8 Q;  2NO8 A;  1NKN A;  2KIK A;  1MFT A;  1FE6 A;  3L75 G;  4RJT A;  4H0L B;  1GL2 B;  3M0D A;  1IZN B;  2XND H;  4DOJ A;  3K5B A;  2B9B A;  5HGN A;  2G3A A;  4H44 C;  2KOR A;  5CJ0 A;  1ZW0 A;  1RE3 C;  3AEF C;  2ERH A;  2LKI A;  1E0H A;  3SSU A;  3OAK A;  1NU1 K;  3H1K J;  1YI2 P;  1JCD A;  2FAD A;  1IFD A;  3H47 A;  2JP3 A;  5HGM A;  1M1J C;  1SQQ D;  2RN0 A;  3A0B E;  2FFD C;  4U0E A;  3RL0 B;  3L74 D;  1PGQ A;  4PD4 E;  2FYU K;  4U0F A;  2K93 A;  1NAF A;  4HKG A;  5APS A;  3WUV A;  3G0V A;  2N6Z A;  3T97 B;  4JBZ A;  1PPJ D;  3TGU G;  3HUS A;  3L75 J;  3M9B A;  2W27 A;  2B87 A;  3VMY A;  4LLH A;  4HB1 A;  1VF5 D;  1FZF A;  5BU5 A;  4HKZ H;  2FXP A;  2K3R A;  2Q3I A;  4BRY A;  2ZFC A;  1JY3 O;  1H89 A;  1M1J A;  1M7L A;  1NWQ A;  3BAT A;  2I1K A;  2FFD A;  2E5T A;  3B5N C;  1ZRT D;  1WMK A;  3SWY A;  3L71 G;  4EIJ A;  1J1E B;  2XKM A;  2IBZ D;  3A2A A;  5CCH C;  1NTZ E;  1VQL P;  1URQ C;  3NXS A;  3RK3 E;  4PJ0 E;  1BGY D;  3HYB A;  1SQP E;  1LWU B;  3ITK A;  3C9I A;  3EWK A;  3VOP A;  5KJ7 C;  1U57 A;  4H13 C;  4H2Y C;  4GIF A;  5KKZ B;  1JNM A;  1N73 B;  1PEQ A;  3IN6 A;  3A0H H;  2KG8 A;  1Z6M A;  3H25 A;  5DJU B;  5CBO A;  2K0Y A;  3L71 J;  2R3C A;  1GU4 A;  4OWF A;  1L0N E;  1PGP A;  5M1B A;  2PEM A;  2R32 A;  2O01 N;  1EZV I;  3RK2 B;  1SQV D;  1GD2 E;  1N86 A;  3R4Y A;  2K9Y A;  5C39 A;  3MHV A;  3ZDM A;  4XFJ A;  2R5B A;  2BCC D;  2QJP B;  1HBW A;  2M5R A;  1ZME C;  2WPQ A;  3H1I D;  1RE4 C;  5CBN A;  1AA0 A;  1SVF A;  2N1T A;  3L73 J;  2YO2 A;  2QE7 H;  4H0L C;  1RNI A;  1K8A Q;  1EZV D;  1GL2 C;  2OYI A;  2M0B A;  4CA3 A;  1P84 E;  1NTM D;  3HD7 A;  3HE4 A;  3PTZ A;  4TT3 H;  2QNW A;  3H1J G;  1X3O A;  1Q81 Q;  1IFN A;  3CXH H;  2A45 G;  1E5W A;  1EQ7 A;  5BS2 A;  3RL0 C;  2QG4 A;  4AYC A;  5AVR B;  2LF4 A;  3VYI A;  1T3U A;  3P8C D;  3KZI H;  4GR2 A;  2A45 H;  2FYU E;  3N4X A;  1S3J A;  2IYO A;  3AE2 C;  3BVH A;  2KOP A;  1YJN P;  2HR3 A;  2W6B A;  3SWK A;  2XV5 A;  2Z4E A;  1EXJ A;  2YIU B;  1VF5 B;  2JWA A;  5E79 H;  5AVU B;  4YXD C;  3CC7 P;  3L70 D;  3MD0 A;  1VQ8 P;  1J1E C;  3H1L D;  4K3A A;  3VTP C;  4PH1 A;  3C1L A;  3FXE A;  3AE5 C;  3T97 A;  2WPV B;  1LJ2 A;  1KN7 A;  4R4L A;  1VDF A;  2K5X A;  4B86 A;  1UIX A;  1OW8 A;  3L4F A;  1LWU C;  1KQF B;  4XE5 B;  1SQX G;  1GDT A;  2XT1 A;  1GTW A;  1ZNV A;  4COP A;  3CCE P;  1NU1 D;  4KJM A;  2L9F A;  5KKZ C;  2QRX A;  1N73 C;  3BRV B;  4OVN F;  2KNC A;  1VPC A;  1R5L A;  1PP9 G;  2JR8 A;  1QVG O;  2O01 H;  2C9N Y;  3CWB D;  2M3E A;  3BCC D;  1DD3 A;  3TF5 A;  3H1H J;  2KSE A;  1HWT C;  1YIT P;  3VP9 A;  4C7R A;  3FWN A;  2KGA A;  4DJG A;  1HQB A;  3RK2 C;  1X0T A;  1OW6 A;  4Y28 J;  1AQT A;  1YJW P;  1FJK A;  1X9V A;  3V6I A;  4U0D A;  1N73 A;  2O01 J; 
#chains in the Genus database with same CATH homology
 1M6N A;  3G29 A;  2M8P A;  2CWO A;  3CMA P;  2Z46 A;  3G28 A;  1BAJ A;  1VQN P;  3Q20 A;  4XRO A;  1QRJ A;  2OTL P;  2XV6 A;  3G4S P;  1YI2 P;  1YJN P;  2PY8 A;  3CCJ P;  2OTJ P;  2QEX P;  3H47 A;  3E2D A;  1JJ2 O;  5HGM A;  3CCR P;  1VQ7 P;  3LRY A;  2PEJ A;  4U0E A;  4U0A A;  4XFZ A;  1Q82 Q;  2EIA A;  3I56 P;  3DS4 A;  1M6E X;  2PEM A;  1YHQ P;  1KQS O;  3G1I A;  1M74 A;  4XRQ A;  3CCM P;  4GR6 A;  3CC7 P;  3CXC O;  4M0I A;  1M90 Q;  2L6E A;  3VRL C;  1RO2 A;  2E1M A;  4U0F A;  1VQ8 P;  5F2N A;  2BHV A;  1W2B O;  3G0V A;  4PH1 A;  2BUO A;  2KOD A;  5F2K A;  1VQK P;  3CC2 P;  3CD6 P;  3DS5 A;  3CCL P;  2DGY A;  1RO0 A;  3CPW O;  2JO0 A;  4COC A;  3H4E A;  4QNB A;  3DS0 A;  1VQP P;  1D1D A;  2EFJ A;  1VQO P;  1A8O A;  3G71 P;  2BQ1 E;  3B5I A;  1A43 A;  2JYG A;  3DS3 A;  1EOQ A;  4PH0 A;  1ZMB A;  4IPY A;  1NJI Q;  4U0C A;  3G6E P;  1M1K Q;  1N8R Q;  2QA4 P;  5F2O A;  2XT1 A;  1Q7Y Q;  4XFX A;  3G26 A;  3P05 A;  1VQM P;  4COP A;  1RNI A;  1K8A Q;  2P9X A;  3RG6 C;  3CCE P;  4WYM A;  1IUQ A;  5JPA A;  3DTJ A;  3MGE A;  5HGO A;  2JYL A;  1VQ4 P;  1K9M Q;  1QVF O;  1VQ5 P;  2EG5 A;  1PEO A;  2XXM A;  1QVG O;  1KD1 Q;  1VQ6 P;  2PEN A;  2Z45 A;  3M1M A;  2PEQ A;  1VQ9 P;  5HGL A;  3DS1 A;  5I4T G;  1VQL P;  3DS2 A;  3H0D A;  1Q81 Q;  4U0B A;  3CCQ P;  2M8L A;  2PEK A;  2OAR A;  1E6J P;  3NTE A;  3DPH A;  1KC8 Q;  3HYB A;  1K30 A;  5BS2 A;  1PEM A;  2M8N A;  1YJ9 P;  1YIT P;  3WBH A;  3CME P;  3G1G A;  2LF4 A;  3OW2 O;  2PEI A;  3CCU P;  3CCS P;  4XFY A;  1K73 Q;  3HZQ A;  3G21 A;  5DCK A;  3I55 P;  5BS1 A;  3CC4 P;  2Z44 A;  1Q86 Q;  1YJW P;  3CCV P;  1S72 P;  1EIA A;  5HGN A;  1AUM A;  2PEO A;  1YIJ P;  4GR2 A;  1PEQ A;  2ONT A;  4U0D A;  1PEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...