1Q81Q

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q81Q03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q81Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q81Q02
1K8AQ 1VQKP 3CC2P 1YIJP 1VQ9P 3CD6P 3CCQP 2QA4P 1YJWP 1Q82Q 1Q81Q 3CCUP 1NJIQ 1KC8Q 3CCRP 1YJNP 1VQ8P 1KD1Q 1VQLP 2OTLP 2OTJP 1YITP 1VQNP 1N8RQ 1QVFO 1YHQP 1KQSO 1M1KQ 1VQ7P 1VQ4P 3I55P 3CCJP 3CC4P 3CCEP 3G6EP 3CXCO 3I56P 1VQ5P 1S72P 1W2BO 3CMAP 3OW2O 1Q7YQ 1K73Q 3CCLP 1VQ6P 1Q86Q 3CCSP 1QVGO 1K9MQ 3CPWO 3CCVP 1VQPP 1VQMP 1YJ9P 1YI2P 1M90Q 3CC7P 1VQOP 3CCMP 1JJ2O 3G71P 3G4SP 2QEXP 3CMEP
chains in the Genus database with same CATH superfamily
2A06G 2K0YA 2BEZF 3MTUE 1NTZG 4U7JA 2OYHC 2OTJP 2KNCA 5E79H 5CCHD 4CPGA 3RL0D 1FDOA 1N86A 1AJYA 2N1TA 1GL2C 1KQFB 1QRJA 3BCCE 3BCCJ 3H1IG 4EI2A 3RL0B 2M5AA 3CI9A 2D2CD 1PZQA 3L72G 5KKZC 2WSCH 1KTMA 1FZAA 3KYQA 3WUTA 1SFCB 2YIUC 3AECC 2IYOA 1SQXE 1SQXJ 5KP6B 4H44B 4GR2A 2JP3A 1SLQA 2B89A 3CWBG 1KQGB 4ASVA 1RQUA 2OYIA 4W7YA 3EFFK 1A8OA 3KXDA 1NQ4A 2QVAA 1N7SC 1LP1A 4U3FE 4U3FJ 1UJZA 1IJDB 3L70G 1FAVA 1KB9I 2E76B 5TJHA 1NTME 1NTMJ 3BRVB 4BPGA 2CWOA 1KQSO 4PV1C 2FXOA 2WTYA 2E1MA 2DGYA 4R4LA 2WPTA 2MF4A 3Q20A 2MD9A 2JU2A 2K3RA 2C0XA 1RF1C 3V2QA 3RK3D 2OGUA 5BU5A 1IC2A 1L0NG 2JU1A 5AW1B 2QJYC 1BCCD 2R5DA 4UB8H 1HGZA 3P8CD 2WZ7A 2H43A 3MUDC 2ITAA 4D6TD 3G4SP 3CC2P 3JC22 4I6MC 2M0BA 4L73A 1BSHA 2CG5B 1GW3A 5GTIE 1L0IA 2WPVB 1JM0A 2HG5D 4BRYA 1P84H 1SQVJ 1SFCA 2R5BA 3ZDMA 2KLVA 1F80D 3FXEA 1J1DB 3EJEA 1Z56A 2HR3A 1SQPE 1SQPJ 3R2PA 5KLVE 5KLVJ 4WYMA 1M8OB 5H2FH 2IYPA 3RK2B 2YO3A 3AE3C 5EJDA 3FWNA 2FYNB 1SVFA 3KQGA 1J1EC 2NO8A 2WMMA 1JEKA 4XROA 5CMZA 5CCGD 1ZRTD 1X22A 1QEXA 1IO4A 2LIWA 3DPHA 3V2PA 1AUMA 4HYTB 3PHLA 5F2NA 1EOQA 1OWAA 2PY8A 2N1TC 1Q7YQ 2XZ1C 1FDMA 2P67A 1FR2A 3II6A 1NTKK 2PRRA 1HBWA 2Z5IA 5BS1A 2Q5UA 2PEIA 1PGQA 2XDJA 3RBZA 2BCCG 1VQ4P 2KG8A 1ZW0A 3G6EP 4DT0A 1IFPA 2IX7C 2B9BA 3H1IE 3H1IJ 1H8AA 4GDOA 2P58A 3AEBC 3CXHE 3L36A 3H1LD 2JO1A 3L72E 3L72J 1D1DA 3B4QA 1FS0E 3HE4B 1NTKG 3V5BA 2FY8A 3MGNA 4QNBA 2BQ1E 3L35A 3CCEP 1KYOI 3N4XA 2LKIA 2NRGA 3AE2C 2G3AA 2LR2A 3TNUB 1K73Q 1GL2D 2KLUA 3LW5J 1BCCG 2DW3A 3WUUA 3Q5SA 4U0BA 1G2CB 2WITA 1KYOD 2OYHB 2K0XA 4C7RA 1OW7A 1Q81Q 1KD1Q 4Z1MH 3DS2A 1QL1A 1NWQA 3E7KA 3EJBA 1EZVI 1S72P 1BSNA 2H89C 1M7LA 2B88A 3CCVP 1H89A 4EOTA 5KKZB 1EZVD 1R5SA 2LKMA 2YMYA 1OVVA 3V6IA 2CK3H 2YIUB 1DD3A 3RBXA 1RE4A 1IMQA 2E42A 2K93A 3S4RA 1ZXGA 2OARA 4I1LA 3DS1A 3WMM0 1N7SD 2JAZA 2VRSA 1JY3N 3V4WA 2GYKA 2PP6A 2WSEJ 5AW9B 1S3JA 1L0NE 1L0NJ 2WQYC 1S9KD 1FJPA 1NAFA 2WVRA 4PJ0E 1ZV8A 2IFNA 3KDPB 4PV1D 3CX5E 1PP9D 1VKUA 1LWUA 3TGUE 3TGUJ 4ZKPA 2C9LY 3HE4A 3AEFC 3AE1C 3RL0g 4PH0A 4GOEA 1R5LA 1RF0A 2ZFCA 1NH4A 3M0DC 2IBZG 5APUA 1RF1B 1AFOA 1NOHA 3TNUA 1GU4A 2LTEA 2HPCB 2FADA 1JB0J 3AE4C 1G2CA 2QEXP 2KB7P 5AW2B 2OYHA 4IL6X 4GIFA 3GMAA 2QJYB 3BRTB 2KK7A 4U0DA 1GXHA 2Q7CA 2E76C 3M1MA 2GZGA 2AF8A 1VQMP 2EHTA 2AXCA 2R32A 2H7HA 3A3YB 3L75D 1VQKP 3E1RA 1IZNB 4RJTA 1CW5A 2KOQA 3GZLA 1PPJD 2PGDA 3A7OA 4PD4H 2KUBA 2L91A 2A06D 5AVQB 2EFJA 1NTZD 3SWYA 2VLOA 1BDDA 2XU6A 1SP4A 2CPSA 4XFYA 3SWFA 3RGUA 5GTIH 1T2KC 2JYLA 1NHLA 1UNKA 1LT9A 1Y9BA 1K30A 1J1EB 2MVUA 1ZR4A 2XZ0D 1E0HA 2EG5A 2L5GB 1KV4A 4Y99B 2N1TD 3D71A 1JJ2O 2OYOA 1S5LX 2KNCB 3RK3E 1RE3A 2N1TB 3H1HG 1VPCA 1YTZT 2JR8A 1FZFA 1USEA 1BCCE 1BCCJ 1JOCA 2FYNC 3P8CE 4M0IA 2HPCA 1GK6A 1PP9G 2POHA 4D6TE 4D6TJ 3E1IA 4AQRD 3A0BE 2A45G 4U0CA 2ERHA 1VQ5P 1QL2A 3L70D 4YTPC 4IFMA 2VLPA 2Z45A 1RE4C 5AW4B 1YQ4C 1ZN5A 3CCMP 2LPKA 1GU5A 5AW7B 2PEOA 1AV1A 2KOPA 3P05A 2XV5A 5APYA 3AE5C 5KJ7A 1FZEA 1MV8A 5KAFE 2BEQD 3EJDA 2JBGA 2SPZA 1LP1B 1IFJA 4WBAA 4NPEA 2K9YA 2XZRA 5B5EE 3CX5I 3DS4A 1LWUC 2GZJA 1IFIA 1ZRTE 3TF5A 4IL6H 3QH9A 1GW4A 3PRJA 3L75G 2L22A 1D7MA 3F89A 2IZ1A 3E2DA 4HKZH 2KZIA 2KXPB 1RF0C 1T3UA 3LW5H 3G1GA 5B66E 2Z46A 1MKMA 1PPJG 5AVXB 3VTPC 4OWFA 2XNDH 3M0AA 2FBWC 3AE8C 1PV3A 1MZ9A 2O01H 1CSBA 1MUUA 1KORA 1T8ZA 2WSFJ 3OJAB 5APXA 3G9RA 4TLFA 1OVRA 1L4AC 1SFCD 3H1LE 3H1LJ 2KI7B 5GTHH 3ITKA 2FXMA 4H44D 4K35A 1LTSC 3PJSK 4BRYB 1JCCA 1NKNA 2DNWA 1W2BO 1HF9A 2FFDA 3VMYA 4HKGA 1AQTA 2Q6QA 2RKLA 5KAIH 3TYYA 5TISE 2VSQA 3HYBA 4YPCA 4L74A 2UWJE 2WSEH 2EIAA 5AW6B 3HE5A 5AVVB 1KYOE 4A7PA 3AE9C 2JB0A 1S5LH 1URQA 3LRYA 1LT9C 2GM4A 2E76D 2C9NY 1S4XA 1Q86Q 4RO0A 1HY8A 2PEKA 2YKPA 1SS1A 1IMPA 2X2BA 2BCCD 4UB6E 1QGKB 1EZVE 3B8EB 3JCUH 1P84D 4CA3A 1EMVA 1BDCA 3CL3D 3SFEC 1RE3C 1VF5C 3C1LA 2Y9YA 2G8YA 1L0LK 2J59M 4B86A 4C7NB 1NTKD 4OH8B 2FACA 1LTTC 2Y0EA 1H0TA 2E75B 1RNIA 4DCKA 2QRXA 3USSA 1YTZI 2C0WA 2AFDA 1T2KD 4DG9A 2O1JA 1S9KE 4COCA 2WWWA 3OW2O 3B5IA 3C8VA 2YKOA 2KGEA 2YMKA 3D6YA 1SQBE 1SQBJ 1Q2NA 2ZJSE 2XNXA 4NPFX 2FYZA 4RESB 1X3OA 1X9VA 3NMDA 2JGPA 3CXCO 5KJ7C 3H6PA 4MRTC 1EC5A 3Q5RA 3MZWB 1AYIA 2ZAEB 2ZVNB 3WBHA 5CJ4A 3RK2D 1KILE 2GZIA 3VMAA 2N5HA 2JWDA 2V7QJ 2MY5A 1IUQA 4IZ6A 1HVVA 3M0DA 5CJ0A 5AVRB 1M57D 1KB9H 4EYYQ 2IZ0A 1ZP0C 1M6EX 4NPDA 4WY4A 3K5BA 4Y99C 2WSSH 1N2DC 3HD7A 2NPSA 3L75E 2KYVA 1JTHA 3PTZA 4JF7A 2IBZI 4XRQA 1PPJE 2J58A 4HJGH 1MFTA 2W8ZA 3B5NA 4C7NA 2A06E 4N78E 1NTZE 1NTZJ 3HTKB 1X0TA 1E6JP 1USDA 3A0HE 2IBZD 2XT1A 1CI6A 3M06A 4K3AA 1JY3O 3JSVC 1M1JA 2P2UA 5JPAA 1S1CX 3F5HA 1FOSF 4IOIH 2ZT9C 2FFDC 2PEMA 4WWIA 1YJ9P 2AXTE 3ABVC 1NVOA 2FQ2A 2HYNA 3AEGC 1LWUB 3GKLC 1BE3G 2E74C 2O1KA 4L76A 3IFMA 3WU2E 1T6AA 2Q3EA 1URQC 2L9FA 1PGPA 5AVUB 1VQPP 1QX8A 2P10A 4GR6A 3L73G 4BXLA 5B5EH 3CWBE 1SQQK 3CWBJ 2Z4EA 1VQ9P 1M74A 2P1JA 1EDJA 4Y28J 1N8RQ 1QVFO 3G21A 4I7ZC 3I5CA 5B66H 3CCLP 1L4AB 1RY3A 1YBKA 1M90Q 3TSIA 3L70E 3L70J 1S2EA 1FC2C 3KZIH 3SFDC 3GJNA 2BUOA 1CEIA 5E79E 2W27A 3DS0A 2RMZA 3I56P 2WSFH 3RG2A 4LC1A 1LTBC 1GTWA 3VOPA 1BAJA 3GG2A 4KHXA 2FYUK 3H1HD 1K8AQ 1Q82Q 3HTKA 1NU1K 1VQLP 1VHNA 2WSCJ 1A02F 2N6ZA 1LT9B 2KODA 2WT7A 4AYCA 5APWA 2A45I 4JYBA 2GDXA 2JKVA 1VF5D 1QVGO 1W5CE 1JY2O 3DTJA 2KOOA 2AEMA 3VN0A 2L6EA 3G29A 3G26A 1YJWP 2J5UA 1M6NA 1VF5B 5BU8B 2FYUG 1PFIA 3AEAC 3W67A 2GZEA 1NU1G 4PD4D 4GOFA 2BHVA 4XFJA 2D2CC 1EQ7A 1FZCA 2M8NA 2HODB 3S9OA 1JMMA 2FQ1A 4WY4C 2FVAA 5F2OA 1OMIA 1L2PA 2V4HA 1OW6A 1SQVD 2FHSC 3HD7C 4N3YB 2NPSC 1SQXK 3UIAA 5EFWB 2K9JA 2ZYDA 4AUWA 3W68A 2OQQA 2O3JA 2JDIH 1IK9A 1K9MQ 1L4AA 1SQPD 5KJ7D 5APVA 1YIJP 3B5NC 1J2JB 3CCUP 5HGNA 1MZ8A 3MP7B 2E75C 2P7JA 3OA7A 2K92A 4IFDK 1FZBA 3GLMA 1KFNA 1M1JC 2KSJA 7CEIA 1DX7A 5DJUB 4I2LC 3V4QA 3G71P 1NTMK 1ZOYC 2CQ8A 3NXSA 1A43A 1RH5B 1YJNP 2BCCE 2BCCJ 2QJKC 1N73C 2M8RA 2ZYGA 3P7KA 2M5RA 1Y47A 4U3FG 1VQOP 2QJPC 5KP8B 4HB1A 1TU3F 2OTKE 3CMEP 1FE6A 5F2KA 2V7QH 1ZLLA 1NTKE 1NTKJ 3A5TA 5HVCA 2PNGA 1HGVA 5H2FE 1WT6A 2GUSA 4HH2A 2N50A 2GA1A 3CLQA 3Q3DA 1PEOA 3FX0A 3HUSA 2HODA 3U1CA 2ZT9D 1HQBA 1FOSE 4PXHB 2BASA 1LT1A 3HZQA 1SQVK 2KGDA 5BS2A 4JPZB 2H8PD 2KG9A 2AVAA 2YXQB 4H2YC 2E74D 2ZT9B 4XA4A 2FFDB 4ZKUA 2M3EA 1OXZA 1SQPK 2LMLA 1URQD 4YXDC 3HRNA 5KLVK 1KC8Q 3HE5B 2L0QA 2E74B 2N9BA 5DCKA 1GMJA 2KZJA 3GF7A 1LGHB 4IPYA 1M1KQ 1URQB 4XFZA 1OFCX 2AEFA 5HV8A 2ZYAA 1SQVG 3CXHH 2KWLA 1DNYA 1RQVA 1OX3A 3P8MC 1AF8A 1LTAC 2QA4P 5CBNA 1SQPG 2GDWA 4I7ZB 5AVSB 5KLVG 3WU2H 4JYCA 2KP8A 1PEMA 5AVYB 2GDYA 3RG6C 5HGLA 2PAJA 3CE7A 5I4TG 1L0LD 2JO0A 3H1JD 2H88C 1AVYA 3M91A 4COPA 1K05A 1FZCC 1H0TB 2WPRA 2I1KA 1T8KA 2Q9IA 4IFFA 1DEEG 2IBZE 5AW0B 3U43A 3EQ2A 3U1AA 1A02J 1JO5A 3TGUD 1PEQA 2I8DA 3L4FA 2KIKA 3DS3A 1PGOA 3PP5A 3IN6A 3BASA 1JMBA 1XTGB 1IFNA 4XE5B 2CGQA 2XKMA 1OVUA 2R3SA 5APTA 4C46A 3H1KD 2HFED 3GZMA 2LL8A 1YI2P 1PIXA 2MR7A 2WPSA 1WRGA 2M8PA 1LJ2A 3H0DA 1ZR2A 4GKGA 1VQ8P 4U0FA 1MFZA 3GF3A 2Y9ZA 4WY4D 1LNQA 2RH0A 2GZFA 4PJ0H 2W6JH 2D2CB 1BGYD 3HD7D 2NPSD 3D6ZA 1G1IA 3CX5H 3AE6C 5EW5E 4WY4B 5K5GB 5AVTB 1P84I 1AQ5A 4U0AA 3HD7B 2NPSB 1JTHB 3B5ND 1KN7A 1VQ7P 4H2XC 2MKVA 3CCJP 1Z6MA 2FQ0A 2W6BA 1RO2A 3KPEA 2PENA 5AVZB 2E75D 1BE3D 1L0NK 1RO0A 3B5NB 5AW3B 2WPQA 1VL2A 3HUSC 3Q5PA 1ZMBA 2K37A 1DV5A 2ZXEB 2KOSA 1CI6B 3H1HJ 3H1HE 3VYIA 1LTGC 3VMXA 4BWNA 1M1JB 3G28A 1JNMA 1KB9D 1U7MA 3L73D 4M3LA 3H32B 1K04A 4EDFA 1HUCA 1JY3P 1PP9E 1PP9J 3T97A 1ZNVA 2QJKB 2HLOA 1L0LG 2QIWA 1N73B 2KR5A 3H1JG 3M9HA 3SSUA 1Y8AA 2JEEA 2N9YB 2EHSA 2K5XA 4GT1A 3I55P 4R0MA 2ZVOB 2IDBA 3RK3B 1KILC 2ZXXA 4L75A 1NO4A 2M8LA 1U7JA 2QJPB 4PD4E 1PGJA 5CCHA 3BATA 4TT3H 1SQQD 4QKOA 4H13C 3TGUG 3GW6A 2OTLP 3VP8A 3FGAD 2QG4A 1SQVE 2FKWB 2K2QA 1EDKA 3NTEA 1LTJC 1FBMA 3AEEC 3NFQA 1YYCA 3H1KG 4U0EA 1OR5A 3L74D 4LLHA 3U59A 2Z5HA 4MN4C 3C9IA 3L75J 5KTBA 3NTNA 1PL5A 2CPBA 3B4SA 2PFXA 1HJBA 3H25A 4OGQC 5CZDB 3L71D 3M9BA 1BGYG 1DEBA 2FYUD 2YO2A 1X8YA 2KGCA 1NU1D 4BPHA 1UIIA 5CHXA 3A0BH 2JJLA 1IFMA 2QE7H 2WT7B 3LIDA 1KQLA 2K94A 2FXPA 1VQ6P 2LIUA 1NGMB 4DOJA 1UIXA 2W90A 3H32A 4LGDE 3O8ZA 4BPFA 2B87B 1N73A 2JWAA 3BCCD 1GZLA 4JQ0D 1JY2P 2E43A 4H2WC 5KP7B 5KAFH 2L4BA 5KLIC 1FZCB 4JBZA 3CC7P 3O6QB 2LXBA 2FAEA 1L4AD 1DD4A 1YITP 1VQNP 2YKQA 4YXWH 2OYIC 4OVNF 1OW8A 4IL6E 2K9JB 1Q90D 1SQXD 3GHGB 1M56D 4H0LC 3R4YA 2QM7A 2AFEA 2I1JA 2MJZA 1R8EA 2JQ4A 3QWOC 2NZ2A 2R3CA 1GXGA 4DJGA 4EIJA 1GL2B 2ROQA 4D6TG 1YHQP 1NKZB 1SQQG 3L37A 2O01J 1X79B 2M3BA 4R4MA 3MHVA 4U3FD 5AW5B 4ZNCA 4XFXA 1DIPA 2Y0DA 3V2NA 5CBOA 4O9BA 1NTMD 2QNWA 5GTHE 1PEUA 2R44A 5APQA 1AVOA 2VLQA 3L74G 5CCGA 3CMAP 5BVZA 3SWKA 1LTIC 5KAIE 4W7ZA 5TISH 1U57A 1L0LE 1L0LJ 1KLPA 4N6JA 3DS5A 2O01N 3H1JE 3H1JJ 3FWLA 2B87A 3RL0C 5CCHC 1N7LA 4PD4I 1KYOH 1NJIQ 3CCRP 5APSA 3L71G 3AEDC 1T3JA 1N7SB 1S5LE 1EXIA 2KGAA 4KJMA 2ONTA 2K1AA 1SFCC 2KS1B 4GODA 3CCSP 2CNRA 1SQBD 2W6AA 3HUSB 1CZQA 1YQ3C 4H44C 3VRLC 4PV1B 1ZMEC 4UB6H 3O6QA 3OAKA 1GPJA 1HH0A 1FDIA 3JCUE 2PEJA 2RN0A 2K0DX 3GHGA 2E5TA 2Z44A 3G3ZA 3BCCG 3H47A 1KILD 2N6YA 3H1KE 3H1KJ 4RKUJ 4WVZA 5C39A 3AE7C 5KLVD 3N7NA 4ZMDA 3H1LG 1IK7A 5HGMA 1GL2A 1KILB 4H13D 2KW2A 5DJTB 1EDLA 2P9XA 4PH1A 2PEQA 3IF4A 3PLNA 1HTLC 2MVVA 4UB8E 4DZOA 1BGYE 1BGYJ 1SQXG 1GK4A 2K88A 3V2RA 1FZGA 3PH0A 4H13B 1OZHA 1G1JA 1FU1A 1E5WA 3BVHA 2QM8A 1L0HA 2A45H 5AVWB 1HJ0A 3LIEA 3EWKA 3Q1MA 2XXMA 1LTJB 1P84E 1VDFA 1NAYA 1EXJA 1GDTA 3RK3C 4N78D 1GD2E 3D70A 2AEJA 3A2AA 1BE3E 2N5IA 1BE3J 4OGQD 3MD0A 3CXHI 3LMOA 1EDIA 2MR8A 5HGOA 1RHZB 2JYGA 1EZVG 1KMIZ 3H1ID 1NTMG 3VMZA 1WMKA 1JY2N 1N7SA 3CC4P 4OGQB 2KOGA 3MGEA 3CXHD 1KB9E 3TK1A 3L73E 3L73J 3CPWO 2KS1A 2KG6A 3L72D 1SQBK 3P32A 1OIPA 3CD6P 1J1DC 5L8RJ 1XTCC 1KFMA 1JUNA 1NYHA 2FVFA 3CWBD 3RK2C 1JCDA 2YXRB 2N98A 1RF1A 2YNYA 2QSIA 1QLED 2M5AB 2IFMA 3M9QA 3EFGA 3FXDA 3IR9A 4ASWA 3VP9A 2XV6A 1SQBG 3A0HH 1SQQE 1SQQJ 4QMAA 3MIWA 1KILA 5AW8B 1E79H 1BXIA 3Q2YA 5KLIB 4PWVB 2KORA 4NEOA 1EIAA 1AA0A 2Q3IA 3G1IA 3MUDA 4H0LD 5CCGC 2LOLA 2AXTH 5M1BA 3KHUA 1HWTC 2OYIB 2LF4A 2IPPA 4F37A 3L74E 3L74J 4H0LB 1FJKA 3G0VA 3IAOA 2Q1KA 3WUVA 2Y0CA 1LTJA 3B71A 1H88A 1NTZK 1L0ND 2LXCB 2W83C 1W2EA 3H4EA 3L71E 3L71J 1DH3A 3CCQP 2VLNA 4UHPB 2E5YA 2FYUE 2FYUJ 4WB4A 1NU1E 1NU1J 3CX5D 3S1KA 4KT0J 2FVEA 2GUVA 1IFDA 3GHGC 3TDKA 2KSEA 3NY7B 1KZUB 4W80A 3T97B 1ACPA 3KZIE
chains in the Genus database with same CATH topology
3VRLC 4XFYA 5BS1A 1YIJP 3CD6P 3DS4A 1VQ8P 4U0FA 2BUOA 3CCUP 2PEIA 2OTJP 2JYLA 2OTLP 5HGNA 1YITP 1VQNP 5DCKA 2PEJA 4IPYA 1M1KQ 4XFZA 1VQ4P 3DS0A 1K30A 3G6EP 1QRJA 3E2DA 3I56P 2Z44A 3NTEA 2EG5A 3G1GA 3H47A 4XRQA 1BAJA 2Z46A 1JJ2O 3G71P 4U0AA 1D1DA 3G4SP 3CC2P 4U0EA 1K8AQ 1E6JP 2XV6A 1A43A 1RNIA 2QA4P 1Q82Q 1VQLP 1YJNP 2XT1A 5HGMA 1YHQP 1VQ7P 2KODA 4QNBA 4PH0A 2P9XA 2BQ1E 3CCJP 4COCA 5JPAA 1PEMA 3CCEP 1RO2A 4PH1A 2PEQA 3RG6C 1EIAA 2PENA 5HGLA 3OW2O 1K73Q 3G1IA 3B5IA 5I4TG 1QVGO 4XFXA 2PEMA 2JO0A 1YJ9P 1RO0A 3DTJA 4GR2A 4COPA 1VQOP 4U0BA 2L6EA 4M0IA 1ZMBA 2QEXP 3CMEP 3G29A 3G26A 5F2KA 2LF4A 1YJWP 1M6NA 1Q81Q 4WYMA 1KD1Q 4U0DA 1PEUA 3DS2A 3M1MA 3G28A 3G0VA 2XXMA 4U0CA 3CXCO 1VQ5P 1W2BO 1S72P 3CMAP 1A8OA 1PEOA 2BHVA 1VQ6P 1VQPP 3CCVP 2Z45A 1VQMP 2M8NA 4GR6A 1PEQA 3HYBA 3WBHA 3CCMP 3DS3A 2EIAA 3DS5A 4XROA 2PEOA 3H4EA 1VQKP 1VQ9P 5F2OA 3CCQP 1M74A 1NJIQ 1IUQA 1KC8Q 3P05A 3CCRP 3HZQA 3DPHA 5HGOA 2CWOA 1N8RQ 5BS2A 1QVFO 1KQSO 2JYGA 3G21A 1AUMA 3I55P 5F2NA 3LRYA 3CC4P 1EOQA 2E1MA 2PY8A 2DGYA 3MGEA 2ONTA 1Q7YQ 3CCLP 2M8LA 3Q20A 1M6EX 3CCSP 1Q86Q 1K9MQ 3CPWO 2OARA 2PEKA 2EFJA 3DS1A 1YI2P 1M90Q 3CC7P 2M8PA 3H0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A Q;  1VQK P;  3CC2 P;  1YIJ P;  1VQ9 P;  3CD6 P;  3CCQ P;  2QA4 P;  1YJW P;  1Q82 Q;  1Q81 Q;  3CCU P;  1NJI Q;  1KC8 Q;  3CCR P;  1YJN P;  1VQ8 P;  1KD1 Q;  1VQL P;  2OTL P;  2OTJ P;  1YIT P;  1VQN P;  1N8R Q;  1QVF O;  1YHQ P;  1KQS O;  1M1K Q;  1VQ7 P;  1VQ4 P;  3I55 P;  3CCJ P;  3CC4 P;  3CCE P;  3G6E P;  3CXC O;  3I56 P;  1VQ5 P;  1S72 P;  1W2B O;  3CMA P;  3OW2 O;  1Q7Y Q;  1K73 Q;  3CCL P;  1VQ6 P;  1Q86 Q;  3CCS P;  1QVG O;  1K9M Q;  3CPW O;  3CCV P;  1VQP P;  1VQM P;  1YJ9 P;  1YI2 P;  1M90 Q;  3CC7 P;  1VQO P;  3CCM P;  1JJ2 O;  3G71 P;  3G4S P;  2QEX P;  3CME P; 
#chains in the Genus database with same CATH topology
 2A06 G;  2K0Y A;  2BEZ F;  3MTU E;  1NTZ G;  4U7J A;  2OYH C;  2OTJ P;  2KNC A;  5E79 H;  5CCH D;  4CPG A;  3RL0 D;  1FDO A;  1N86 A;  1AJY A;  2N1T A;  1GL2 C;  1KQF B;  1QRJ A;  3BCC E;  3BCC J;  3H1I G;  4EI2 A;  3RL0 B;  2M5A A;  3CI9 A;  2D2C D;  1PZQ A;  3L72 G;  5KKZ C;  2WSC H;  1KTM A;  1FZA A;  3KYQ A;  3WUT A;  1SFC B;  2YIU C;  3AEC C;  2IYO A;  1SQX E;  1SQX J;  5KP6 B;  4H44 B;  4GR2 A;  2JP3 A;  1SLQ A;  2B89 A;  3CWB G;  1KQG B;  4ASV A;  1RQU A;  2OYI A;  4W7Y A;  3EFF K;  1A8O A;  3KXD A;  1NQ4 A;  2QVA A;  1N7S C;  1LP1 A;  4U3F E;  4U3F J;  1UJZ A;  1IJD B;  3L70 G;  1FAV A;  1KB9 I;  2E76 B;  5TJH A;  1NTM E;  1NTM J;  3BRV B;  4BPG A;  2CWO A;  1KQS O;  4PV1 C;  2FXO A;  2WTY A;  2E1M A;  2DGY A;  4R4L A;  2WPT A;  2MF4 A;  3Q20 A;  2MD9 A;  2JU2 A;  2K3R A;  2C0X A;  1RF1 C;  3V2Q A;  3RK3 D;  2OGU A;  5BU5 A;  1IC2 A;  1L0N G;  2JU1 A;  5AW1 B;  2QJY C;  1BCC D;  2R5D A;  4UB8 H;  1HGZ A;  3P8C D;  2WZ7 A;  2H43 A;  3MUD C;  2ITA A;  4D6T D;  3G4S P;  3CC2 P;  3JC2 2;  4I6M C;  2M0B A;  4L73 A;  1BSH A;  2CG5 B;  1GW3 A;  5GTI E;  1L0I A;  2WPV B;  1JM0 A;  2HG5 D;  4BRY A;  1P84 H;  1SQV J;  1SFC A;  2R5B A;  3ZDM A;  2KLV A;  1F80 D;  3FXE A;  1J1D B;  3EJE A;  1Z56 A;  2HR3 A;  1SQP E;  1SQP J;  3R2P A;  5KLV E;  5KLV J;  4WYM A;  1M8O B;  5H2F H;  2IYP A;  3RK2 B;  2YO3 A;  3AE3 C;  5EJD A;  3FWN A;  2FYN B;  1SVF A;  3KQG A;  1J1E C;  2NO8 A;  2WMM A;  1JEK A;  4XRO A;  5CMZ A;  5CCG D;  1ZRT D;  1X22 A;  1QEX A;  1IO4 A;  2LIW A;  3DPH A;  3V2P A;  1AUM A;  4HYT B;  3PHL A;  5F2N A;  1EOQ A;  1OWA A;  2PY8 A;  2N1T C;  1Q7Y Q;  2XZ1 C;  1FDM A;  2P67 A;  1FR2 A;  3II6 A;  1NTK K;  2PRR A;  1HBW A;  2Z5I A;  5BS1 A;  2Q5U A;  2PEI A;  1PGQ A;  2XDJ A;  3RBZ A;  2BCC G;  1VQ4 P;  2KG8 A;  1ZW0 A;  3G6E P;  4DT0 A;  1IFP A;  2IX7 C;  2B9B A;  3H1I E;  3H1I J;  1H8A A;  4GDO A;  2P58 A;  3AEB C;  3CXH E;  3L36 A;  3H1L D;  2JO1 A;  3L72 E;  3L72 J;  1D1D A;  3B4Q A;  1FS0 E;  3HE4 B;  1NTK G;  3V5B A;  2FY8 A;  3MGN A;  4QNB A;  2BQ1 E;  3L35 A;  3CCE P;  1KYO I;  3N4X A;  2LKI A;  2NRG A;  3AE2 C;  2G3A A;  2LR2 A;  3TNU B;  1K73 Q;  1GL2 D;  2KLU A;  3LW5 J;  1BCC G;  2DW3 A;  3WUU A;  3Q5S A;  4U0B A;  1G2C B;  2WIT A;  1KYO D;  2OYH B;  2K0X A;  4C7R A;  1OW7 A;  1Q81 Q;  1KD1 Q;  4Z1M H;  3DS2 A;  1QL1 A;  1NWQ A;  3E7K A;  3EJB A;  1EZV I;  1S72 P;  1BSN A;  2H89 C;  1M7L A;  2B88 A;  3CCV P;  1H89 A;  4EOT A;  5KKZ B;  1EZV D;  1R5S A;  2LKM A;  2YMY A;  1OVV A;  3V6I A;  2CK3 H;  2YIU B;  1DD3 A;  3RBX A;  1RE4 A;  1IMQ A;  2E42 A;  2K93 A;  3S4R A;  1ZXG A;  2OAR A;  4I1L A;  3DS1 A;  3WMM 0;  1N7S D;  2JAZ A;  2VRS A;  1JY3 N;  3V4W A;  2GYK A;  2PP6 A;  2WSE J;  5AW9 B;  1S3J A;  1L0N E;  1L0N J;  2WQY C;  1S9K D;  1FJP A;  1NAF A;  2WVR A;  4PJ0 E;  1ZV8 A;  2IFN A;  3KDP B;  4PV1 D;  3CX5 E;  1PP9 D;  1VKU A;  1LWU A;  3TGU E;  3TGU J;  4ZKP A;  2C9L Y;  3HE4 A;  3AEF C;  3AE1 C;  3RL0 g;  4PH0 A;  4GOE A;  1R5L A;  1RF0 A;  2ZFC A;  1NH4 A;  3M0D C;  2IBZ G;  5APU A;  1RF1 B;  1AFO A;  1NOH A;  3TNU A;  1GU4 A;  2LTE A;  2HPC B;  2FAD A;  1JB0 J;  3AE4 C;  1G2C A;  2QEX P;  2KB7 P;  5AW2 B;  2OYH A;  4IL6 X;  4GIF A;  3GMA A;  2QJY B;  3BRT B;  2KK7 A;  4U0D A;  1GXH A;  2Q7C A;  2E76 C;  3M1M A;  2GZG A;  2AF8 A;  1VQM P;  2EHT A;  2AXC A;  2R32 A;  2H7H A;  3A3Y B;  3L75 D;  1VQK P;  3E1R A;  1IZN B;  4RJT A;  1CW5 A;  2KOQ A;  3GZL A;  1PPJ D;  2PGD A;  3A7O A;  4PD4 H;  2KUB A;  2L91 A;  2A06 D;  5AVQ B;  2EFJ A;  1NTZ D;  3SWY A;  2VLO A;  1BDD A;  2XU6 A;  1SP4 A;  2CPS A;  4XFY A;  3SWF A;  3RGU A;  5GTI H;  1T2K C;  2JYL A;  1NHL A;  1UNK A;  1LT9 A;  1Y9B A;  1K30 A;  1J1E B;  2MVU A;  1ZR4 A;  2XZ0 D;  1E0H A;  2EG5 A;  2L5G B;  1KV4 A;  4Y99 B;  2N1T D;  3D71 A;  1JJ2 O;  2OYO A;  1S5L X;  2KNC B;  3RK3 E;  1RE3 A;  2N1T B;  3H1H G;  1VPC A;  1YTZ T;  2JR8 A;  1FZF A;  1USE A;  1BCC E;  1BCC J;  1JOC A;  2FYN C;  3P8C E;  4M0I A;  2HPC A;  1GK6 A;  1PP9 G;  2POH A;  4D6T E;  4D6T J;  3E1I A;  4AQR D;  3A0B E;  2A45 G;  4U0C A;  2ERH A;  1VQ5 P;  1QL2 A;  3L70 D;  4YTP C;  4IFM A;  2VLP A;  2Z45 A;  1RE4 C;  5AW4 B;  1YQ4 C;  1ZN5 A;  3CCM P;  2LPK A;  1GU5 A;  5AW7 B;  2PEO A;  1AV1 A;  2KOP A;  3P05 A;  2XV5 A;  5APY A;  3AE5 C;  5KJ7 A;  1FZE A;  1MV8 A;  5KAF E;  2BEQ D;  3EJD A;  2JBG A;  2SPZ A;  1LP1 B;  1IFJ A;  4WBA A;  4NPE A;  2K9Y A;  2XZR A;  5B5E E;  3CX5 I;  3DS4 A;  1LWU C;  2GZJ A;  1IFI A;  1ZRT E;  3TF5 A;  4IL6 H;  3QH9 A;  1GW4 A;  3PRJ A;  3L75 G;  2L22 A;  1D7M A;  3F89 A;  2IZ1 A;  3E2D A;  4HKZ H;  2KZI A;  2KXP B;  1RF0 C;  1T3U A;  3LW5 H;  3G1G A;  5B66 E;  2Z46 A;  1MKM A;  1PPJ G;  5AVX B;  3VTP C;  4OWF A;  2XND H;  3M0A A;  2FBW C;  3AE8 C;  1PV3 A;  1MZ9 A;  2O01 H;  1CSB A;  1MUU A;  1KOR A;  1T8Z A;  2WSF J;  3OJA B;  5APX A;  3G9R A;  4TLF A;  1OVR A;  1L4A C;  1SFC D;  3H1L E;  3H1L J;  2KI7 B;  5GTH H;  3ITK A;  2FXM A;  4H44 D;  4K35 A;  1LTS C;  3PJS K;  4BRY B;  1JCC A;  1NKN A;  2DNW A;  1W2B O;  1HF9 A;  2FFD A;  3VMY A;  4HKG A;  1AQT A;  2Q6Q A;  2RKL A;  5KAI H;  3TYY A;  5TIS E;  2VSQ A;  3HYB A;  4YPC A;  4L74 A;  2UWJ E;  2WSE H;  2EIA A;  5AW6 B;  3HE5 A;  5AVV B;  1KYO E;  4A7P A;  3AE9 C;  2JB0 A;  1S5L H;  1URQ A;  3LRY A;  1LT9 C;  2GM4 A;  2E76 D;  2C9N Y;  1S4X A;  1Q86 Q;  4RO0 A;  1HY8 A;  2PEK A;  2YKP A;  1SS1 A;  1IMP A;  2X2B A;  2BCC D;  4UB6 E;  1QGK B;  1EZV E;  3B8E B;  3JCU H;  1P84 D;  4CA3 A;  1EMV A;  1BDC A;  3CL3 D;  3SFE C;  1RE3 C;  1VF5 C;  3C1L A;  2Y9Y A;  2G8Y A;  1L0L K;  2J59 M;  4B86 A;  4C7N B;  1NTK D;  4OH8 B;  2FAC A;  1LTT C;  2Y0E A;  1H0T A;  2E75 B;  1RNI A;  4DCK A;  2QRX A;  3USS A;  1YTZ I;  2C0W A;  2AFD A;  1T2K D;  4DG9 A;  2O1J A;  1S9K E;  4COC A;  2WWW A;  3OW2 O;  3B5I A;  3C8V A;  2YKO A;  2KGE A;  2YMK A;  3D6Y A;  1SQB E;  1SQB J;  1Q2N A;  2ZJS E;  2XNX A;  4NPF X;  2FYZ A;  4RES B;  1X3O A;  1X9V A;  3NMD A;  2JGP A;  3CXC O;  5KJ7 C;  3H6P A;  4MRT C;  1EC5 A;  3Q5R A;  3MZW B;  1AYI A;  2ZAE B;  2ZVN B;  3WBH A;  5CJ4 A;  3RK2 D;  1KIL E;  2GZI A;  3VMA A;  2N5H A;  2JWD A;  2V7Q J;  2MY5 A;  1IUQ A;  4IZ6 A;  1HVV A;  3M0D A;  5CJ0 A;  5AVR B;  1M57 D;  1KB9 H;  4EYY Q;  2IZ0 A;  1ZP0 C;  1M6E X;  4NPD A;  4WY4 A;  3K5B A;  4Y99 C;  2WSS H;  1N2D C;  3HD7 A;  2NPS A;  3L75 E;  2KYV A;  1JTH A;  3PTZ A;  4JF7 A;  2IBZ I;  4XRQ A;  1PPJ E;  2J58 A;  4HJG H;  1MFT A;  2W8Z A;  3B5N A;  4C7N A;  2A06 E;  4N78 E;  1NTZ E;  1NTZ J;  3HTK B;  1X0T A;  1E6J P;  1USD A;  3A0H E;  2IBZ D;  2XT1 A;  1CI6 A;  3M06 A;  4K3A A;  1JY3 O;  3JSV C;  1M1J A;  2P2U A;  5JPA A;  1S1C X;  3F5H A;  1FOS F;  4IOI H;  2ZT9 C;  2FFD C;  2PEM A;  4WWI A;  1YJ9 P;  2AXT E;  3ABV C;  1NVO A;  2FQ2 A;  2HYN A;  3AEG C;  1LWU B;  3GKL C;  1BE3 G;  2E74 C;  2O1K A;  4L76 A;  3IFM A;  3WU2 E;  1T6A A;  2Q3E A;  1URQ C;  2L9F A;  1PGP A;  5AVU B;  1VQP P;  1QX8 A;  2P10 A;  4GR6 A;  3L73 G;  4BXL A;  5B5E H;  3CWB E;  1SQQ K;  3CWB J;  2Z4E A;  1VQ9 P;  1M74 A;  2P1J A;  1EDJ A;  4Y28 J;  1N8R Q;  1QVF O;  3G21 A;  4I7Z C;  3I5C A;  5B66 H;  3CCL P;  1L4A B;  1RY3 A;  1YBK A;  1M90 Q;  3TSI A;  3L70 E;  3L70 J;  1S2E A;  1FC2 C;  3KZI H;  3SFD C;  3GJN A;  2BUO A;  1CEI A;  5E79 E;  2W27 A;  3DS0 A;  2RMZ A;  3I56 P;  2WSF H;  3RG2 A;  4LC1 A;  1LTB C;  1GTW A;  3VOP A;  1BAJ A;  3GG2 A;  4KHX A;  2FYU K;  3H1H D;  1K8A Q;  1Q82 Q;  3HTK A;  1NU1 K;  1VQL P;  1VHN A;  2WSC J;  1A02 F;  2N6Z A;  1LT9 B;  2KOD A;  2WT7 A;  4AYC A;  5APW A;  2A45 I;  4JYB A;  2GDX A;  2JKV A;  1VF5 D;  1QVG O;  1W5C E;  1JY2 O;  3DTJ A;  2KOO A;  2AEM A;  3VN0 A;  2L6E A;  3G29 A;  3G26 A;  1YJW P;  2J5U A;  1M6N A;  1VF5 B;  5BU8 B;  2FYU G;  1PFI A;  3AEA C;  3W67 A;  2GZE A;  1NU1 G;  4PD4 D;  4GOF A;  2BHV A;  4XFJ A;  2D2C C;  1EQ7 A;  1FZC A;  2M8N A;  2HOD B;  3S9O A;  1JMM A;  2FQ1 A;  4WY4 C;  2FVA A;  5F2O A;  1OMI A;  1L2P A;  2V4H A;  1OW6 A;  1SQV D;  2FHS C;  3HD7 C;  4N3Y B;  2NPS C;  1SQX K;  3UIA A;  5EFW B;  2K9J A;  2ZYD A;  4AUW A;  3W68 A;  2OQQ A;  2O3J A;  2JDI H;  1IK9 A;  1K9M Q;  1L4A A;  1SQP D;  5KJ7 D;  5APV A;  1YIJ P;  3B5N C;  1J2J B;  3CCU P;  5HGN A;  1MZ8 A;  3MP7 B;  2E75 C;  2P7J A;  3OA7 A;  2K92 A;  4IFD K;  1FZB A;  3GLM A;  1KFN A;  1M1J C;  2KSJ A;  7CEI A;  1DX7 A;  5DJU B;  4I2L C;  3V4Q A;  3G71 P;  1NTM K;  1ZOY C;  2CQ8 A;  3NXS A;  1A43 A;  1RH5 B;  1YJN P;  2BCC E;  2BCC J;  2QJK C;  1N73 C;  2M8R A;  2ZYG A;  3P7K A;  2M5R A;  1Y47 A;  4U3F G;  1VQO P;  2QJP C;  5KP8 B;  4HB1 A;  1TU3 F;  2OTK E;  3CME P;  1FE6 A;  5F2K A;  2V7Q H;  1ZLL A;  1NTK E;  1NTK J;  3A5T A;  5HVC A;  2PNG A;  1HGV A;  5H2F E;  1WT6 A;  2GUS A;  4HH2 A;  2N50 A;  2GA1 A;  3CLQ A;  3Q3D A;  1PEO A;  3FX0 A;  3HUS A;  2HOD A;  3U1C A;  2ZT9 D;  1HQB A;  1FOS E;  4PXH B;  2BAS A;  1LT1 A;  3HZQ A;  1SQV K;  2KGD A;  5BS2 A;  4JPZ B;  2H8P D;  2KG9 A;  2AVA A;  2YXQ B;  4H2Y C;  2E74 D;  2ZT9 B;  4XA4 A;  2FFD B;  4ZKU A;  2M3E A;  1OXZ A;  1SQP K;  2LML A;  1URQ D;  4YXD C;  3HRN A;  5KLV K;  1KC8 Q;  3HE5 B;  2L0Q A;  2E74 B;  2N9B A;  5DCK A;  1GMJ A;  2KZJ A;  3GF7 A;  1LGH B;  4IPY A;  1M1K Q;  1URQ B;  4XFZ A;  1OFC X;  2AEF A;  5HV8 A;  2ZYA A;  1SQV G;  3CXH H;  2KWL A;  1DNY A;  1RQV A;  1OX3 A;  3P8M C;  1AF8 A;  1LTA C;  2QA4 P;  5CBN A;  1SQP G;  2GDW A;  4I7Z B;  5AVS B;  5KLV G;  3WU2 H;  4JYC A;  2KP8 A;  1PEM A;  5AVY B;  2GDY A;  3RG6 C;  5HGL A;  2PAJ A;  3CE7 A;  5I4T G;  1L0L D;  2JO0 A;  3H1J D;  2H88 C;  1AVY A;  3M91 A;  4COP A;  1K05 A;  1FZC C;  1H0T B;  2WPR A;  2I1K A;  1T8K A;  2Q9I A;  4IFF A;  1DEE G;  2IBZ E;  5AW0 B;  3U43 A;  3EQ2 A;  3U1A A;  1A02 J;  1JO5 A;  3TGU D;  1PEQ A;  2I8D A;  3L4F A;  2KIK A;  3DS3 A;  1PGO A;  3PP5 A;  3IN6 A;  3BAS A;  1JMB A;  1XTG B;  1IFN A;  4XE5 B;  2CGQ A;  2XKM A;  1OVU A;  2R3S A;  5APT A;  4C46 A;  3H1K D;  2HFE D;  3GZM A;  2LL8 A;  1YI2 P;  1PIX A;  2MR7 A;  2WPS A;  1WRG A;  2M8P A;  1LJ2 A;  3H0D A;  1ZR2 A;  4GKG A;  1VQ8 P;  4U0F A;  1MFZ A;  3GF3 A;  2Y9Z A;  4WY4 D;  1LNQ A;  2RH0 A;  2GZF A;  4PJ0 H;  2W6J H;  2D2C B;  1BGY D;  3HD7 D;  2NPS D;  3D6Z A;  1G1I A;  3CX5 H;  3AE6 C;  5EW5 E;  4WY4 B;  5K5G B;  5AVT B;  1P84 I;  1AQ5 A;  4U0A A;  3HD7 B;  2NPS B;  1JTH B;  3B5N D;  1KN7 A;  1VQ7 P;  4H2X C;  2MKV A;  3CCJ P;  1Z6M A;  2FQ0 A;  2W6B A;  1RO2 A;  3KPE A;  2PEN A;  5AVZ B;  2E75 D;  1BE3 D;  1L0N K;  1RO0 A;  3B5N B;  5AW3 B;  2WPQ A;  1VL2 A;  3HUS C;  3Q5P A;  1ZMB A;  2K37 A;  1DV5 A;  2ZXE B;  2KOS A;  1CI6 B;  3H1H J;  3H1H E;  3VYI A;  1LTG C;  3VMX A;  4BWN A;  1M1J B;  3G28 A;  1JNM A;  1KB9 D;  1U7M A;  3L73 D;  4M3L A;  3H32 B;  1K04 A;  4EDF A;  1HUC A;  1JY3 P;  1PP9 E;  1PP9 J;  3T97 A;  1ZNV A;  2QJK B;  2HLO A;  1L0L G;  2QIW A;  1N73 B;  2KR5 A;  3H1J G;  3M9H A;  3SSU A;  1Y8A A;  2JEE A;  2N9Y B;  2EHS A;  2K5X A;  4GT1 A;  3I55 P;  4R0M A;  2ZVO B;  2IDB A;  3RK3 B;  1KIL C;  2ZXX A;  4L75 A;  1NO4 A;  2M8L A;  1U7J A;  2QJP B;  4PD4 E;  1PGJ A;  5CCH A;  3BAT A;  4TT3 H;  1SQQ D;  4QKO A;  4H13 C;  3TGU G;  3GW6 A;  2OTL P;  3VP8 A;  3FGA D;  2QG4 A;  1SQV E;  2FKW B;  2K2Q A;  1EDK A;  3NTE A;  1LTJ C;  1FBM A;  3AEE C;  3NFQ A;  1YYC A;  3H1K G;  4U0E A;  1OR5 A;  3L74 D;  4LLH A;  3U59 A;  2Z5H A;  4MN4 C;  3C9I A;  3L75 J;  5KTB A;  3NTN A;  1PL5 A;  2CPB A;  3B4S A;  2PFX A;  1HJB A;  3H25 A;  4OGQ C;  5CZD B;  3L71 D;  3M9B A;  1BGY G;  1DEB A;  2FYU D;  2YO2 A;  1X8Y A;  2KGC A;  1NU1 D;  4BPH A;  1UII A;  5CHX A;  3A0B H;  2JJL A;  1IFM A;  2QE7 H;  2WT7 B;  3LID A;  1KQL A;  2K94 A;  2FXP A;  1VQ6 P;  2LIU A;  1NGM B;  4DOJ A;  1UIX A;  2W90 A;  3H32 A;  4LGD E;  3O8Z A;  4BPF A;  2B87 B;  1N73 A;  2JWA A;  3BCC D;  1GZL A;  4JQ0 D;  1JY2 P;  2E43 A;  4H2W C;  5KP7 B;  5KAF H;  2L4B A;  5KLI C;  1FZC B;  4JBZ A;  3CC7 P;  3O6Q B;  2LXB A;  2FAE A;  1L4A D;  1DD4 A;  1YIT P;  1VQN P;  2YKQ A;  4YXW H;  2OYI C;  4OVN F;  1OW8 A;  4IL6 E;  2K9J B;  1Q90 D;  1SQX D;  3GHG B;  1M56 D;  4H0L C;  3R4Y A;  2QM7 A;  2AFE A;  2I1J A;  2MJZ A;  1R8E A;  2JQ4 A;  3QWO C;  2NZ2 A;  2R3C A;  1GXG A;  4DJG A;  4EIJ A;  1GL2 B;  2ROQ A;  4D6T G;  1YHQ P;  1NKZ B;  1SQQ G;  3L37 A;  2O01 J;  1X79 B;  2M3B A;  4R4M A;  3MHV A;  4U3F D;  5AW5 B;  4ZNC A;  4XFX A;  1DIP A;  2Y0D A;  3V2N A;  5CBO A;  4O9B A;  1NTM D;  2QNW A;  5GTH E;  1PEU A;  2R44 A;  5APQ A;  1AVO A;  2VLQ A;  3L74 G;  5CCG A;  3CMA P;  5BVZ A;  3SWK A;  1LTI C;  5KAI E;  4W7Z A;  5TIS H;  1U57 A;  1L0L E;  1L0L J;  1KLP A;  4N6J A;  3DS5 A;  2O01 N;  3H1J E;  3H1J J;  3FWL A;  2B87 A;  3RL0 C;  5CCH C;  1N7L A;  4PD4 I;  1KYO H;  1NJI Q;  3CCR P;  5APS A;  3L71 G;  3AED C;  1T3J A;  1N7S B;  1S5L E;  1EXI A;  2KGA A;  4KJM A;  2ONT A;  2K1A A;  1SFC C;  2KS1 B;  4GOD A;  3CCS P;  2CNR A;  1SQB D;  2W6A A;  3HUS B;  1CZQ A;  1YQ3 C;  4H44 C;  3VRL C;  4PV1 B;  1ZME C;  4UB6 H;  3O6Q A;  3OAK A;  1GPJ A;  1HH0 A;  1FDI A;  3JCU E;  2PEJ A;  2RN0 A;  2K0D X;  3GHG A;  2E5T A;  2Z44 A;  3G3Z A;  3BCC G;  3H47 A;  1KIL D;  2N6Y A;  3H1K E;  3H1K J;  4RKU J;  4WVZ A;  5C39 A;  3AE7 C;  5KLV D;  3N7N A;  4ZMD A;  3H1L G;  1IK7 A;  5HGM A;  1GL2 A;  1KIL B;  4H13 D;  2KW2 A;  5DJT B;  1EDL A;  2P9X A;  4PH1 A;  2PEQ A;  3IF4 A;  3PLN A;  1HTL C;  2MVV A;  4UB8 E;  4DZO A;  1BGY E;  1BGY J;  1SQX G;  1GK4 A;  2K88 A;  3V2R A;  1FZG A;  3PH0 A;  4H13 B;  1OZH A;  1G1J A;  1FU1 A;  1E5W A;  3BVH A;  2QM8 A;  1L0H A;  2A45 H;  5AVW B;  1HJ0 A;  3LIE A;  3EWK A;  3Q1M A;  2XXM A;  1LTJ B;  1P84 E;  1VDF A;  1NAY A;  1EXJ A;  1GDT A;  3RK3 C;  4N78 D;  1GD2 E;  3D70 A;  2AEJ A;  3A2A A;  1BE3 E;  2N5I A;  1BE3 J;  4OGQ D;  3MD0 A;  3CXH I;  3LMO A;  1EDI A;  2MR8 A;  5HGO A;  1RHZ B;  2JYG A;  1EZV G;  1KMI Z;  3H1I D;  1NTM G;  3VMZ A;  1WMK A;  1JY2 N;  1N7S A;  3CC4 P;  4OGQ B;  2KOG A;  3MGE A;  3CXH D;  1KB9 E;  3TK1 A;  3L73 E;  3L73 J;  3CPW O;  2KS1 A;  2KG6 A;  3L72 D;  1SQB K;  3P32 A;  1OIP A;  3CD6 P;  1J1D C;  5L8R J;  1XTC C;  1KFM A;  1JUN A;  1NYH A;  2FVF A;  3CWB D;  3RK2 C;  1JCD A;  2YXR B;  2N98 A;  1RF1 A;  2YNY A;  2QSI A;  1QLE D;  2M5A B;  2IFM A;  3M9Q A;  3EFG A;  3FXD A;  3IR9 A;  4ASW A;  3VP9 A;  2XV6 A;  1SQB G;  3A0H H;  1SQQ E;  1SQQ J;  4QMA A;  3MIW A;  1KIL A;  5AW8 B;  1E79 H;  1BXI A;  3Q2Y A;  5KLI B;  4PWV B;  2KOR A;  4NEO A;  1EIA A;  1AA0 A;  2Q3I A;  3G1I A;  3MUD A;  4H0L D;  5CCG C;  2LOL A;  2AXT H;  5M1B A;  3KHU A;  1HWT C;  2OYI B;  2LF4 A;  2IPP A;  4F37 A;  3L74 E;  3L74 J;  4H0L B;  1FJK A;  3G0V A;  3IAO A;  2Q1K A;  3WUV A;  2Y0C A;  1LTJ A;  3B71 A;  1H88 A;  1NTZ K;  1L0N D;  2LXC B;  2W83 C;  1W2E A;  3H4E A;  3L71 E;  3L71 J;  1DH3 A;  3CCQ P;  2VLN A;  4UHP B;  2E5Y A;  2FYU E;  2FYU J;  4WB4 A;  1NU1 E;  1NU1 J;  3CX5 D;  3S1K A;  4KT0 J;  2FVE A;  2GUV A;  1IFD A;  3GHG C;  3TDK A;  2KSE A;  3NY7 B;  1KZU B;  4W80 A;  3T97 B;  1ACP A;  3KZI E; 
#chains in the Genus database with same CATH homology
 3VRL C;  4XFY A;  5BS1 A;  1YIJ P;  3CD6 P;  3DS4 A;  1VQ8 P;  4U0F A;  2BUO A;  3CCU P;  2PEI A;  2OTJ P;  2JYL A;  2OTL P;  5HGN A;  1YIT P;  1VQN P;  5DCK A;  2PEJ A;  4IPY A;  1M1K Q;  4XFZ A;  1VQ4 P;  3DS0 A;  1K30 A;  3G6E P;  1QRJ A;  3E2D A;  3I56 P;  2Z44 A;  3NTE A;  2EG5 A;  3G1G A;  3H47 A;  4XRQ A;  1BAJ A;  2Z46 A;  1JJ2 O;  3G71 P;  4U0A A;  1D1D A;  3G4S P;  3CC2 P;  4U0E A;  1K8A Q;  1E6J P;  2XV6 A;  1A43 A;  1RNI A;  2QA4 P;  1Q82 Q;  1VQL P;  1YJN P;  2XT1 A;  5HGM A;  1YHQ P;  1VQ7 P;  2KOD A;  4QNB A;  4PH0 A;  2P9X A;  2BQ1 E;  3CCJ P;  4COC A;  5JPA A;  1PEM A;  3CCE P;  1RO2 A;  4PH1 A;  2PEQ A;  3RG6 C;  1EIA A;  2PEN A;  5HGL A;  3OW2 O;  1K73 Q;  3G1I A;  3B5I A;  5I4T G;  1QVG O;  4XFX A;  2PEM A;  2JO0 A;  1YJ9 P;  1RO0 A;  3DTJ A;  4GR2 A;  4COP A;  1VQO P;  4U0B A;  2L6E A;  4M0I A;  1ZMB A;  2QEX P;  3CME P;  3G29 A;  3G26 A;  5F2K A;  2LF4 A;  1YJW P;  1M6N A;  1Q81 Q;  4WYM A;  1KD1 Q;  4U0D A;  1PEU A;  3DS2 A;  3M1M A;  3G28 A;  3G0V A;  2XXM A;  4U0C A;  3CXC O;  1VQ5 P;  1W2B O;  1S72 P;  3CMA P;  1A8O A;  1PEO A;  2BHV A;  1VQ6 P;  1VQP P;  3CCV P;  2Z45 A;  1VQM P;  2M8N A;  4GR6 A;  1PEQ A;  3HYB A;  3WBH A;  3CCM P;  3DS3 A;  2EIA A;  3DS5 A;  4XRO A;  2PEO A;  3H4E A;  1VQK P;  1VQ9 P;  5F2O A;  3CCQ P;  1M74 A;  1NJI Q;  1IUQ A;  1KC8 Q;  3P05 A;  3CCR P;  3HZQ A;  3DPH A;  5HGO A;  2CWO A;  1N8R Q;  5BS2 A;  1QVF O;  1KQS O;  2JYG A;  3G21 A;  1AUM A;  3I55 P;  5F2N A;  3LRY A;  3CC4 P;  1EOQ A;  2E1M A;  2PY8 A;  2DGY A;  3MGE A;  2ONT A;  1Q7Y Q;  3CCL P;  2M8L A;  3Q20 A;  1M6E X;  3CCS P;  1Q86 Q;  1K9M Q;  3CPW O;  2OAR A;  2PEK A;  2EFJ A;  3DS1 A;  1YI2 P;  1M90 Q;  3CC7 P;  2M8P A;  3H0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...