1Q81Q

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q81Q03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q81Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q81Q02
1K9MQ 3CCVP 1K73Q 1VQ9P 1VQMP 1JJ2O 1Q82Q 1M90Q 1YHQP 1VQ6P 2OTLP 1VQPP 1QVFO 2OTJP 1N8RQ 2QEXP 1M1KQ 3CC2P 1YI2P 1VQ7P 3CCUP 1S72P 1W2BO 3CCRP 1Q81Q 3CCLP 3CC7P 1QVGO 3CMEP 3G71P 3CCEP 3OW2O 1VQLP 1VQOP 3CCQP 1VQNP 3CCMP 3CCSP 1K8AQ 3CD6P 2QA4P 3G6EP 1YIJP 1YITP 1VQ8P 1VQKP 3CC4P 3I56P 3G4SP 3CXCO 1NJIQ 1VQ4P 3CPWO 1KC8Q 3I55P 3CMAP 1KQSO 3CCJP 1YJNP 1Q86Q 1KD1Q 1VQ5P 1YJ9P 1Q7YQ 1YJWP
chains in the Genus database with same CATH superfamily
2KOSA 2ITAA 1M90Q 2E75D 1OMIA 4M0IA 1YQ3C 2WSFJ 4OH8B 3RBXA 1N73C 2BQ1E 2ROQA 1FS0E 4H0LC 3SWYA 2KOQA 1PP9G 3A7OA 1K9MQ 1X22A 2I8DA 4C7RA 3BRVB 2WPQA 3LW5H 3H1KE 1EZVD 3CC7P 1KQLA 1LTJA 4U3FJ 5APVA 3CXHD 4OGQD 3BCCD 2IBZI 1CZQA 5GTIH 5KAFH 2H7HA 3HUSA 1IUQA 4DT0A 2WSCJ 1SQBG 2B9BA 1SQVG 2L91A 1LT9C 2BCCG 2N5HA 1ZMEC 2E74B 1NTKK 3VYIA 2OQQA 1MKMA 1G2CB 1JTHB 4D6TJ 3E1RA 3V2RA 5CJ0A 1GL2C 3RG6C 1JM0A 2J59M 1SLQA 3SWKA 3G6EP 1NU1K 4U7JA 4CPGA 2O01N 4IL6X 3RK2C 1YJWP 3CX5D 5KJ7C 1DD3A 2OARA 2K2QA 1VF5C 5CCGC 2M5AA 1AUMA 2Y9YA 1M1KQ 1BE3G 3HYBA 1S72P 3CCRP 4U0AA 1J1EC 1VQNP 1IK7A 4C7NA 1L0NE 3FXEA 3FWNA 3RBZA 1KC8Q 2K3RA 4GKGA 1PP9D 5CCHA 1FDIA 1FOSF 1J1DC 2ZT9D 1MV8A 2Z46A 3LRYA 1IO4A 4IFDK 3V2QA 2C9LY 1BCCE 3HE5A 4XE5B 1IJDB 1OX3A 3A0BH 2KP8A 1ZR4A 4IOIH 2L0QA 5KLVJ 3PJSK 3PH0A 3A0HE 1SQVD 3G26A 2FXOA 2KB7P 2BCCD 2K1AA 5CMZA 1RE3C 1LTTC 5CCGA 5B66E 4R0MA 1QVFO 3U1AA 1IFIA 1GW4A 5HV8A 4H0LD 3CI9A 1Q2NA 1ZN5A 3HTKB 3G9RA 5AW4B 2QA4P 1IZNB 4CA3A 4H13B 3KPEA 1JY2O 1R8EA 3H1KG 3O8ZA 1N7SC 4HH2A 3CCVP 1SQPK 1WMKA 1DH3A 2QVAA 1BE3D 1SQXG 2HPCB 3AE6C 5B5EH 1SS1A 1PPJE 3TDKA 5CCHD 1BSNA 1PEOA 1GTWA 2M8LA 3VP9A 3HZQA 1MUUA 1NQ4A 4IZ6A 1SQQK 1YQ4C 2ZVOB 1GU4A 2IYOA 2LXCB 3MUDC 1GL2D 2L5GB 2AXTE 1NHLA 2MVVA 3QH9A 4PV1B 2NZ2A 1NTMG 3E2DA 1HGZA 2E5TA 4BPHA 2N9BA 4HYTB 1M56D 3B8EB 1FZCC 4PD4I 5KJ7D 2JU2A 2E43A 1VF5D 2Q7CA 5AVZB 4ASWA 5CCGD 1FDOA 5CBNA 1MFTA 1U7MA 1RF1C 2EIAA 2YMYA 2AF8A 1KB9H 3L75J 4GR6A 2ZFCA 3Q1MA 3V2PA 7CEIA 4GDOA 5H2FE 3I5CA 2KK7A 3Q20A 4N3YB 3OW2O 4TT3H 2OYHC 2W27A 4L74A 3L37A 2H8PD 3MUDA 1NTKE 2G8YA 1KILB 1VQ5P 2D2CC 5I4TG 1M74A 4WWIA 2K9YA 2QJYB 1USDA 1SQXD 2QRXA 4COCA 2FADA 3B5NC 1X79B 1FR2A 2NPSC 3W68A 1H0TA 2PEIA 3B4SA 2B87B 1MZ8A 4Y99C 1K73Q 1JEKA 3G21A 1ZXGA 2ZJSE 1NTMD 2XDJA 4UB8E 2Q9IA 1P84H 1IC2A 3U43A 2Q3IA 2AEJA 4PJ0H 5BU8B 1RHZB 3WU2E 2LKIA 1N7SD 2KGAA 4N6JA 2CK3H 3JCUE 1HY8A 3TNUB 4WY4C 2JBGA 1VQ4P 2GDXA 1Q86Q 2IYPA 2PEOA 2Y0DA 2WT7B 1FBMA 2OTJP 1NTZJ 3GHGB 1BDCA 3VTPC 3CWBJ 3B4QA 2WSSH 3PTZA 1VQLP 3P8CD 2L22A 3JC22 4QKOA 1LWUB 4BPGA 2IDBA 1UJZA 1YHQP 1LP1B 2FXPA 1L0NJ 4GT1A 3AECC 1W5CE 2ZAEB 1SFCB 3DS1A 1URQC 1D7MA 5APUA 2XV5A 1QLED 3RL0C 3D71A 1SVFA 3H1ID 1SQPE 1LT9B 4BPFA 4NPDA 2VRSA 1BCCJ 1XTGB 2WMMA 1VQ6P 1EDJA 2O01J 2QJPB 1NYHA 3RK3C 3L72E 1NTKG 2I1JA 2D2CD 1S9KE 1R5SA 1OFCX 1SQQE 3EJDA 1HJ0A 1YIJP 2N5IA 1L0LK 3RK2B 2YKQA 2AFEA 1PEUA 3B5ND 2X2BA 1NU1G 2NPSD 2PAJA 4U0BA 1GK4A 2LMLA 1Q82Q 2BASA 5AVVB 2B89A 2XZ1C 1PIXA 1VL2A 1VQ7P 1S1CX 4DOJA 3H1LG 2MR7A 2YMKA 5KAIE 3RGUA 3P7KA 1EZVE 3H1JG 1FZFA 2Q6QA 5APTA 3CXHE 3H6PA 1NKZB 1ZP0C 2M3EA 3BCCE 2QE7H 2H43A 1OVUA 2JYLA 4JPZB 5EFWB 1DEBA 4WY4D 1HVVA 2LTEA 1T6AA 3V5BA 3M9BA 5AVRB 2CWOA 2K0DX 2E1MA 1HUCA 2JGPA 1GW3A 2FKWB 3A2AA 2N1TB 3L70D 1N2DC 3L71J 1IFPA 1GK6A 4JYCA 4L73A 1NTKD 3Q5SA 3CX5E 2G3AA 2M3BA 4H44C 2K0YA 1DD4A 1FOSE 1H89A 1E6JP 1KB9I 1RQUA 1A02F 1NU1D 5TISE 4BRYA 1URQD 1GZLA 1K30A 4KT0J 2QIWA 3RL0D 5KP7B 4GODA 4XRQA 3L73J 3MGNA 1BGYG 1Q81Q 5KLIB 1PP9E 1SQPG 3H1LD 4EYYQ 2EHTA 3G29A 3D70A 5AW0B 2W6AA 2WZ7A 1FAVA 3H1JD 3USSA 3AEAC 3RK3D 4F37A 3L72G 2MR8A 2KGCA 2Z5HA 1SQQG 4UHPB 4DG9A 4JF7A 2OYIB 2RMZA 3HTKA 5AW9B 1S5LX 2Q1KA 2IFMA 3C1LA 2BCCE 2E76C 2L9FA 1AFOA 2FVAA 2K92A 2K0XA 5HGMA 5E79E 1P84I 5BS2A 1JMBA 3N7NA 2OTLP 2HPCA 2MKVA 2JKVA 2GM4A 1EZVG 1IFDA 1J2JB 2OYHB 4I7ZC 4ZKPA 4PD4H 1BE3E 4D6TG 3M91A 5K5GB 2FFDB 1BGYD 1QL1A 3MZWB 3EJBA 2HODA 2XZ0D 1LTJC 4U0CA 1JY3O 1S5LE 3L35A 1S9KD 2A45I 2JO0A 1SQQD 1RY3A 4H44D 3AE1C 1JUNA 1GD2E 1QGKB 2KG6A 1ZRTD 3SFDC 4IFFA 2K93A 1M7LA 2R3CA 2KNCA 2JQ4A 1NO4A 1KYOI 2IBZD 2N6YA 3IFMA 5APQA 2QJKB 1PL5A 4QNBA 1RQVA 3SFEC 4L76A 2B87A 1SQXE 4IFMA 3MTUE 2KS1B 3CD6P 4D6TD 3AE2C 3KDPB 5CCHC 2WPSA 5AVQB 2LR2A 4AUWA 1R5LA 2E76D 3GW6A 5AVXB 1JY2N 3BASA 2YNYA 1U7JA 2W8ZA 3TNUA 5GTIE 2N6ZA 1AA0A 1NTME 3BCCJ 3MGEA 3PRJA 3PP5A 2WT7A 1QX8A 3KZIH 1AVOA 1S2EA 1A43A 3GHGA 5M1BA 1JO5A 3FGAD 1ZR2A 4I1LA 5KP6B 1N7LA 2M8PA 4NPEA 2M0BA 3CCSP 1OW6A 4PH1A 2BUOA 2W83C 3M06A 1E0HA 2KZIA 2FYUJ 3VMAA 4O9BA 1LP1A 1L0LG 1LTBC 2P2UA 3P8CE 1L4AB 4OVNF 1SFCA 1N86A 2LIUA 1ZLLA 3O6QB 3H0DA 2ZXEB 2N50A 2E42A 2O01H 1EXIA 1NJIQ 5DJUB 2XXMA 2NO8A 3GZMA 2XZRA 3AEGC 1EQ7A 3NFQA 1M1JB 3T97B 1PFIA 2P9XA 4K3AA 1PP9J 4TLFA 2AXCA 2YKPA 4IL6E 3H1IE 1DX7A 2XT1A 1VDFA 5AW2B 3K5BA 3TGUE 3VP8A 2CGQA 1LGHB 3I55P 3L36A 1SQBJ 5JPAA 2KGEA 1SQVJ 3C8VA 2BCCJ 2BEQD 4K35A 5TJHA 1D1DA 1W2EA 5AVYB 2LOLA 3L74J 1YBKA 2E75B 1RO0A 2Q5UA 2ONTA 1YYCA 3ABVC 2IPPA 2K9JA 2VSQA 1PGJA 2WPTA 2AXTH 1L0LD 5HGOA 2KSJA 2I1KA 1MZ9A 3A3YB 2Z44A 1BE3J 1JCCA 1FZBA 3SWFA 2GZJA 1HTLC 2C0WA 4GIFA 2DW3A 4HB1A 1OXZA 2N1TA 2L6EA 4I6MC 4OGQB 3H1HJ 3CWBG 3TSIA 1UIXA 2EHSA 2GZIA 2Z4EA 1EDIA 2SPZA 1X0TA 5KKZC 2JDIH 1EMVA 2YIUB 2PP6A 3L70E 1FE6A 2XNXA 5KTBA 2YKOA 3AE9C 5F2NA 2GDWA 2LIWA 1VQ9P 2AFDA 3N4XA 4UB6E 1ZNVA 2MJZA 1QVGO 1ACPA 3H4EA 1NU1E 4XFJA 2N98A 3CCQP 1S4XA 2P1JA 3AE7C 1EXJA 3H1IG 3H1KJ 3H1LE 4KHXA 2VLPA 2OYIA 1T8KA 3W67A 3TGUG 3AE3C 3H1JE 1SQXJ 1HGVA 3WU2H 2ZT9B 3RK3E 4XA4A 2EFJA 3JCUH 1QEXA 3KQGA 3HUSB 1L2PA 5BS1A 1EDKA 1NTZD 2HR3A 3EQ2A 3CWBD 4PJ0E 5KLVK 1ZV8A 2AVAA 2RH0A 1N73B 3V6IA 4H0LB 3RL0g 1USEA 2WSEJ 1G1JA 3R2PA 2P67A 2FFDA 5HGLA 2Y0CA 2P10A 2A45H 3HD7A 2M5AB 1Y8AA 2GYKA 1ZMBA 2JR8A 2ZVNB 1VQOP 3M0DC 1K8AQ 1K04A 4C7NB 4HKGA 3MIWA 3LIEA 1BGYE 4H2XC 2E74C 3DPHA 3EWKA 3S1KA 1E5WA 5APSA 3L70G 3TGUD 2K88A 1Z6MA 3H47A 1GL2B 1KYOH 3CL3D 2LPKA 5AW7B 2VLQA 1T3UA 3HE4B 4PXHB 1WT6A 4W80A 2GZGA 1LTAC 1JY3P 2O3JA 1BSHA 3G3ZA 2YXRB 1VF5B 2XU6A 1KMIZ 3EJEA 4H2WC 2JYGA 2XV6A 2KORA 5C39A 1ZRTE 1W2BO 4YXDC 4H2YC 1J1EB 2IFNA 3L4FA 3F5HA 3M0DA 4IPYA 1L0HA 3CCMP 5KAIH 2IBZE 3IN6A 1G1IA 1J1DB 3TF5A 3CXHH 1G2CA 1JTHA 3Q5PA 2O1KA 4LLHA 2Y0EA 1Q90D 5BU5A 2FYZA 2R5BA 2C0XA 2H88C 2YO3A 4D6TE 3NXSA 2R44A 4MN4C 1BXIA 1NGMB 5F2KA 1M8OB 1HWTC 1KORA 1ZW0A 3UIAA 1PZQA 3S9OA 4JYBA 5CJ4A 3QWOC 2GDYA 2DGYA 2CPBA 1ZOYC 2LL8A 2KIKA 1KB9D 1RNIA 5APYA 2E5YA 2FY8A 3I56P 4H13C 1A8OA 1NAFA 1N7SB 2NRGA 1BAJA 5L8RJ 1HF9A 1Y9BA 3L73D 5TISH 1WRGA 4RJTA 4ZNCA 2UWJE 2WWWA 1KN7A 1NTKJ 3A5TA 2E74D 2BHVA 1NTZK 3G1IA 3AEFC 1CEIA 2HFED 2WITA 1LNQA 1M1JA 5AW1B 3T97A 2K37A 5KLVE 3KHUA 1GMJA 4NPFX 4LC1A 2PGDA 1OVRA 4GOEA 2JJLA 1FZCB 1EOQA 1P84D 3H1LJ 2QM7A 1KFMA 1L0NK 1TU3F 4BWNA 1RF1B 3CMAP 2HLOA 3DS3A 2FHSC 1FC2C 3H1JJ 2XKMA 1UNKA 2FBWC 5E79H 1KV4A 3G1GA 2BEZF 2IBZG 3MHVA 4U3FG 3KXDA 5HGNA 2ERHA 2IX7C 1VHNA 3H32B 1CI6B 3B71A 4EIJA 2D2CB 4N78D 1KD1Q 1KILC 3E1IA 3AE5C 3LMOA 3B5NB 2LKMA 1H88A 2JB0A 1IFJA 3E7KA 2NPSB 4R4MA 2XNDH 4WYMA 4OWFA 1U57A 1L0LE 1M6EX 3PHLA 2CNRA 3EFFK 1JMMA 2KG9A 2KGDA 4Y99B 1YJNP 4RESB 3AE4C 1KQGB 4JQ0D 4EI2A 5GTHE 3AEEC 1Y47A 3M1MA 4H13D 4ZMDA 3L75E 3Q5RA 1SQPJ 2LF4A 1KYOD 3D6YA 4WY4B 1KILA 3L72J 3II6A 2PEQA 5APXA 4U3FD 3GHGC 2KOOA 1SQQJ 3DTJA 3GZLA 1NAYA 4GR2A 4GOFA 1PV3A 5CHXA 5KLVG 4L75A 4PV1D 1X3OA 3DS2A 3CXCO 1LWUC 1Q7YQ 1PGPA 4A7PA 1T3JA 2B88A 3CLQA 1SFCC 1URQB 3RL0B 3AEDC 3GG2A 5KAFE 1EZVI 3CCJP 3CXHI 4U0DA 2A06G 2PEMA 2QNWA 3VMYA 3VMZA 2QM8A 2WSEH 3RK3B 3L74G 2QJPC 3JSVC 1N73A 3NTEA 1KILD 1NTZE 2FYNC 1EIAA 4QMAA 3CWBE 3D6ZA 1LWUA 1PGQA 1VKUA 2FYUD 3B5IA 1K05A 1PEQA 3KZIE 2ZYDA 1T2KC 1JOCA 4Z1MH 2MY5A 2CPSA 2DNWA 2YO2A 3ITKA 2JO1A 4XFXA 2JWAA 3CX5I 2PEKA 4XFYA 2WPRA 2WPVB 1JNMA 1OR5A 5KLVD 3WBHA 1NVOA 3CC4P 3MP7B 1QRJA 3DS4A 1LT9A 3H1HG 3M0AA 4KJMA 2P7JA 3L75G 3A0HH 2VLOA 4MRTC 4BRYB 1GL2A 5AVWB 5B66H 1UIIA 3HE4A 4IL6H 1X8YA 2GUVA 3A0BE 5EW5E 2R32A 3PLNA 1AF8A 1SQBD 1RF0C 2WTYA 5KJ7A 4RKUJ 5AVTB 4YXWH 3WUTA 2FVEA 1AQ5A 2A06D 1YTZI 1RO2A 1FZEA 1RE4C 2EG5A 2N1TC 1LJ2A 2LXBA 1VQMP 3TYYA 2J5UA 4U0EA 2QEXP 3L74D 1F80D 2R3SA 3FWLA 1AVYA 4H44B 1DNYA 2KLVA 1YITP 1CSBA 3NTNA 3P8MC 2M8NA 4U0FA 3CE7A 2FQ0A 1SFCD 1KLPA 3ZDMA 4PD4D 5KP8B 3SSUA 5B5EE 2JEEA 5KLIC 1IFMA 4ASVA 2QG4A 3CMEP 3CCEP 1RF0A 1VQ8P 3H1HD 1RE3A 3L75D 1RE4A 4EDFA 2KODA 1NTZG 3GKLC 3S4RA 1L0LJ 2FVFA 2OYIC 3RK2D 1RH5B 3L71E 1OW7A 5H2FH 2HODB 1T2KD 2PNGA 4AQRD 2E76B 2V7QH 1N7SA 2CG5B 1KB9E 3V2NA 1KZUB 2AEFA 5DCKA 4W7ZA 1L0NG 1GPJA 4UB6H 3WUVA 1EDLA 3L73E 4I7ZB 1XTCC 2WVRA 3DS5A 2IZ0A 3H1KD 3H25A 1BCCG 2AEMA 1HH0A 2KNCB 2PY8A 3VOPA 2R5DA 3EFGA 1FZCA 1FZAA 2FFDC 4UB8H 2GZFA 1QL2A 5AW5B 3HD7C 2FYUK 2PEJA 4BXLA 1LTJB 2N1TD 1GXHA 3F89A 1HBWA 2KR5A 1RF1A 2N9YB 3VMXA 2FXMA 3LW5J 3VN0A 4LGDE 2KSEA 2HYNA 2QSIA 2FQ1A 1P84E 3GMAA 3C9IA 4DJGA 5AW6B 1S3JA 3CC2P 1NTMJ 5CZDB 3H32A 4NEOA 2K5XA 2OYHA 1CI6A 4WVZA 1OIPA 4EOTA 1IMPA 1OW8A 4DZOA 1PGOA 3CPWO 2FQ2A 2POHA 2MF4A 2K94A 2V4HA 1KFNA 4I2LC 2M5RA 1PPJG 1FDMA 1LTGC 3DS0A 1L0ND 5APWA 2RKLA 3B5NA 1GDTA 2MVUA 1DIPA 1YI2P 2NPSA 3FX0A 4M3LA 4N78E 3NY7B 3BATA 3GF7A 1SQBK 3RG2A 3G28A 1SQVK 2OGUA 2QJKC 1VQKP 2VLNA 2KG8A 1BCCD 2IZ1A 3L71G 5AVSB 2PRRA 3LIDA 2KLUA 3U59A 3NMDA 2J58A 1VQPP 3Q2YA 2W6JH 2ZXXA 2KYVA 4YTPC 1AV1A 3HE5B 4AYCA 4WY4A 4HJGH 1KQFB 2H89C 2WSFH 1MFZA 5AW3B 4DCKA 3P05A 3H1IJ 2ZYAA 2YXQB 3L73G 3GLMA 1KYOE 3GF3A 2FAEA 3TGUJ 2JWDA 4JBZA 2FYNB 1DEEG 3MD0A 1PEMA 1E79H 5EJDA 5AW8B 3G4SP 1AQTA 4U3FE 2KS1A 1CW5A 4XROA 1PPJD 5BVZA 3HD7D 2PFXA 4RO0A 2WSCH 1L4AC 3BRTB 2GA1A 3GJNA 1URQA 2GZEA 3M9HA 4Y28J 1FJPA 2GUSA 1LTIC 3P32A 3AE8C 2KWLA 1T8ZA 2FACA 2ZYGA 3L71D 2K9JB 4C46A 1Z56A 1M1JC 1JB0J 1OVVA 4WB4A 3V4QA 1N8RQ 1VPCA 3V4WA 1OZHA 3CX5H 3U1CA 5AVUB 1X9VA 4PH0A 3IAOA 1SQXK 1IK9A 2JU1A 1AYIA 1YJ9P 1KILE 1L0IA 1L4AA 2Y9ZA 2CQ8A 2FYUE 2V7QJ 3L70J 1JY3N 3CCLP 1A02J 2Z45A 3O6QA 2KI7B 2KOPA 2M8RA 2E75C 2L4BA 2A45G 1EC5A 3VRLC 1NTMK 2PENA 1H8AA 3HRNA 1JJ2O 1IFNA 4PV1C 1AJYA 1NU1J 1HQBA 1IMQA 3TK1A 3IF4A 3R4YA 4XFZA 1LT1A 2OYOA 1M6NA 1HJBA 1H0TB 2KOGA 2JP3A 1JCDA 2MD9A 3OAKA 3Q3DA 4OGQC 5HVCA 2OTKE 1SQBE 2C9NY 1SQVE 1KTMA 2Q3EA 5KKZB 3M9QA 1GU5A 2A06E 2YIUC 1BDDA 2WQYC 1NKNA 4COPA 4B86A 1L4AD 3L74E 2KW2A 5F2OA 1GXGA 3OJAB 3IR9A 1FJKA 4W7YA 2W90A 3AEBC 3KYQA 2KUBA 1M57D 2QJYC 3OA7A 1NH4A 2KZJA 4ZKUA 3G71P 2HG5D 5CBOA 3WMM0 3BCCG 4PD4E 1JY2P 3FXDA 1FU1A 1KQSO 1NOHA 3BVHA 4PWVB 4YPCA 2O1JA 1S5LH 3WUUA 1FZGA 2W6BA 5GTHH 1NWQA 5DJTB 1DV5A 3H1HE 1SQPD 3HD7B 4HKZH 3CCUP 2Z5IA 2ZT9C 1BGYJ 2JAZA 1YTZT 2P58A 2RN0A 1LTSC 3G0VA 4R4LA 4WBAA 2FYUG 3L72D 3HUSC 1SP4A 1OWAA 2KXPB
chains in the Genus database with same CATH topology
2EG5A 5HGOA 3P05A 4GR6A 1A43A 2PY8A 1VQMP 1JJ2O 1M90Q 1YHQP 4U0EA 2Z46A 3G1GA 3LRYA 2QEXP 4XFZA 4M0IA 2Z44A 2PEJA 1M6NA 2M8PA 5HGNA 3DS1A 3Q20A 3OW2O 1PEMA 3CCSP 1YITP 2BQ1E 4U0CA 4PH1A 3G4SP 1E6JP 2BUOA 5F2KA 3CCJP 3G26A 2L6EA 2M8NA 4U0FA 4XROA 1VQ5P 1KD1Q 4U0DA 1K9MQ 5I4TG 1M74A 2PEMA 2JO0A 1K30A 5HGLA 1VQ6P 2DGYA 1QVFO 4COCA 1Q7YQ 4XRQA 3CC2P 1Q81Q 3CC7P 3CMEP 3G29A 3NTEA 3CCEP 4WYMA 1ZMBA 1RNIA 1VQOP 1M6EX 1K8AQ 1EIAA 3H0DA 2PEIA 2QA4P 1YIJP 1VQ8P 3I56P 4COPA 3B5IA 1A8OA 1NJIQ 3CPWO 1IUQA 2XXMA 1PEUA 1YJNP 1BAJA 5F2OA 5F2NA 1K73Q 1PEQA 3G21A 2KODA 2P9XA 3CCVP 3DS0A 4U0BA 1VQ9P 3DPHA 1Q82Q 1N8RQ 3M1MA 1YI2P 1VQ7P 3H47A 4XFXA 3RG6C 2PEKA 1QVGO 2XT1A 4XFYA 3G71P 3H4EA 3G28A 3CCQP 4QNBA 3WBHA 1PEOA 2LF4A 3G6EP 1VQKP 3CC4P 2M8LA 2BHVA 3HZQA 4PH0A 1QRJA 1VQ4P 3DS4A 3G1IA 3I55P 1KQSO 1Q86Q 1YJ9P 2PEOA 1YJWP 3CD6P 5HGMA 5JPAA 2OARA 5DCKA 5BS2A 2PEQA 2OTLP 1VQPP 2JYLA 2JYGA 1AUMA 3E2DA 1M1KQ 2XV6A 2OTJP 3HYBA 3DTJA 3CCUP 1S72P 1D1DA 1W2BO 3CCRP 4U0AA 3CCLP 4GR2A 2Z45A 1VQLP 1EOQA 1VQNP 4IPYA 2CWOA 3CCMP 2E1MA 2EFJA 1RO0A 2ONTA 3G0VA 3DS5A 3DS2A 3CXCO 3VRLC 1KC8Q 2PENA 3CMAP 3DS3A 3MGEA 2EIAA 5BS1A 1RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M Q;  3CCV P;  1K73 Q;  1VQ9 P;  1VQM P;  1JJ2 O;  1Q82 Q;  1M90 Q;  1YHQ P;  1VQ6 P;  2OTL P;  1VQP P;  1QVF O;  2OTJ P;  1N8R Q;  2QEX P;  1M1K Q;  3CC2 P;  1YI2 P;  1VQ7 P;  3CCU P;  1S72 P;  1W2B O;  3CCR P;  1Q81 Q;  3CCL P;  3CC7 P;  1QVG O;  3CME P;  3G71 P;  3CCE P;  3OW2 O;  1VQL P;  1VQO P;  3CCQ P;  1VQN P;  3CCM P;  3CCS P;  1K8A Q;  3CD6 P;  2QA4 P;  3G6E P;  1YIJ P;  1YIT P;  1VQ8 P;  1VQK P;  3CC4 P;  3I56 P;  3G4S P;  3CXC O;  1NJI Q;  1VQ4 P;  3CPW O;  1KC8 Q;  3I55 P;  3CMA P;  1KQS O;  3CCJ P;  1YJN P;  1Q86 Q;  1KD1 Q;  1VQ5 P;  1YJ9 P;  1Q7Y Q;  1YJW P; 
#chains in the Genus database with same CATH topology
 2KOS A;  2ITA A;  1M90 Q;  2E75 D;  1OMI A;  4M0I A;  1YQ3 C;  2WSF J;  4OH8 B;  3RBX A;  1N73 C;  2BQ1 E;  2ROQ A;  1FS0 E;  4H0L C;  3SWY A;  2KOQ A;  1PP9 G;  3A7O A;  1K9M Q;  1X22 A;  2I8D A;  4C7R A;  3BRV B;  2WPQ A;  3LW5 H;  3H1K E;  1EZV D;  3CC7 P;  1KQL A;  1LTJ A;  4U3F J;  5APV A;  3CXH D;  4OGQ D;  3BCC D;  2IBZ I;  1CZQ A;  5GTI H;  5KAF H;  2H7H A;  3HUS A;  1IUQ A;  4DT0 A;  2WSC J;  1SQB G;  2B9B A;  1SQV G;  2L91 A;  1LT9 C;  2BCC G;  2N5H A;  1ZME C;  2E74 B;  1NTK K;  3VYI A;  2OQQ A;  1MKM A;  1G2C B;  1JTH B;  4D6T J;  3E1R A;  3V2R A;  5CJ0 A;  1GL2 C;  3RG6 C;  1JM0 A;  2J59 M;  1SLQ A;  3SWK A;  3G6E P;  1NU1 K;  4U7J A;  4CPG A;  2O01 N;  4IL6 X;  3RK2 C;  1YJW P;  3CX5 D;  5KJ7 C;  1DD3 A;  2OAR A;  2K2Q A;  1VF5 C;  5CCG C;  2M5A A;  1AUM A;  2Y9Y A;  1M1K Q;  1BE3 G;  3HYB A;  1S72 P;  3CCR P;  4U0A A;  1J1E C;  1VQN P;  1IK7 A;  4C7N A;  1L0N E;  3FXE A;  3FWN A;  3RBZ A;  1KC8 Q;  2K3R A;  4GKG A;  1PP9 D;  5CCH A;  1FDI A;  1FOS F;  1J1D C;  2ZT9 D;  1MV8 A;  2Z46 A;  3LRY A;  1IO4 A;  4IFD K;  3V2Q A;  2C9L Y;  1BCC E;  3HE5 A;  4XE5 B;  1IJD B;  1OX3 A;  3A0B H;  2KP8 A;  1ZR4 A;  4IOI H;  2L0Q A;  5KLV J;  3PJS K;  3PH0 A;  3A0H E;  1SQV D;  3G26 A;  2FXO A;  2KB7 P;  2BCC D;  2K1A A;  5CMZ A;  1RE3 C;  1LTT C;  5CCG A;  5B66 E;  4R0M A;  1QVF O;  3U1A A;  1IFI A;  1GW4 A;  5HV8 A;  4H0L D;  3CI9 A;  1Q2N A;  1ZN5 A;  3HTK B;  3G9R A;  5AW4 B;  2QA4 P;  1IZN B;  4CA3 A;  4H13 B;  3KPE A;  1JY2 O;  1R8E A;  3H1K G;  3O8Z A;  1N7S C;  4HH2 A;  3CCV P;  1SQP K;  1WMK A;  1DH3 A;  2QVA A;  1BE3 D;  1SQX G;  2HPC B;  3AE6 C;  5B5E H;  1SS1 A;  1PPJ E;  3TDK A;  5CCH D;  1BSN A;  1PEO A;  1GTW A;  2M8L A;  3VP9 A;  3HZQ A;  1MUU A;  1NQ4 A;  4IZ6 A;  1SQQ K;  1YQ4 C;  2ZVO B;  1GU4 A;  2IYO A;  2LXC B;  3MUD C;  1GL2 D;  2L5G B;  2AXT E;  1NHL A;  2MVV A;  3QH9 A;  4PV1 B;  2NZ2 A;  1NTM G;  3E2D A;  1HGZ A;  2E5T A;  4BPH A;  2N9B A;  4HYT B;  1M56 D;  3B8E B;  1FZC C;  4PD4 I;  5KJ7 D;  2JU2 A;  2E43 A;  1VF5 D;  2Q7C A;  5AVZ B;  4ASW A;  5CCG D;  1FDO A;  5CBN A;  1MFT A;  1U7M A;  1RF1 C;  2EIA A;  2YMY A;  2AF8 A;  1KB9 H;  3L75 J;  4GR6 A;  2ZFC A;  3Q1M A;  3V2P A;  7CEI A;  4GDO A;  5H2F E;  3I5C A;  2KK7 A;  3Q20 A;  4N3Y B;  3OW2 O;  4TT3 H;  2OYH C;  2W27 A;  4L74 A;  3L37 A;  2H8P D;  3MUD A;  1NTK E;  2G8Y A;  1KIL B;  1VQ5 P;  2D2C C;  5I4T G;  1M74 A;  4WWI A;  2K9Y A;  2QJY B;  1USD A;  1SQX D;  2QRX A;  4COC A;  2FAD A;  3B5N C;  1X79 B;  1FR2 A;  2NPS C;  3W68 A;  1H0T A;  2PEI A;  3B4S A;  2B87 B;  1MZ8 A;  4Y99 C;  1K73 Q;  1JEK A;  3G21 A;  1ZXG A;  2ZJS E;  1NTM D;  2XDJ A;  4UB8 E;  2Q9I A;  1P84 H;  1IC2 A;  3U43 A;  2Q3I A;  2AEJ A;  4PJ0 H;  5BU8 B;  1RHZ B;  3WU2 E;  2LKI A;  1N7S D;  2KGA A;  4N6J A;  2CK3 H;  3JCU E;  1HY8 A;  3TNU B;  4WY4 C;  2JBG A;  1VQ4 P;  2GDX A;  1Q86 Q;  2IYP A;  2PEO A;  2Y0D A;  2WT7 B;  1FBM A;  2OTJ P;  1NTZ J;  3GHG B;  1BDC A;  3VTP C;  3CWB J;  3B4Q A;  2WSS H;  3PTZ A;  1VQL P;  3P8C D;  2L22 A;  3JC2 2;  4QKO A;  1LWU B;  4BPG A;  2IDB A;  1UJZ A;  1YHQ P;  1LP1 B;  2FXP A;  1L0N J;  4GT1 A;  3AEC C;  1W5C E;  2ZAE B;  1SFC B;  3DS1 A;  1URQ C;  1D7M A;  5APU A;  2XV5 A;  1QLE D;  3RL0 C;  3D71 A;  1SVF A;  3H1I D;  1SQP E;  1LT9 B;  4BPF A;  4NPD A;  2VRS A;  1BCC J;  1XTG B;  2WMM A;  1VQ6 P;  1EDJ A;  2O01 J;  2QJP B;  1NYH A;  3RK3 C;  3L72 E;  1NTK G;  2I1J A;  2D2C D;  1S9K E;  1R5S A;  1OFC X;  1SQQ E;  3EJD A;  1HJ0 A;  1YIJ P;  2N5I A;  1L0L K;  3RK2 B;  2YKQ A;  2AFE A;  1PEU A;  3B5N D;  2X2B A;  1NU1 G;  2NPS D;  2PAJ A;  4U0B A;  1GK4 A;  2LML A;  1Q82 Q;  2BAS A;  5AVV B;  2B89 A;  2XZ1 C;  1PIX A;  1VL2 A;  1VQ7 P;  1S1C X;  4DOJ A;  3H1L G;  2MR7 A;  2YMK A;  5KAI E;  3RGU A;  3P7K A;  1EZV E;  3H1J G;  1FZF A;  2Q6Q A;  5APT A;  3CXH E;  3H6P A;  1NKZ B;  1ZP0 C;  2M3E A;  3BCC E;  2QE7 H;  2H43 A;  1OVU A;  2JYL A;  4JPZ B;  5EFW B;  1DEB A;  4WY4 D;  1HVV A;  2LTE A;  1T6A A;  3V5B A;  3M9B A;  5AVR B;  2CWO A;  2K0D X;  2E1M A;  1HUC A;  2JGP A;  1GW3 A;  2FKW B;  3A2A A;  2N1T B;  3L70 D;  1N2D C;  3L71 J;  1IFP A;  1GK6 A;  4JYC A;  4L73 A;  1NTK D;  3Q5S A;  3CX5 E;  2G3A A;  2M3B A;  4H44 C;  2K0Y A;  1DD4 A;  1FOS E;  1H89 A;  1E6J P;  1KB9 I;  1RQU A;  1A02 F;  1NU1 D;  5TIS E;  4BRY A;  1URQ D;  1GZL A;  1K30 A;  4KT0 J;  2QIW A;  3RL0 D;  5KP7 B;  4GOD A;  4XRQ A;  3L73 J;  3MGN A;  1BGY G;  1Q81 Q;  5KLI B;  1PP9 E;  1SQP G;  3H1L D;  4EYY Q;  2EHT A;  3G29 A;  3D70 A;  5AW0 B;  2W6A A;  2WZ7 A;  1FAV A;  3H1J D;  3USS A;  3AEA C;  3RK3 D;  4F37 A;  3L72 G;  2MR8 A;  2KGC A;  2Z5H A;  1SQQ G;  4UHP B;  4DG9 A;  4JF7 A;  2OYI B;  2RMZ A;  3HTK A;  5AW9 B;  1S5L X;  2Q1K A;  2IFM A;  3C1L A;  2BCC E;  2E76 C;  2L9F A;  1AFO A;  2FVA A;  2K92 A;  2K0X A;  5HGM A;  5E79 E;  1P84 I;  5BS2 A;  1JMB A;  3N7N A;  2OTL P;  2HPC A;  2MKV A;  2JKV A;  2GM4 A;  1EZV G;  1IFD A;  1J2J B;  2OYH B;  4I7Z C;  4ZKP A;  4PD4 H;  1BE3 E;  4D6T G;  3M91 A;  5K5G B;  2FFD B;  1BGY D;  1QL1 A;  3MZW B;  3EJB A;  2HOD A;  2XZ0 D;  1LTJ C;  4U0C A;  1JY3 O;  1S5L E;  3L35 A;  1S9K D;  2A45 I;  2JO0 A;  1SQQ D;  1RY3 A;  4H44 D;  3AE1 C;  1JUN A;  1GD2 E;  1QGK B;  2KG6 A;  1ZRT D;  3SFD C;  4IFF A;  2K93 A;  1M7L A;  2R3C A;  2KNC A;  2JQ4 A;  1NO4 A;  1KYO I;  2IBZ D;  2N6Y A;  3IFM A;  5APQ A;  2QJK B;  1PL5 A;  4QNB A;  1RQV A;  3SFE C;  4L76 A;  2B87 A;  1SQX E;  4IFM A;  3MTU E;  2KS1 B;  3CD6 P;  4D6T D;  3AE2 C;  3KDP B;  5CCH C;  2WPS A;  5AVQ B;  2LR2 A;  4AUW A;  1R5L A;  2E76 D;  3GW6 A;  5AVX B;  1JY2 N;  3BAS A;  2YNY A;  1U7J A;  2W8Z A;  3TNU A;  5GTI E;  2N6Z A;  1AA0 A;  1NTM E;  3BCC J;  3MGE A;  3PRJ A;  3PP5 A;  2WT7 A;  1QX8 A;  3KZI H;  1AVO A;  1S2E A;  1A43 A;  3GHG A;  5M1B A;  1JO5 A;  3FGA D;  1ZR2 A;  4I1L A;  5KP6 B;  1N7L A;  2M8P A;  4NPE A;  2M0B A;  3CCS P;  1OW6 A;  4PH1 A;  2BUO A;  2W83 C;  3M06 A;  1E0H A;  2KZI A;  2FYU J;  3VMA A;  4O9B A;  1LP1 A;  1L0L G;  1LTB C;  2P2U A;  3P8C E;  1L4A B;  4OVN F;  1SFC A;  1N86 A;  2LIU A;  1ZLL A;  3O6Q B;  3H0D A;  2ZXE B;  2N50 A;  2E42 A;  2O01 H;  1EXI A;  1NJI Q;  5DJU B;  2XXM A;  2NO8 A;  3GZM A;  2XZR A;  3AEG C;  1EQ7 A;  3NFQ A;  1M1J B;  3T97 B;  1PFI A;  2P9X A;  4K3A A;  1PP9 J;  4TLF A;  2AXC A;  2YKP A;  4IL6 E;  3H1I E;  1DX7 A;  2XT1 A;  1VDF A;  5AW2 B;  3K5B A;  3TGU E;  3VP8 A;  2CGQ A;  1LGH B;  3I55 P;  3L36 A;  1SQB J;  5JPA A;  2KGE A;  1SQV J;  3C8V A;  2BCC J;  2BEQ D;  4K35 A;  5TJH A;  1D1D A;  1W2E A;  5AVY B;  2LOL A;  3L74 J;  1YBK A;  2E75 B;  1RO0 A;  2Q5U A;  2ONT A;  1YYC A;  3ABV C;  2IPP A;  2K9J A;  2VSQ A;  1PGJ A;  2WPT A;  2AXT H;  1L0L D;  5HGO A;  2KSJ A;  2I1K A;  1MZ9 A;  3A3Y B;  2Z44 A;  1BE3 J;  1JCC A;  1FZB A;  3SWF A;  2GZJ A;  1HTL C;  2C0W A;  4GIF A;  2DW3 A;  4HB1 A;  1OXZ A;  2N1T A;  2L6E A;  4I6M C;  4OGQ B;  3H1H J;  3CWB G;  3TSI A;  1UIX A;  2EHS A;  2GZI A;  2Z4E A;  1EDI A;  2SPZ A;  1X0T A;  5KKZ C;  2JDI H;  1EMV A;  2YIU B;  2PP6 A;  3L70 E;  1FE6 A;  2XNX A;  5KTB A;  2YKO A;  3AE9 C;  5F2N A;  2GDW A;  2LIW A;  1VQ9 P;  2AFD A;  3N4X A;  4UB6 E;  1ZNV A;  2MJZ A;  1QVG O;  1ACP A;  3H4E A;  1NU1 E;  4XFJ A;  2N98 A;  3CCQ P;  1S4X A;  2P1J A;  3AE7 C;  1EXJ A;  3H1I G;  3H1K J;  3H1L E;  4KHX A;  2VLP A;  2OYI A;  1T8K A;  3W67 A;  3TGU G;  3AE3 C;  3H1J E;  1SQX J;  1HGV A;  3WU2 H;  2ZT9 B;  3RK3 E;  4XA4 A;  2EFJ A;  3JCU H;  1QEX A;  3KQG A;  3HUS B;  1L2P A;  5BS1 A;  1EDK A;  1NTZ D;  2HR3 A;  3EQ2 A;  3CWB D;  4PJ0 E;  5KLV K;  1ZV8 A;  2AVA A;  2RH0 A;  1N73 B;  3V6I A;  4H0L B;  3RL0 g;  1USE A;  2WSE J;  1G1J A;  3R2P A;  2P67 A;  2FFD A;  5HGL A;  2Y0C A;  2P10 A;  2A45 H;  3HD7 A;  2M5A B;  1Y8A A;  2GYK A;  1ZMB A;  2JR8 A;  2ZVN B;  1VQO P;  3M0D C;  1K8A Q;  1K04 A;  4C7N B;  4HKG A;  3MIW A;  3LIE A;  1BGY E;  4H2X C;  2E74 C;  3DPH A;  3EWK A;  3S1K A;  1E5W A;  5APS A;  3L70 G;  3TGU D;  2K88 A;  1Z6M A;  3H47 A;  1GL2 B;  1KYO H;  3CL3 D;  2LPK A;  5AW7 B;  2VLQ A;  1T3U A;  3HE4 B;  4PXH B;  1WT6 A;  4W80 A;  2GZG A;  1LTA C;  1JY3 P;  2O3J A;  1BSH A;  3G3Z A;  2YXR B;  1VF5 B;  2XU6 A;  1KMI Z;  3EJE A;  4H2W C;  2JYG A;  2XV6 A;  2KOR A;  5C39 A;  1ZRT E;  1W2B O;  4YXD C;  4H2Y C;  1J1E B;  2IFN A;  3L4F A;  3F5H A;  3M0D A;  4IPY A;  1L0H A;  3CCM P;  5KAI H;  2IBZ E;  3IN6 A;  1G1I A;  1J1D B;  3TF5 A;  3CXH H;  1G2C A;  1JTH A;  3Q5P A;  2O1K A;  4LLH A;  2Y0E A;  1Q90 D;  5BU5 A;  2FYZ A;  2R5B A;  2C0X A;  2H88 C;  2YO3 A;  4D6T E;  3NXS A;  2R44 A;  4MN4 C;  1BXI A;  1NGM B;  5F2K A;  1M8O B;  1HWT C;  1KOR A;  1ZW0 A;  3UIA A;  1PZQ A;  3S9O A;  4JYB A;  5CJ4 A;  3QWO C;  2GDY A;  2DGY A;  2CPB A;  1ZOY C;  2LL8 A;  2KIK A;  1KB9 D;  1RNI A;  5APY A;  2E5Y A;  2FY8 A;  3I56 P;  4H13 C;  1A8O A;  1NAF A;  1N7S B;  2NRG A;  1BAJ A;  5L8R J;  1HF9 A;  1Y9B A;  3L73 D;  5TIS H;  1WRG A;  4RJT A;  4ZNC A;  2UWJ E;  2WWW A;  1KN7 A;  1NTK J;  3A5T A;  2E74 D;  2BHV A;  1NTZ K;  3G1I A;  3AEF C;  1CEI A;  2HFE D;  2WIT A;  1LNQ A;  1M1J A;  5AW1 B;  3T97 A;  2K37 A;  5KLV E;  3KHU A;  1GMJ A;  4NPF X;  4LC1 A;  2PGD A;  1OVR A;  4GOE A;  2JJL A;  1FZC B;  1EOQ A;  1P84 D;  3H1L J;  2QM7 A;  1KFM A;  1L0N K;  1TU3 F;  4BWN A;  1RF1 B;  3CMA P;  2HLO A;  3DS3 A;  2FHS C;  1FC2 C;  3H1J J;  2XKM A;  1UNK A;  2FBW C;  5E79 H;  1KV4 A;  3G1G A;  2BEZ F;  2IBZ G;  3MHV A;  4U3F G;  3KXD A;  5HGN A;  2ERH A;  2IX7 C;  1VHN A;  3H32 B;  1CI6 B;  3B71 A;  4EIJ A;  2D2C B;  4N78 D;  1KD1 Q;  1KIL C;  3E1I A;  3AE5 C;  3LMO A;  3B5N B;  2LKM A;  1H88 A;  2JB0 A;  1IFJ A;  3E7K A;  2NPS B;  4R4M A;  2XND H;  4WYM A;  4OWF A;  1U57 A;  1L0L E;  1M6E X;  3PHL A;  2CNR A;  3EFF K;  1JMM A;  2KG9 A;  2KGD A;  4Y99 B;  1YJN P;  4RES B;  3AE4 C;  1KQG B;  4JQ0 D;  4EI2 A;  5GTH E;  3AEE C;  1Y47 A;  3M1M A;  4H13 D;  4ZMD A;  3L75 E;  3Q5R A;  1SQP J;  2LF4 A;  1KYO D;  3D6Y A;  4WY4 B;  1KIL A;  3L72 J;  3II6 A;  2PEQ A;  5APX A;  4U3F D;  3GHG C;  2KOO A;  1SQQ J;  3DTJ A;  3GZL A;  1NAY A;  4GR2 A;  4GOF A;  1PV3 A;  5CHX A;  5KLV G;  4L75 A;  4PV1 D;  1X3O A;  3DS2 A;  3CXC O;  1LWU C;  1Q7Y Q;  1PGP A;  4A7P A;  1T3J A;  2B88 A;  3CLQ A;  1SFC C;  1URQ B;  3RL0 B;  3AED C;  3GG2 A;  5KAF E;  1EZV I;  3CCJ P;  3CXH I;  4U0D A;  2A06 G;  2PEM A;  2QNW A;  3VMY A;  3VMZ A;  2QM8 A;  2WSE H;  3RK3 B;  3L74 G;  2QJP C;  3JSV C;  1N73 A;  3NTE A;  1KIL D;  1NTZ E;  2FYN C;  1EIA A;  4QMA A;  3CWB E;  3D6Z A;  1LWU A;  1PGQ A;  1VKU A;  2FYU D;  3B5I A;  1K05 A;  1PEQ A;  3KZI E;  2ZYD A;  1T2K C;  1JOC A;  4Z1M H;  2MY5 A;  2CPS A;  2DNW A;  2YO2 A;  3ITK A;  2JO1 A;  4XFX A;  2JWA A;  3CX5 I;  2PEK A;  4XFY A;  2WPR A;  2WPV B;  1JNM A;  1OR5 A;  5KLV D;  3WBH A;  1NVO A;  3CC4 P;  3MP7 B;  1QRJ A;  3DS4 A;  1LT9 A;  3H1H G;  3M0A A;  4KJM A;  2P7J A;  3L75 G;  3A0H H;  2VLO A;  4MRT C;  4BRY B;  1GL2 A;  5AVW B;  5B66 H;  1UII A;  3HE4 A;  4IL6 H;  1X8Y A;  2GUV A;  3A0B E;  5EW5 E;  2R32 A;  3PLN A;  1AF8 A;  1SQB D;  1RF0 C;  2WTY A;  5KJ7 A;  4RKU J;  5AVT B;  4YXW H;  3WUT A;  2FVE A;  1AQ5 A;  2A06 D;  1YTZ I;  1RO2 A;  1FZE A;  1RE4 C;  2EG5 A;  2N1T C;  1LJ2 A;  2LXB A;  1VQM P;  3TYY A;  2J5U A;  4U0E A;  2QEX P;  3L74 D;  1F80 D;  2R3S A;  3FWL A;  1AVY A;  4H44 B;  1DNY A;  2KLV A;  1YIT P;  1CSB A;  3NTN A;  3P8M C;  2M8N A;  4U0F A;  3CE7 A;  2FQ0 A;  1SFC D;  1KLP A;  3ZDM A;  4PD4 D;  5KP8 B;  3SSU A;  5B5E E;  2JEE A;  5KLI C;  1IFM A;  4ASV A;  2QG4 A;  3CME P;  3CCE P;  1RF0 A;  1VQ8 P;  3H1H D;  1RE3 A;  3L75 D;  1RE4 A;  4EDF A;  2KOD A;  1NTZ G;  3GKL C;  3S4R A;  1L0L J;  2FVF A;  2OYI C;  3RK2 D;  1RH5 B;  3L71 E;  1OW7 A;  5H2F H;  2HOD B;  1T2K D;  2PNG A;  4AQR D;  2E76 B;  2V7Q H;  1N7S A;  2CG5 B;  1KB9 E;  3V2N A;  1KZU B;  2AEF A;  5DCK A;  4W7Z A;  1L0N G;  1GPJ A;  4UB6 H;  3WUV A;  1EDL A;  3L73 E;  4I7Z B;  1XTC C;  2WVR A;  3DS5 A;  2IZ0 A;  3H1K D;  3H25 A;  1BCC G;  2AEM A;  1HH0 A;  2KNC B;  2PY8 A;  3VOP A;  2R5D A;  3EFG A;  1FZC A;  1FZA A;  2FFD C;  4UB8 H;  2GZF A;  1QL2 A;  5AW5 B;  3HD7 C;  2FYU K;  2PEJ A;  4BXL A;  1LTJ B;  2N1T D;  1GXH A;  3F89 A;  1HBW A;  2KR5 A;  1RF1 A;  2N9Y B;  3VMX A;  2FXM A;  3LW5 J;  3VN0 A;  4LGD E;  2KSE A;  2HYN A;  2QSI A;  2FQ1 A;  1P84 E;  3GMA A;  3C9I A;  4DJG A;  5AW6 B;  1S3J A;  3CC2 P;  1NTM J;  5CZD B;  3H32 A;  4NEO A;  2K5X A;  2OYH A;  1CI6 A;  4WVZ A;  1OIP A;  4EOT A;  1IMP A;  1OW8 A;  4DZO A;  1PGO A;  3CPW O;  2FQ2 A;  2POH A;  2MF4 A;  2K94 A;  2V4H A;  1KFN A;  4I2L C;  2M5R A;  1PPJ G;  1FDM A;  1LTG C;  3DS0 A;  1L0N D;  5APW A;  2RKL A;  3B5N A;  1GDT A;  2MVU A;  1DIP A;  1YI2 P;  2NPS A;  3FX0 A;  4M3L A;  4N78 E;  3NY7 B;  3BAT A;  3GF7 A;  1SQB K;  3RG2 A;  3G28 A;  1SQV K;  2OGU A;  2QJK C;  1VQK P;  2VLN A;  2KG8 A;  1BCC D;  2IZ1 A;  3L71 G;  5AVS B;  2PRR A;  3LID A;  2KLU A;  3U59 A;  3NMD A;  2J58 A;  1VQP P;  3Q2Y A;  2W6J H;  2ZXX A;  2KYV A;  4YTP C;  1AV1 A;  3HE5 B;  4AYC A;  4WY4 A;  4HJG H;  1KQF B;  2H89 C;  2WSF H;  1MFZ A;  5AW3 B;  4DCK A;  3P05 A;  3H1I J;  2ZYA A;  2YXQ B;  3L73 G;  3GLM A;  1KYO E;  3GF3 A;  2FAE A;  3TGU J;  2JWD A;  4JBZ A;  2FYN B;  1DEE G;  3MD0 A;  1PEM A;  1E79 H;  5EJD A;  5AW8 B;  3G4S P;  1AQT A;  4U3F E;  2KS1 A;  1CW5 A;  4XRO A;  1PPJ D;  5BVZ A;  3HD7 D;  2PFX A;  4RO0 A;  2WSC H;  1L4A C;  3BRT B;  2GA1 A;  3GJN A;  1URQ A;  2GZE A;  3M9H A;  4Y28 J;  1FJP A;  2GUS A;  1LTI C;  3P32 A;  3AE8 C;  2KWL A;  1T8Z A;  2FAC A;  2ZYG A;  3L71 D;  2K9J B;  4C46 A;  1Z56 A;  1M1J C;  1JB0 J;  1OVV A;  4WB4 A;  3V4Q A;  1N8R Q;  1VPC A;  3V4W A;  1OZH A;  3CX5 H;  3U1C A;  5AVU B;  1X9V A;  4PH0 A;  3IAO A;  1SQX K;  1IK9 A;  2JU1 A;  1AYI A;  1YJ9 P;  1KIL E;  1L0I A;  1L4A A;  2Y9Z A;  2CQ8 A;  2FYU E;  2V7Q J;  3L70 J;  1JY3 N;  3CCL P;  1A02 J;  2Z45 A;  3O6Q A;  2KI7 B;  2KOP A;  2M8R A;  2E75 C;  2L4B A;  2A45 G;  1EC5 A;  3VRL C;  1NTM K;  2PEN A;  1H8A A;  3HRN A;  1JJ2 O;  1IFN A;  4PV1 C;  1AJY A;  1NU1 J;  1HQB A;  1IMQ A;  3TK1 A;  3IF4 A;  3R4Y A;  4XFZ A;  1LT1 A;  2OYO A;  1M6N A;  1HJB A;  1H0T B;  2KOG A;  2JP3 A;  1JCD A;  2MD9 A;  3OAK A;  3Q3D A;  4OGQ C;  5HVC A;  2OTK E;  1SQB E;  2C9N Y;  1SQV E;  1KTM A;  2Q3E A;  5KKZ B;  3M9Q A;  1GU5 A;  2A06 E;  2YIU C;  1BDD A;  2WQY C;  1NKN A;  4COP A;  4B86 A;  1L4A D;  3L74 E;  2KW2 A;  5F2O A;  1GXG A;  3OJA B;  3IR9 A;  1FJK A;  4W7Y A;  2W90 A;  3AEB C;  3KYQ A;  2KUB A;  1M57 D;  2QJY C;  3OA7 A;  1NH4 A;  2KZJ A;  4ZKU A;  3G71 P;  2HG5 D;  5CBO A;  3WMM 0;  3BCC G;  4PD4 E;  1JY2 P;  3FXD A;  1FU1 A;  1KQS O;  1NOH A;  3BVH A;  4PWV B;  4YPC A;  2O1J A;  1S5L H;  3WUU A;  1FZG A;  2W6B A;  5GTH H;  1NWQ A;  5DJT B;  1DV5 A;  3H1H E;  1SQP D;  3HD7 B;  4HKZ H;  3CCU P;  2Z5I A;  2ZT9 C;  1BGY J;  2JAZ A;  1YTZ T;  2P58 A;  2RN0 A;  1LTS C;  3G0V A;  4R4L A;  4WBA A;  2FYU G;  3L72 D;  3HUS C;  1SP4 A;  1OWA A;  2KXP B; 
#chains in the Genus database with same CATH homology
 2EG5 A;  5HGO A;  3P05 A;  4GR6 A;  1A43 A;  2PY8 A;  1VQM P;  1JJ2 O;  1M90 Q;  1YHQ P;  4U0E A;  2Z46 A;  3G1G A;  3LRY A;  2QEX P;  4XFZ A;  4M0I A;  2Z44 A;  2PEJ A;  1M6N A;  2M8P A;  5HGN A;  3DS1 A;  3Q20 A;  3OW2 O;  1PEM A;  3CCS P;  1YIT P;  2BQ1 E;  4U0C A;  4PH1 A;  3G4S P;  1E6J P;  2BUO A;  5F2K A;  3CCJ P;  3G26 A;  2L6E A;  2M8N A;  4U0F A;  4XRO A;  1VQ5 P;  1KD1 Q;  4U0D A;  1K9M Q;  5I4T G;  1M74 A;  2PEM A;  2JO0 A;  1K30 A;  5HGL A;  1VQ6 P;  2DGY A;  1QVF O;  4COC A;  1Q7Y Q;  4XRQ A;  3CC2 P;  1Q81 Q;  3CC7 P;  3CME P;  3G29 A;  3NTE A;  3CCE P;  4WYM A;  1ZMB A;  1RNI A;  1VQO P;  1M6E X;  1K8A Q;  1EIA A;  3H0D A;  2PEI A;  2QA4 P;  1YIJ P;  1VQ8 P;  3I56 P;  4COP A;  3B5I A;  1A8O A;  1NJI Q;  3CPW O;  1IUQ A;  2XXM A;  1PEU A;  1YJN P;  1BAJ A;  5F2O A;  5F2N A;  1K73 Q;  1PEQ A;  3G21 A;  2KOD A;  2P9X A;  3CCV P;  3DS0 A;  4U0B A;  1VQ9 P;  3DPH A;  1Q82 Q;  1N8R Q;  3M1M A;  1YI2 P;  1VQ7 P;  3H47 A;  4XFX A;  3RG6 C;  2PEK A;  1QVG O;  2XT1 A;  4XFY A;  3G71 P;  3H4E A;  3G28 A;  3CCQ P;  4QNB A;  3WBH A;  1PEO A;  2LF4 A;  3G6E P;  1VQK P;  3CC4 P;  2M8L A;  2BHV A;  3HZQ A;  4PH0 A;  1QRJ A;  1VQ4 P;  3DS4 A;  3G1I A;  3I55 P;  1KQS O;  1Q86 Q;  1YJ9 P;  2PEO A;  1YJW P;  3CD6 P;  5HGM A;  5JPA A;  2OAR A;  5DCK A;  5BS2 A;  2PEQ A;  2OTL P;  1VQP P;  2JYL A;  2JYG A;  1AUM A;  3E2D A;  1M1K Q;  2XV6 A;  2OTJ P;  3HYB A;  3DTJ A;  3CCU P;  1S72 P;  1D1D A;  1W2B O;  3CCR P;  4U0A A;  3CCL P;  4GR2 A;  2Z45 A;  1VQL P;  1EOQ A;  1VQN P;  4IPY A;  2CWO A;  3CCM P;  2E1M A;  2EFJ A;  1RO0 A;  2ONT A;  3G0V A;  3DS5 A;  3DS2 A;  3CXC O;  3VRL C;  1KC8 Q;  2PEN A;  3CMA P;  3DS3 A;  3MGE A;  2EIA A;  5BS1 A;  1RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...