1Q81Q

Crystal structure of minihelix with 3' puromycin bound to a-site of the 50s ribosomal subunit.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into Peptide Bond Formation
pubmed doi rcsb
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q81Q03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q81Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q81Q02
3CPWO 3CCMP 2OTLP 1QVFO 1K73Q 1VQLP 1VQNP 1VQMP 1JJ2O 1Q86Q 1VQ5P 1VQ9P 1KQSO 3I55P 1VQ7P 1M90Q 1KD1Q 2OTJP 3CCJP 1NJIQ 1YJWP 3G4SP 1VQKP 2QA4P 1YJ9P 1K9MQ 3CMAP 1VQ4P 1YITP 1Q81Q 3I56P 3CCQP 3G6EP 1YJNP 3CC7P 1KC8Q 1VQPP 1Q7YQ 3CXCO 1K8AQ 1QVGO 3G71P 1N8RQ 1VQOP 3CC2P 1YI2P 1VQ6P 3CCVP 3CCEP 1S72P 1YHQP 3OW2O 3CMEP 1M1KQ 3CD6P 2QEXP 3CCRP 1Q82Q 3CCLP 1VQ8P 3CCUP 1YIJP 1W2BO 3CC4P 3CCSP
chains in the Genus database with same CATH superfamily
3WU2H 5AW2B 1EZVD 1BE3E 3G28A 1K9MQ 1OVRA 2FY8A 1MFZA 1USDA 2N6ZA 1FS0E 3TYYA 3KZIH 3G1IA 3HD7B 5KP7B 2EIAA 5CCHA 1J1EB 1PPJE 3CX5D 2PEQA 1X22A 2PEOA 3DS1A 3EJDA 5KP6B 1MKMA 2KOOA 3V2RA 1YJNP 1M74A 2BCCD 3L35A 3U59A 3L71J 4ZKUA 3WUVA 1RF1C 2QSIA 1EC5A 3CCEP 1LP1A 3LW5H 1OZHA 3H1LG 3EFGA 3CPWO 1SQXG 1M7LA 2KLVA 1ZNVA 2OTJP 1VQ5P 2RN0A 1KILA 3GF3A 4K3AA 1GK6A 2H88C 3NY7B 3LW5J 4BRYB 3H25A 2D2CB 4EIJA 1AJYA 2E1MA 3CXCO 1JOCA 3P8CD 2MVUA 3B71A 3Q1MA 3CXHD 3GMAA 2V7QH 2L22A 2E76C 4HKZH 4ZKPA 4OVNF 1S4XA 2AEFA 3L75D 2J5UA 3I56P 1SQQJ 1JY3P 2KSEA 1T3JA 1K04A 2JU1A 1KFNA 1JMBA 2QJYC 2ZVOB 3SSUA 1M6NA 1IJDB 2JBGA 2M8LA 3HD7A 1S1CX 3H1KJ 4LC1A 5BVZA 1SVFA 4GOFA 2FFDC 1OIPA 4HH2A 2JR8A 1KTMA 2YXQB 5BU8B 1HQBA 5C39A 1U7JA 2Y9YA 1Y47A 2O1KA 1AFOA 1D7MA 2W8ZA 2KOPA 3DS4A 3H4EA 1RQUA 3G1GA 1JY3O 1JB0J 3EJEA 1G2CB 1UJZA 1ACPA 4NPFX 1JNMA 3CC7P 1FDIA 4BRYA 3MD0A 4GR2A 4ZMDA 1AA0A 2NPSD 2BCCG 3L74J 3E1IA 4L74A 1QRJA 2K0YA 3H1LE 3V2NA 1PIXA 1SQXE 2HLOA 2A45G 2N5HA 1NKNA 5APUA 1LT9A 2KUBA 2CG5B 1N86A 1LTIC 5AVVB 2QM8A 3RL0g 2FBWC 5BS2A 1VKUA 2FQ1A 2KLUA 2M3EA 4QNBA 2L4BA 1HGZA 2PEMA 2XV5A 2XT1A 3BCCJ 4DT0A 2FXOA 2MJZA 5H2FE 1KC8Q 2A06G 7CEIA 5KP8B 2ZYAA 4QMAA 3H47A 3TSIA 3L75G 2YIUB 5M1BA 4IFMA 4PJ0E 2IZ0A 5TISE 2K9JB 3V4WA 4BPGA 2NRGA 2AEMA 1M57D 1EZVI 3GG2A 2KNCB 3DS5A 1N73C 1CZQA 1EZVE 3RK3D 3A2AA 1G2CA 2WITA 2GZJA 3M06A 2PNGA 1SFCC 3TGUG 3DTJA 1L4AC 5KLIC 3FGAD 2QE7H 1TU3F 3CX5E 2YO2A 1GXGA 2JWAA 1X0TA 2K1AA 2VLOA 1L0LD 3AE9C 1GD2E 2ITAA 1KZUB 4BPFA 1MFTA 1W2EA 2BCCE 3UIAA 1VQ8P 1NVOA 2C9NY 2PP6A 1E6JP 4D6TJ 3IFMA 1NJIQ 4H2WC 1FOSE 5KAFH 4OGQC 1URQB 2E75D 3GZMA 1YQ4C 1KYOD 4HB1A 4DOJA 4IOIH 2QJKB 2FYUE 1YIJP 3CXHI 3P8CE 1USEA 3PP5A 4WVZA 5GTIH 3MHVA 3LIEA 3RK3C 3RK2B 2K9JA 2BQ1E 2GZEA 3CXHE 2K37A 5BU5A 2IDBA 2OTKE 1JCCA 3AE6C 2GZFA 1KN7A 1BE3J 1MZ9A 4TLFA 4C7RA 5CZDB 4GT1A 3BATA 2KNCA 2BEQD 1S5LE 1PEMA 2CPBA 4XA4A 3FXDA 1MV8A 3Q5RA 3TNUB 1SLQA 1K73Q 2NZ2A 3V5BA 1JY3N 4DJGA 3NTEA 3LMOA 1SQVG 1N7SD 2ZXEB 4H0LB 1ZXGA 2CNRA 3KPEA 1RE4A 3CCLP 1IMQA 3AEDC 2E75C 1NTZK 3PTZA 1JCDA 2P2UA 3M9BA 3N7NA 4O9BA 1BCCD 1ZRTE 2R5DA 4GIFA 4WY4D 1OVVA 2AFDA 3L73J 1KB9I 1NU1K 1URQA 3DS3A 1L0LG 2XV6A 5AVYB 2Z44A 2LXBA 4ZNCA 3P32A 4RESB 2N1TA 2JDIH 3A0HH 4GDOA 2ZAEB 4YTPC 2FYUK 2CQ8A 1FBMA 1A43A 1ZOYC 1GL2B 1S5LX 3M91A 1SQPK 1L0ND 1SQBJ 1VHNA 4BXLA 2IYOA 1N7SC 3FXEA 3TNUA 3P05A 3A0BH 3C8VA 2GUVA 2KR5A 4W7YA 4PH1A 2OYHC 2MR8A 4L76A 5AW4B 1NTMJ 2V4HA 4R4MA 5AVRB 3CCVP 1AQTA 2RH0A 4IFFA 5CBNA 5KKZC 4PV1B 4WY4C 2CWOA 5KJ7A 5GTHE 3FWNA 2E74B 3VYIA 2AXCA 1Q90D 1UIIA 3MUDC 1N7LA 4XROA 3CCQP 1M6EX 3AEEC 3IF4A 4WWIA 4PWVB 2P67A 3RK3E 4F37A 1QL2A 1OMIA 4L73A 1HJBA 3V4QA 1Q86Q 2QM7A 4PD4D 3H1LJ 2OYOA 4GR6A 4DG9A 2JKVA 1SQXJ 1YITP 4NEOA 1QEXA 2MY5A 1OWAA 4I6MC 2N9BA 1L0LE 3V2PA 3O8ZA 2JB0A 1ZV8A 1LNQA 2WPRA 1H8AA 5AW5B 1IFMA 3AECC 1T8KA 1OR5A 2IBZI 1VQ4P 2FQ2A 5DJUB 4U7JA 2YKQA 2IBZE 2K2QA 1W5CE 1QVGO 4H0LD 1P84I 1FZCC 1K8AQ 1P84E 3GF7A 1KYOE 2LMLA 1L0NG 1ZR4A 3LIDA 1FU1A 4L75A 4XRQA 1IZNB 2XNDH 3ZDMA 2QRXA 1T3UA 4KJMA 1DD4A 4UB6E 2K9YA 1KILB 2M3BA 4YXDC 1CI6B 1HVVA 4COPA 4RO0A 2FHSC 3AE5C 1IFDA 3B8EB 4U0CA 3VMZA 2OYIC 1JY2N 3F5HA 3M0DA 1M1JC 2IX7C 2FFDA 3MGEA 2KXPB 5AW0B 1GL2D 3BASA 2JGPA 1QVFO 1N2DC 2WSCH 2A45H 2JO1A 1L0LK 1FE6A 2XZRA 1HBWA 5HGNA 1T2KD 2ZT9D 2WSCJ 2VLQA 1T8ZA 5KAIE 1BCCE 4IPYA 2M8PA 2R3SA 3E7KA 1LTJC 3D71A 2YMYA 2MR7A 1HJ0A 1SFCB 3AE1C 1L4AB 2JP3A 3GKLC 1NTZD 2QA4P 1FZEA 5CCGD 3VTPC 2QJPB 2G8YA 2KZIA 5KLVD 1S5LH 4Y99C 2LXCB 2Q7CA 3HTKA 1PGQA 2N9YB 2EHSA 3O6QB 5B66E 1NU1D 3IAOA 2X2BA 4IL6E 5APYA 1A02J 3H1ID 5E79E 3L75J 1VQNP 1LJ2A 2KIKA 3GHGB 1L0NE 2BHVA 1BXIA 1CI6A 4IFDK 2SPZA 2FYUD 2ZYDA 3VMXA 1DEBA 1LWUB 3F89A 1FZGA 3JCUE 3S9OA 4GKGA 2P9XA 2AXTE 2FXPA 2ZT9C 1SQPD 3TGUJ 1VQ9P 3VP9A 1VQ7P 4H13B 1LT9B 2KGCA 3L4FA 1WRGA 2FACA 3H1JJ 3H1HE 3L71D 1JO5A 2PY8A 3GW6A 4K35A 2H7HA 4N3YB 2O1JA 1SFCA 1VF5D 1BSHA 1L4AA 4PD4I 3V6IA 2C0WA 2GDWA 1EZVG 4UB8H 1QLED 4PD4E 2XU6A 1YI2P 4OWFA 4XFZA 3CCRP 5CHXA 1ZRTD 2WSFH 2WWWA 2AEJA 1KILD 3O6QA 5EFWB 4XFXA 1EIAA 3AEAC 2WSFJ 2KS1A 2Y0EA 1KB9D 1IMPA 2B9BA 3GHGA 3P8MC 1AUMA 1NTZG 1L0NK 3ABVC 3IN6A 4I1LA 5GTHH 1LTTC 1LWUA 2XNXA 2VRSA 3DS2A 1XTCC 1BGYD 1NU1G 4YXWH 3H1IG 1QX8A 2HPCB 3AEGC 3AE2C 1ZN5A 1SQVJ 3RL0B 1S3JA 1FAVA 2W83C 1K05A 1S72P 1VF5C 2PEIA 1D1DA 2LF4A 2FYUG 3HD7D 1ZMBA 2YXRB 1KD1Q 2K5XA 2M8NA 1YJ9P 3KDPB 3HE5B 1NTKK 3RG2A 1E79H 2WSSH 1SQPG 1X8YA 2FYNB 2Y0DA 1PFIA 1FJKA 1H88A 5CBOA 3GLMA 3CLQA 3G71P 3SWFA 1OW8A 2GDXA 4I7ZB 2FKWB 2JU2A 3CL3D 1E5WA 3L37A 5APQA 1L2PA 3EJBA 2NPSC 4NPEA 1J1DC 2QNWA 2D2CD 2ERHA 2Q1KA 4HYTB 2XZ1C 3CWBD 3B5NB 1BAJA 2Q6QA 2AVAA 1KLPA 1KYOH 2H8PD 4TT3H 2FVAA 2C9LY 2K3RA 2DNWA 2XZ0D 1LTGC 2E5YA 3BCCD 1KQGB 2BASA 3HD7C 1RHZB 2XDJA 1NTZE 1J1EC 2HPCA 4IZ6A 3KYQA 3R2PA 5KLVE 4I2LC 3ITKA 1R5LA 1VQMP 2IBZD 2LKMA 1NU1E 1Z56A 3SWKA 2H43A 1UIXA 3BRTB 3H1IE 1BGYG 1RE3A 4MRTC 3WBHA 4DZOA 3HE5A 1P84D 1X3OA 2N1TB 2K94A 2CK3H 2OYHA 1RO0A 2D2CC 2K0DX 2WSEH 4XFJA 4R0MA 1LT1A 2Q3IA 2P7JA 2GDYA 1PP9J 4GOEA 2GZGA 1SQPE 1EDIA 2WSEJ 3NMDA 2W90A 3M9QA 2K92A 3KZIE 4H44B 2GA1A 3RG6C 1XTGB 5K5GB 2OTLP 2KORA 3B5NA 3L71E 1GPJA 4H2XC 2ZFCA 2GUSA 2L91A 4D6TD 2I1JA 2HG5D 3VOPA 2PENA 2Z45A 3MZWB 1GW3A 2QG4A 2MKVA 3L70D 2KGDA 2OYIB 5AVZB 2KP8A 4N78D 2PEJA 4W80A 2KG8A 1NO4A 4PXHB 1GW4A 3CWBG 3HUSC 5KLVK 5APWA 1QL1A 1KILE 2K88A 1GTWA 2LIWA 2WVRA 2LL8A 1KB9E 3BCCG 3CC4P 4H2YC 2WT7B 5F2NA 1VQKP 1FZCA 1HTLC 1JUNA 5CJ0A 1BGYE 2IBZG 1IO4A 2I8DA 1DV5A 4AYCA 1OXZA 3EFFK 1T6AA 4Y99B 3AEFC 4LLHA 1VDFA 1EXIA 1RF1B 2C0XA 1FZFA 3W67A 3D6ZA 2FQ0A 3CE7A 1GU5A 1IFIA 2AF8A 4NPDA 3SFDC 2JEEA 3M0AA 4YPCA 1VQOP 3L73D 4ASWA 3LRYA 2R3CA 3EWKA 2OYIA 2JQ4A 3U43A 2E76B 1M1JA 2FVEA 2E42A 2WMMA 3H1HD 1Q81Q 1PEOA 3T97B 1LTAC 5HVCA 3GZLA 3L74E 1Q7YQ 1LTBC 1NTKD 1URQD 1GU4A 2ZXXA 1VPCA 2MD9A 4D6TG 2K0XA 2O3JA 2QJYB 3PHLA 3D6YA 2L6EA 4WYMA 1ZMEC 2N1TD 1VQLP 2DW3A 2J59M 3L70G 1SQBD 4U3FD 1LTJA 2ZYGA 3CWBE 2HR3A 3AE8C 3RK2D 2G3AA 2WT7A 1SQQK 2FFDB 5I4TG 1BCCG 2B89A 2LTEA 5AVQB 2EG5A 3VP8A 3C1LA 5AW6B 1NTMD 3BCCE 2LOLA 4LGDE 1GZLA 1RF1A 1K30A 3G0VA 3G4SP 1BSNA 2KYVA 5APTA 2YNYA 3G6EP 1SP4A 1AQ5A 4ASVA 5H2FH 1YTZT 3OA7A 1HY8A 3VMYA 1QGKB 3Q2YA 1M1KQ 5KJ7D 4PJ0H 5TISH 1YBKA 4EOTA 1DD3A 1URQC 2XXMA 1AV1A 2Y0CA 3HTKB 3L72D 2KK7A 2J58A 1VL2A 2WPSA 3DS0A 2QJKC 2LPKA 3SFEC 3T97A 1Y9BA 1PL5A 1OVUA 1JJ2O 5HV8A 1EDKA 5EW5E 2HODB 1F80D 2WZ7A 3CX5H 3MP7B 4A7PA 4PH0A 5JPAA 2IYPA 1PV3A 1FC2C 1IFPA 1CEIA 1G1IA 1AVOA 4GODA 2EFJA 2Z46A 1U7MA 3H1HG 5AW8B 4D6TE 1H0TA 1FDOA 1NTKG 1NTZJ 3AE3C 2BUOA 4Y28J 2GM4A 2R32A 4U0BA 1AVYA 3L70E 1YQ3C 2BCCJ 5KAFE 4H0LC 3HE4B 4N78E 5AVSB 2KOQA 2M5AB 1N73B 1NU1J 1SQBG 3KXDA 4U3FG 2NPSB 5HGLA 1RF0C 2MVVA 3H1IJ 3RGUA 3K5BA 1FDMA 1A8OA 5AVUB 2UWJE 2R44A 1NYHA 1Q82Q 5HGMA 5GTIE 4PV1D 3A5TA 5KLIB 1ZW0A 2E74D 2Q9IA 3CXHH 1NH4A 1X79B 1OW6A 2FYUJ 3B4QA 1NTMG 2KI7B 2E76D 1X9VA 2IZ1A 4CPGA 3MGNA 2YO3A 1OFCX 3QH9A 5F2OA 2P1JA 1SQPJ 1J2JB 4Z1MH 2W6AA 1M56D 2KOSA 1EMVA 1Q2NA 2WPQA 3Q3DA 3RBZA 4BPHA 2KS1B 5TJHA 3V2QA 2JWDA 1A02F 1Z6MA 5AW9B 2OGUA 4EI2A 4OGQB 1GL2C 2HODA 2W6BA 2H89C 2AFEA 4BWNA 2E5TA 2KOGA 3AE4C 1IFNA 2KWLA 3L72G 3A3YB 4JQ0D 1L0IA 1T2KC 3L73E 1AF8A 3TDKA 3AEBC 3FWLA 3RK3B 4JYBA 1NQ4A 2GZIA 2EHTA 3D70A 3SWYA 3HE4A 1JMMA 1IFJA 4WB4A 1PGOA 4PV1C 2KODA 1KB9H 2M5AA 5CCHD 2E74C 1N73A 4CA3A 1RY3A 2NPSA 3NXSA 1NTKE 3P7KA 5CCGC 2WPTA 2KB7P 2W27A 2A06D 1NKZB 2CPSA 2V7QJ 1NWQA 3A0HE 2JO0A 2B87B 2N98A 2GYKA 1DX7A 1SQBE 3G26A 1IK7A 4U3FE 3CC2P 1BGYJ 3CMEP 1KMIZ 4C46A 2RMZA 4IL6X 1CW5A 5DJTB 4JYCA 2E75B 2MF4A 4DCKA 2KG9A 4HKGA 3A0BE 3M0DC 3HUSB 1NTME 2CGQA 3TGUD 2YKPA 1FJPA 2B88A 4C7NB 1N8RQ 1SQQD 2QIWA 3QWOC 3TK1A 3PH0A 3RBXA 1JM0A 5KLVG 3H1JD 3KQGA 3Q20A 5HGOA 5CMZA 2XKMA 3OAKA 5CCHC 1BDDA 3H1KD 3DPHA 3TF5A 1IC2A 4RKUJ 4M3LA 5AVTB 2PFXA 1YHQP 5F2KA 3WUTA 2QEXP 4U0FA 3L72E 1W2BO 2M8RA 4QKOA 1NHLA 1NAFA 1PEUA 3AE7C 1DNYA 1SFCD 1EOQA 1M90Q 3WMM0 1L4AD 3R4YA 1N7SB 3G9RA 1RQVA 1DEEG 2WQYC 3CWBJ 5APVA 2FAEA 1PGPA 2YKOA 2OYHB 2B87A 1KILC 1FR2A 4R4LA 3OW2O 3CD6P 3NTNA 2JAZA 3CCUP 3H32B 1SQBK 1ZR2A 2P10A 5KKZB 1KQFB 4WY4B 1MUUA 1KORA 2KW2A 1L0LJ 3L71G 2IPPA 3L74D 3KHUA 2PRRA 1JTHB 3Q5PA 1HF9A 1S9KD 1CSBA 3PLNA 3HUSA 4EDFA 4OGQD 2N50A 1NTMK 1SQVD 4C7NA 1P84H 4JPZB 2FXMA 1YTZI 1NAYA 1HGVA 4KHXA 1BDCA 4H13D 2RKLA 3U1AA 1GDTA 2PAJA 4HJGH 1VQ6P 4UB6H 3VN0A 3JSVC 5B5EE 1YYCA 3G29A 3CX5I 2O01N 1DIPA 1SQQG 1R5SA 2OQQA 2QJPC 3H1JG 2VSQA 1AYIA 2IFMA 2ONTA 1SQXK 1UNKA 2ZVNB 3PJSK 1VQPP 4N6JA 1N7SA 3BRVB 2LR2A 5CJ4A 1S2EA 1LTSC 5AW7B 3VRLC 2N6YA 2VLNA 3H1KG 2I1KA 2A45I 2O01H 3GJNA 3GHGC 1FZCB 3WU2E 3H32A 3IR9A 2O01J 3N4XA 4WY4A 3L70J 1LWUC 1FZBA 5KAIH 5APXA 1JTHA 1NGMB 3MUDA 2Q3EA 2PGDA 1BCCJ 4H13C 2IFNA 1M8OB 1LT9C 4MN4C 3G3ZA 3FX0A 2Z5IA 3CMAP 4U0DA 1R8EA 2A06E 2L5GB 5EJDA 3L74G 3L75E 2BEZF 2ZJSE 3RL0D 5B66H 2M5RA 4IL6H 3E1RA 1KV4A 1M1JB 1DH3A 2M0BA 5E79H 1GK4A 4COCA 1JY2P 3I5CA 1OW7A 2E43A 4JBZA 3Q5SA 4OH8B 4KT0J 3C9IA 4AQRD 1EXJA 1FZAA 2KGAA 3HRNA 1PP9D 1L0NJ 4RJTA 3H6PA 1BE3D 3TGUE 1KFMA 2FVFA 2PEKA 3JCUH 1RH5B 1LTJB 2AXTH 3NFQA 1SQQE 2KGEA 3WUUA 1G1JA 3E2DA 4XFYA 3H1JE 1GXHA 1ZLLA 1MZ8A 1SS1A 1PPJD 3A7OA 2FADA 3S1KA 3OJAB 1JY2O 3H1KE 3W68A 3B5ND 3H1HJ 1NTKJ 2ROQA 3RL0C 4UB8E 4UHPB 2HFED 4AUWA 4PD4H 1Y8AA 2DGYA 3B4SA 4U3FJ 1RE3C 5BS1A 1HH0A 3H0DA 2ZT9B 2KZJA 4M0IA 2FYNC 2KG6A 3JC22 1NOHA 2YIUC 2NO8A 5DCKA 4WBAA 4I7ZC 1S9KE 1L0HA 1RF0A 4XE5B 3I55P 3II6A 5AVWB 1SQVE 4W7ZA 3EQ2A 2QVAA 3L36A 1H0TB 1EDJA 3BVHA 3B5NC 2Z5HA 2JYLA 3S4RA 3M9HA 1PP9G 4H44D 2Q5UA 2Z4EA 3MTUE 1BE3G 1RNIA 2N5IA 1JEKA 2KSJA 3L72J 1PEQA 1RE4C 5AW1B 1E0HA 2WTYA 2POHA 3PRJA 2Y9ZA 1PPJG 2R5BA 3CCSP 1GL2A 3CCMP 4U0AA 4EYYQ 1IUQA 3M1MA 2K93A 1KQSO 1HUCA 1YJWP 3U1CA 3USSA 2LIUA 1HWTC 1LGHB 5KTBA 1WMKA 3HZQA 3H1LD 1SQXD 2N1TC 2VLPA 1KYOI 2LKIA 1OX3A 2FYZA 1U57A 2JJLA 1VF5B 2W6JH 4B86A 2L0QA 3RK2C 2JYGA 1KQLA 3L73G 4U0EA 3CCJP 2L9FA 1PZQA 1WT6A 1IK9A 1PGJA 3B5IA 2P58A 5L8RJ 5CCGA 1LP1B 4H44C 1SQVK 2OARA 3HYBA 3CI9A 5B5EH 1ZP0C 5AW3B 3VMAA 5APSA 5KLVJ 3G21A 5KJ7C 1EDLA 2YMKA 2HYNA 1J1DB 2WPVB 1GMJA 4JF7A 1H89A 1EQ7A 3MIWA 5AVXB 1RO2A 1FOSF 1PP9E
chains in the Genus database with same CATH topology
2M8LA 1RO0A 1ZMBA 3NTEA 1VQ9P 1VQ7P 1RNIA 1KD1Q 3G28A 2M8NA 4COPA 1YJ9P 1K9MQ 2XXMA 3DS5A 3E2DA 4XROA 4XFYA 2ONTA 3CCQP 1PEQA 3DPHA 1VQPP 1M6EX 4U0CA 3G71P 3DS0A 1VQOP 3G1IA 3DTJA 3VRLC 3LRYA 1YHQP 5F2KA 3MGEA 2EIAA 2QEXP 2PY8A 3CCLP 3RG6C 3DS4A 4U0FA 2PEQA 1W2BO 1JJ2O 3CCSP 2PEOA 3CCMP 4U0AA 3H4EA 2OTLP 1QVFO 3G1GA 1IUQA 3DS1A 3M1MA 1Q86Q 1PEUA 1EOQA 1KQSO 1M90Q 1YJWP 4GR6A 5HGNA 1YITP 1Q81Q 1YJNP 1M74A 1PEOA 4PH0A 3CC7P 5JPAA 1Q7YQ 2PENA 2Z45A 3HZQA 4IPYA 2M8PA 4GR2A 2DGYA 2EFJA 2Z46A 1YI2P 3DS3A 2KODA 3CCEP 3OW2O 3CD6P 1BAJA 4XFZA 3CCRP 2XV6A 1VQ8P 3CCUP 2PEJA 2L6EA 1QRJA 2Z44A 4WYMA 3CPWO 2BUOA 1E6JP 1VQLP 2JYGA 5BS1A 1VQ5P 2OTJP 4U0EA 4U0BA 3H0DA 3CCJP 1NJIQ 4M0IA 1EIAA 4XFXA 2QA4P 2JO0A 3CMAP 3B5IA 1VQ4P 4U0DA 2E1MA 1A43A 3CXCO 3G26A 5HGLA 1AUMA 1QVGO 5I4TG 2OARA 5DCKA 3CC2P 3HYBA 1A8OA 3CMEP 2EG5A 5BS2A 1Q82Q 5HGMA 1YIJP 3CC4P 4QNBA 1K8AQ 3DS2A 1VQNP 1VQMP 2PEMA 3I55P 4COCA 2XT1A 1K30A 3G0VA 3P05A 5F2NA 3G4SP 1VQKP 2BQ1E 3G21A 3I56P 3G6EP 2BHVA 4PH1A 4XRQA 1KC8Q 3WBHA 1PEMA 1N8RQ 2JYLA 3H47A 5F2OA 1VQ6P 3CCVP 1S72P 2PEKA 1M1KQ 1M6NA 2PEIA 1D1DA 2LF4A 2CWOA 1K73Q 1RO2A 3G29A 2P9XA 3Q20A 5HGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW O;  3CCM P;  2OTL P;  1QVF O;  1K73 Q;  1VQL P;  1VQN P;  1VQM P;  1JJ2 O;  1Q86 Q;  1VQ5 P;  1VQ9 P;  1KQS O;  3I55 P;  1VQ7 P;  1M90 Q;  1KD1 Q;  2OTJ P;  3CCJ P;  1NJI Q;  1YJW P;  3G4S P;  1VQK P;  2QA4 P;  1YJ9 P;  1K9M Q;  3CMA P;  1VQ4 P;  1YIT P;  1Q81 Q;  3I56 P;  3CCQ P;  3G6E P;  1YJN P;  3CC7 P;  1KC8 Q;  1VQP P;  1Q7Y Q;  3CXC O;  1K8A Q;  1QVG O;  3G71 P;  1N8R Q;  1VQO P;  3CC2 P;  1YI2 P;  1VQ6 P;  3CCV P;  3CCE P;  1S72 P;  1YHQ P;  3OW2 O;  3CME P;  1M1K Q;  3CD6 P;  2QEX P;  3CCR P;  1Q82 Q;  3CCL P;  1VQ8 P;  3CCU P;  1YIJ P;  1W2B O;  3CC4 P;  3CCS P; 
#chains in the Genus database with same CATH topology
 3WU2 H;  5AW2 B;  1EZV D;  1BE3 E;  3G28 A;  1K9M Q;  1OVR A;  2FY8 A;  1MFZ A;  1USD A;  2N6Z A;  1FS0 E;  3TYY A;  3KZI H;  3G1I A;  3HD7 B;  5KP7 B;  2EIA A;  5CCH A;  1J1E B;  1PPJ E;  3CX5 D;  2PEQ A;  1X22 A;  2PEO A;  3DS1 A;  3EJD A;  5KP6 B;  1MKM A;  2KOO A;  3V2R A;  1YJN P;  1M74 A;  2BCC D;  3L35 A;  3U59 A;  3L71 J;  4ZKU A;  3WUV A;  1RF1 C;  2QSI A;  1EC5 A;  3CCE P;  1LP1 A;  3LW5 H;  1OZH A;  3H1L G;  3EFG A;  3CPW O;  1SQX G;  1M7L A;  2KLV A;  1ZNV A;  2OTJ P;  1VQ5 P;  2RN0 A;  1KIL A;  3GF3 A;  4K3A A;  1GK6 A;  2H88 C;  3NY7 B;  3LW5 J;  4BRY B;  3H25 A;  2D2C B;  4EIJ A;  1AJY A;  2E1M A;  3CXC O;  1JOC A;  3P8C D;  2MVU A;  3B71 A;  3Q1M A;  3CXH D;  3GMA A;  2V7Q H;  2L22 A;  2E76 C;  4HKZ H;  4ZKP A;  4OVN F;  1S4X A;  2AEF A;  3L75 D;  2J5U A;  3I56 P;  1SQQ J;  1JY3 P;  2KSE A;  1T3J A;  1K04 A;  2JU1 A;  1KFN A;  1JMB A;  2QJY C;  2ZVO B;  3SSU A;  1M6N A;  1IJD B;  2JBG A;  2M8L A;  3HD7 A;  1S1C X;  3H1K J;  4LC1 A;  5BVZ A;  1SVF A;  4GOF A;  2FFD C;  1OIP A;  4HH2 A;  2JR8 A;  1KTM A;  2YXQ B;  5BU8 B;  1HQB A;  5C39 A;  1U7J A;  2Y9Y A;  1Y47 A;  2O1K A;  1AFO A;  1D7M A;  2W8Z A;  2KOP A;  3DS4 A;  3H4E A;  1RQU A;  3G1G A;  1JY3 O;  1JB0 J;  3EJE A;  1G2C B;  1UJZ A;  1ACP A;  4NPF X;  1JNM A;  3CC7 P;  1FDI A;  4BRY A;  3MD0 A;  4GR2 A;  4ZMD A;  1AA0 A;  2NPS D;  2BCC G;  3L74 J;  3E1I A;  4L74 A;  1QRJ A;  2K0Y A;  3H1L E;  3V2N A;  1PIX A;  1SQX E;  2HLO A;  2A45 G;  2N5H A;  1NKN A;  5APU A;  1LT9 A;  2KUB A;  2CG5 B;  1N86 A;  1LTI C;  5AVV B;  2QM8 A;  3RL0 g;  2FBW C;  5BS2 A;  1VKU A;  2FQ1 A;  2KLU A;  2M3E A;  4QNB A;  2L4B A;  1HGZ A;  2PEM A;  2XV5 A;  2XT1 A;  3BCC J;  4DT0 A;  2FXO A;  2MJZ A;  5H2F E;  1KC8 Q;  2A06 G;  7CEI A;  5KP8 B;  2ZYA A;  4QMA A;  3H47 A;  3TSI A;  3L75 G;  2YIU B;  5M1B A;  4IFM A;  4PJ0 E;  2IZ0 A;  5TIS E;  2K9J B;  3V4W A;  4BPG A;  2NRG A;  2AEM A;  1M57 D;  1EZV I;  3GG2 A;  2KNC B;  3DS5 A;  1N73 C;  1CZQ A;  1EZV E;  3RK3 D;  3A2A A;  1G2C A;  2WIT A;  2GZJ A;  3M06 A;  2PNG A;  1SFC C;  3TGU G;  3DTJ A;  1L4A C;  5KLI C;  3FGA D;  2QE7 H;  1TU3 F;  3CX5 E;  2YO2 A;  1GXG A;  2JWA A;  1X0T A;  2K1A A;  2VLO A;  1L0L D;  3AE9 C;  1GD2 E;  2ITA A;  1KZU B;  4BPF A;  1MFT A;  1W2E A;  2BCC E;  3UIA A;  1VQ8 P;  1NVO A;  2C9N Y;  2PP6 A;  1E6J P;  4D6T J;  3IFM A;  1NJI Q;  4H2W C;  1FOS E;  5KAF H;  4OGQ C;  1URQ B;  2E75 D;  3GZM A;  1YQ4 C;  1KYO D;  4HB1 A;  4DOJ A;  4IOI H;  2QJK B;  2FYU E;  1YIJ P;  3CXH I;  3P8C E;  1USE A;  3PP5 A;  4WVZ A;  5GTI H;  3MHV A;  3LIE A;  3RK3 C;  3RK2 B;  2K9J A;  2BQ1 E;  2GZE A;  3CXH E;  2K37 A;  5BU5 A;  2IDB A;  2OTK E;  1JCC A;  3AE6 C;  2GZF A;  1KN7 A;  1BE3 J;  1MZ9 A;  4TLF A;  4C7R A;  5CZD B;  4GT1 A;  3BAT A;  2KNC A;  2BEQ D;  1S5L E;  1PEM A;  2CPB A;  4XA4 A;  3FXD A;  1MV8 A;  3Q5R A;  3TNU B;  1SLQ A;  1K73 Q;  2NZ2 A;  3V5B A;  1JY3 N;  4DJG A;  3NTE A;  3LMO A;  1SQV G;  1N7S D;  2ZXE B;  4H0L B;  1ZXG A;  2CNR A;  3KPE A;  1RE4 A;  3CCL P;  1IMQ A;  3AED C;  2E75 C;  1NTZ K;  3PTZ A;  1JCD A;  2P2U A;  3M9B A;  3N7N A;  4O9B A;  1BCC D;  1ZRT E;  2R5D A;  4GIF A;  4WY4 D;  1OVV A;  2AFD A;  3L73 J;  1KB9 I;  1NU1 K;  1URQ A;  3DS3 A;  1L0L G;  2XV6 A;  5AVY B;  2Z44 A;  2LXB A;  4ZNC A;  3P32 A;  4RES B;  2N1T A;  2JDI H;  3A0H H;  4GDO A;  2ZAE B;  4YTP C;  2FYU K;  2CQ8 A;  1FBM A;  1A43 A;  1ZOY C;  1GL2 B;  1S5L X;  3M91 A;  1SQP K;  1L0N D;  1SQB J;  1VHN A;  4BXL A;  2IYO A;  1N7S C;  3FXE A;  3TNU A;  3P05 A;  3A0B H;  3C8V A;  2GUV A;  2KR5 A;  4W7Y A;  4PH1 A;  2OYH C;  2MR8 A;  4L76 A;  5AW4 B;  1NTM J;  2V4H A;  4R4M A;  5AVR B;  3CCV P;  1AQT A;  2RH0 A;  4IFF A;  5CBN A;  5KKZ C;  4PV1 B;  4WY4 C;  2CWO A;  5KJ7 A;  5GTH E;  3FWN A;  2E74 B;  3VYI A;  2AXC A;  1Q90 D;  1UII A;  3MUD C;  1N7L A;  4XRO A;  3CCQ P;  1M6E X;  3AEE C;  3IF4 A;  4WWI A;  4PWV B;  2P67 A;  3RK3 E;  4F37 A;  1QL2 A;  1OMI A;  4L73 A;  1HJB A;  3V4Q A;  1Q86 Q;  2QM7 A;  4PD4 D;  3H1L J;  2OYO A;  4GR6 A;  4DG9 A;  2JKV A;  1SQX J;  1YIT P;  4NEO A;  1QEX A;  2MY5 A;  1OWA A;  4I6M C;  2N9B A;  1L0L E;  3V2P A;  3O8Z A;  2JB0 A;  1ZV8 A;  1LNQ A;  2WPR A;  1H8A A;  5AW5 B;  1IFM A;  3AEC C;  1T8K A;  1OR5 A;  2IBZ I;  1VQ4 P;  2FQ2 A;  5DJU B;  4U7J A;  2YKQ A;  2IBZ E;  2K2Q A;  1W5C E;  1QVG O;  4H0L D;  1P84 I;  1FZC C;  1K8A Q;  1P84 E;  3GF7 A;  1KYO E;  2LML A;  1L0N G;  1ZR4 A;  3LID A;  1FU1 A;  4L75 A;  4XRQ A;  1IZN B;  2XND H;  3ZDM A;  2QRX A;  1T3U A;  4KJM A;  1DD4 A;  4UB6 E;  2K9Y A;  1KIL B;  2M3B A;  4YXD C;  1CI6 B;  1HVV A;  4COP A;  4RO0 A;  2FHS C;  3AE5 C;  1IFD A;  3B8E B;  4U0C A;  3VMZ A;  2OYI C;  1JY2 N;  3F5H A;  3M0D A;  1M1J C;  2IX7 C;  2FFD A;  3MGE A;  2KXP B;  5AW0 B;  1GL2 D;  3BAS A;  2JGP A;  1QVF O;  1N2D C;  2WSC H;  2A45 H;  2JO1 A;  1L0L K;  1FE6 A;  2XZR A;  1HBW A;  5HGN A;  1T2K D;  2ZT9 D;  2WSC J;  2VLQ A;  1T8Z A;  5KAI E;  1BCC E;  4IPY A;  2M8P A;  2R3S A;  3E7K A;  1LTJ C;  3D71 A;  2YMY A;  2MR7 A;  1HJ0 A;  1SFC B;  3AE1 C;  1L4A B;  2JP3 A;  3GKL C;  1NTZ D;  2QA4 P;  1FZE A;  5CCG D;  3VTP C;  2QJP B;  2G8Y A;  2KZI A;  5KLV D;  1S5L H;  4Y99 C;  2LXC B;  2Q7C A;  3HTK A;  1PGQ A;  2N9Y B;  2EHS A;  3O6Q B;  5B66 E;  1NU1 D;  3IAO A;  2X2B A;  4IL6 E;  5APY A;  1A02 J;  3H1I D;  5E79 E;  3L75 J;  1VQN P;  1LJ2 A;  2KIK A;  3GHG B;  1L0N E;  2BHV A;  1BXI A;  1CI6 A;  4IFD K;  2SPZ A;  2FYU D;  2ZYD A;  3VMX A;  1DEB A;  1LWU B;  3F89 A;  1FZG A;  3JCU E;  3S9O A;  4GKG A;  2P9X A;  2AXT E;  2FXP A;  2ZT9 C;  1SQP D;  3TGU J;  1VQ9 P;  3VP9 A;  1VQ7 P;  4H13 B;  1LT9 B;  2KGC A;  3L4F A;  1WRG A;  2FAC A;  3H1J J;  3H1H E;  3L71 D;  1JO5 A;  2PY8 A;  3GW6 A;  4K35 A;  2H7H A;  4N3Y B;  2O1J A;  1SFC A;  1VF5 D;  1BSH A;  1L4A A;  4PD4 I;  3V6I A;  2C0W A;  2GDW A;  1EZV G;  4UB8 H;  1QLE D;  4PD4 E;  2XU6 A;  1YI2 P;  4OWF A;  4XFZ A;  3CCR P;  5CHX A;  1ZRT D;  2WSF H;  2WWW A;  2AEJ A;  1KIL D;  3O6Q A;  5EFW B;  4XFX A;  1EIA A;  3AEA C;  2WSF J;  2KS1 A;  2Y0E A;  1KB9 D;  1IMP A;  2B9B A;  3GHG A;  3P8M C;  1AUM A;  1NTZ G;  1L0N K;  3ABV C;  3IN6 A;  4I1L A;  5GTH H;  1LTT C;  1LWU A;  2XNX A;  2VRS A;  3DS2 A;  1XTC C;  1BGY D;  1NU1 G;  4YXW H;  3H1I G;  1QX8 A;  2HPC B;  3AEG C;  3AE2 C;  1ZN5 A;  1SQV J;  3RL0 B;  1S3J A;  1FAV A;  2W83 C;  1K05 A;  1S72 P;  1VF5 C;  2PEI A;  1D1D A;  2LF4 A;  2FYU G;  3HD7 D;  1ZMB A;  2YXR B;  1KD1 Q;  2K5X A;  2M8N A;  1YJ9 P;  3KDP B;  3HE5 B;  1NTK K;  3RG2 A;  1E79 H;  2WSS H;  1SQP G;  1X8Y A;  2FYN B;  2Y0D A;  1PFI A;  1FJK A;  1H88 A;  5CBO A;  3GLM A;  3CLQ A;  3G71 P;  3SWF A;  1OW8 A;  2GDX A;  4I7Z B;  2FKW B;  2JU2 A;  3CL3 D;  1E5W A;  3L37 A;  5APQ A;  1L2P A;  3EJB A;  2NPS C;  4NPE A;  1J1D C;  2QNW A;  2D2C D;  2ERH A;  2Q1K A;  4HYT B;  2XZ1 C;  3CWB D;  3B5N B;  1BAJ A;  2Q6Q A;  2AVA A;  1KLP A;  1KYO H;  2H8P D;  4TT3 H;  2FVA A;  2C9L Y;  2K3R A;  2DNW A;  2XZ0 D;  1LTG C;  2E5Y A;  3BCC D;  1KQG B;  2BAS A;  3HD7 C;  1RHZ B;  2XDJ A;  1NTZ E;  1J1E C;  2HPC A;  4IZ6 A;  3KYQ A;  3R2P A;  5KLV E;  4I2L C;  3ITK A;  1R5L A;  1VQM P;  2IBZ D;  2LKM A;  1NU1 E;  1Z56 A;  3SWK A;  2H43 A;  1UIX A;  3BRT B;  3H1I E;  1BGY G;  1RE3 A;  4MRT C;  3WBH A;  4DZO A;  3HE5 A;  1P84 D;  1X3O A;  2N1T B;  2K94 A;  2CK3 H;  2OYH A;  1RO0 A;  2D2C C;  2K0D X;  2WSE H;  4XFJ A;  4R0M A;  1LT1 A;  2Q3I A;  2P7J A;  2GDY A;  1PP9 J;  4GOE A;  2GZG A;  1SQP E;  1EDI A;  2WSE J;  3NMD A;  2W90 A;  3M9Q A;  2K92 A;  3KZI E;  4H44 B;  2GA1 A;  3RG6 C;  1XTG B;  5K5G B;  2OTL P;  2KOR A;  3B5N A;  3L71 E;  1GPJ A;  4H2X C;  2ZFC A;  2GUS A;  2L91 A;  4D6T D;  2I1J A;  2HG5 D;  3VOP A;  2PEN A;  2Z45 A;  3MZW B;  1GW3 A;  2QG4 A;  2MKV A;  3L70 D;  2KGD A;  2OYI B;  5AVZ B;  2KP8 A;  4N78 D;  2PEJ A;  4W80 A;  2KG8 A;  1NO4 A;  4PXH B;  1GW4 A;  3CWB G;  3HUS C;  5KLV K;  5APW A;  1QL1 A;  1KIL E;  2K88 A;  1GTW A;  2LIW A;  2WVR A;  2LL8 A;  1KB9 E;  3BCC G;  3CC4 P;  4H2Y C;  2WT7 B;  5F2N A;  1VQK P;  1FZC A;  1HTL C;  1JUN A;  5CJ0 A;  1BGY E;  2IBZ G;  1IO4 A;  2I8D A;  1DV5 A;  4AYC A;  1OXZ A;  3EFF K;  1T6A A;  4Y99 B;  3AEF C;  4LLH A;  1VDF A;  1EXI A;  1RF1 B;  2C0X A;  1FZF A;  3W67 A;  3D6Z A;  2FQ0 A;  3CE7 A;  1GU5 A;  1IFI A;  2AF8 A;  4NPD A;  3SFD C;  2JEE A;  3M0A A;  4YPC A;  1VQO P;  3L73 D;  4ASW A;  3LRY A;  2R3C A;  3EWK A;  2OYI A;  2JQ4 A;  3U43 A;  2E76 B;  1M1J A;  2FVE A;  2E42 A;  2WMM A;  3H1H D;  1Q81 Q;  1PEO A;  3T97 B;  1LTA C;  5HVC A;  3GZL A;  3L74 E;  1Q7Y Q;  1LTB C;  1NTK D;  1URQ D;  1GU4 A;  2ZXX A;  1VPC A;  2MD9 A;  4D6T G;  2K0X A;  2O3J A;  2QJY B;  3PHL A;  3D6Y A;  2L6E A;  4WYM A;  1ZME C;  2N1T D;  1VQL P;  2DW3 A;  2J59 M;  3L70 G;  1SQB D;  4U3F D;  1LTJ A;  2ZYG A;  3CWB E;  2HR3 A;  3AE8 C;  3RK2 D;  2G3A A;  2WT7 A;  1SQQ K;  2FFD B;  5I4T G;  1BCC G;  2B89 A;  2LTE A;  5AVQ B;  2EG5 A;  3VP8 A;  3C1L A;  5AW6 B;  1NTM D;  3BCC E;  2LOL A;  4LGD E;  1GZL A;  1RF1 A;  1K30 A;  3G0V A;  3G4S P;  1BSN A;  2KYV A;  5APT A;  2YNY A;  3G6E P;  1SP4 A;  1AQ5 A;  4ASV A;  5H2F H;  1YTZ T;  3OA7 A;  1HY8 A;  3VMY A;  1QGK B;  3Q2Y A;  1M1K Q;  5KJ7 D;  4PJ0 H;  5TIS H;  1YBK A;  4EOT A;  1DD3 A;  1URQ C;  2XXM A;  1AV1 A;  2Y0C A;  3HTK B;  3L72 D;  2KK7 A;  2J58 A;  1VL2 A;  2WPS A;  3DS0 A;  2QJK C;  2LPK A;  3SFE C;  3T97 A;  1Y9B A;  1PL5 A;  1OVU A;  1JJ2 O;  5HV8 A;  1EDK A;  5EW5 E;  2HOD B;  1F80 D;  2WZ7 A;  3CX5 H;  3MP7 B;  4A7P A;  4PH0 A;  5JPA A;  2IYP A;  1PV3 A;  1FC2 C;  1IFP A;  1CEI A;  1G1I A;  1AVO A;  4GOD A;  2EFJ A;  2Z46 A;  1U7M A;  3H1H G;  5AW8 B;  4D6T E;  1H0T A;  1FDO A;  1NTK G;  1NTZ J;  3AE3 C;  2BUO A;  4Y28 J;  2GM4 A;  2R32 A;  4U0B A;  1AVY A;  3L70 E;  1YQ3 C;  2BCC J;  5KAF E;  4H0L C;  3HE4 B;  4N78 E;  5AVS B;  2KOQ A;  2M5A B;  1N73 B;  1NU1 J;  1SQB G;  3KXD A;  4U3F G;  2NPS B;  5HGL A;  1RF0 C;  2MVV A;  3H1I J;  3RGU A;  3K5B A;  1FDM A;  1A8O A;  5AVU B;  2UWJ E;  2R44 A;  1NYH A;  1Q82 Q;  5HGM A;  5GTI E;  4PV1 D;  3A5T A;  5KLI B;  1ZW0 A;  2E74 D;  2Q9I A;  3CXH H;  1NH4 A;  1X79 B;  1OW6 A;  2FYU J;  3B4Q A;  1NTM G;  2KI7 B;  2E76 D;  1X9V A;  2IZ1 A;  4CPG A;  3MGN A;  2YO3 A;  1OFC X;  3QH9 A;  5F2O A;  2P1J A;  1SQP J;  1J2J B;  4Z1M H;  2W6A A;  1M56 D;  2KOS A;  1EMV A;  1Q2N A;  2WPQ A;  3Q3D A;  3RBZ A;  4BPH A;  2KS1 B;  5TJH A;  3V2Q A;  2JWD A;  1A02 F;  1Z6M A;  5AW9 B;  2OGU A;  4EI2 A;  4OGQ B;  1GL2 C;  2HOD A;  2W6B A;  2H89 C;  2AFE A;  4BWN A;  2E5T A;  2KOG A;  3AE4 C;  1IFN A;  2KWL A;  3L72 G;  3A3Y B;  4JQ0 D;  1L0I A;  1T2K C;  3L73 E;  1AF8 A;  3TDK A;  3AEB C;  3FWL A;  3RK3 B;  4JYB A;  1NQ4 A;  2GZI A;  2EHT A;  3D70 A;  3SWY A;  3HE4 A;  1JMM A;  1IFJ A;  4WB4 A;  1PGO A;  4PV1 C;  2KOD A;  1KB9 H;  2M5A A;  5CCH D;  2E74 C;  1N73 A;  4CA3 A;  1RY3 A;  2NPS A;  3NXS A;  1NTK E;  3P7K A;  5CCG C;  2WPT A;  2KB7 P;  2W27 A;  2A06 D;  1NKZ B;  2CPS A;  2V7Q J;  1NWQ A;  3A0H E;  2JO0 A;  2B87 B;  2N98 A;  2GYK A;  1DX7 A;  1SQB E;  3G26 A;  1IK7 A;  4U3F E;  3CC2 P;  1BGY J;  3CME P;  1KMI Z;  4C46 A;  2RMZ A;  4IL6 X;  1CW5 A;  5DJT B;  4JYC A;  2E75 B;  2MF4 A;  4DCK A;  2KG9 A;  4HKG A;  3A0B E;  3M0D C;  3HUS B;  1NTM E;  2CGQ A;  3TGU D;  2YKP A;  1FJP A;  2B88 A;  4C7N B;  1N8R Q;  1SQQ D;  2QIW A;  3QWO C;  3TK1 A;  3PH0 A;  3RBX A;  1JM0 A;  5KLV G;  3H1J D;  3KQG A;  3Q20 A;  5HGO A;  5CMZ A;  2XKM A;  3OAK A;  5CCH C;  1BDD A;  3H1K D;  3DPH A;  3TF5 A;  1IC2 A;  4RKU J;  4M3L A;  5AVT B;  2PFX A;  1YHQ P;  5F2K A;  3WUT A;  2QEX P;  4U0F A;  3L72 E;  1W2B O;  2M8R A;  4QKO A;  1NHL A;  1NAF A;  1PEU A;  3AE7 C;  1DNY A;  1SFC D;  1EOQ A;  1M90 Q;  3WMM 0;  1L4A D;  3R4Y A;  1N7S B;  3G9R A;  1RQV A;  1DEE G;  2WQY C;  3CWB J;  5APV A;  2FAE A;  1PGP A;  2YKO A;  2OYH B;  2B87 A;  1KIL C;  1FR2 A;  4R4L A;  3OW2 O;  3CD6 P;  3NTN A;  2JAZ A;  3CCU P;  3H32 B;  1SQB K;  1ZR2 A;  2P10 A;  5KKZ B;  1KQF B;  4WY4 B;  1MUU A;  1KOR A;  2KW2 A;  1L0L J;  3L71 G;  2IPP A;  3L74 D;  3KHU A;  2PRR A;  1JTH B;  3Q5P A;  1HF9 A;  1S9K D;  1CSB A;  3PLN A;  3HUS A;  4EDF A;  4OGQ D;  2N50 A;  1NTM K;  1SQV D;  4C7N A;  1P84 H;  4JPZ B;  2FXM A;  1YTZ I;  1NAY A;  1HGV A;  4KHX A;  1BDC A;  4H13 D;  2RKL A;  3U1A A;  1GDT A;  2PAJ A;  4HJG H;  1VQ6 P;  4UB6 H;  3VN0 A;  3JSV C;  5B5E E;  1YYC A;  3G29 A;  3CX5 I;  2O01 N;  1DIP A;  1SQQ G;  1R5S A;  2OQQ A;  2QJP C;  3H1J G;  2VSQ A;  1AYI A;  2IFM A;  2ONT A;  1SQX K;  1UNK A;  2ZVN B;  3PJS K;  1VQP P;  4N6J A;  1N7S A;  3BRV B;  2LR2 A;  5CJ4 A;  1S2E A;  1LTS C;  5AW7 B;  3VRL C;  2N6Y A;  2VLN A;  3H1K G;  2I1K A;  2A45 I;  2O01 H;  3GJN A;  3GHG C;  1FZC B;  3WU2 E;  3H32 A;  3IR9 A;  2O01 J;  3N4X A;  4WY4 A;  3L70 J;  1LWU C;  1FZB A;  5KAI H;  5APX A;  1JTH A;  1NGM B;  3MUD A;  2Q3E A;  2PGD A;  1BCC J;  4H13 C;  2IFN A;  1M8O B;  1LT9 C;  4MN4 C;  3G3Z A;  3FX0 A;  2Z5I A;  3CMA P;  4U0D A;  1R8E A;  2A06 E;  2L5G B;  5EJD A;  3L74 G;  3L75 E;  2BEZ F;  2ZJS E;  3RL0 D;  5B66 H;  2M5R A;  4IL6 H;  3E1R A;  1KV4 A;  1M1J B;  1DH3 A;  2M0B A;  5E79 H;  1GK4 A;  4COC A;  1JY2 P;  3I5C A;  1OW7 A;  2E43 A;  4JBZ A;  3Q5S A;  4OH8 B;  4KT0 J;  3C9I A;  4AQR D;  1EXJ A;  1FZA A;  2KGA A;  3HRN A;  1PP9 D;  1L0N J;  4RJT A;  3H6P A;  1BE3 D;  3TGU E;  1KFM A;  2FVF A;  2PEK A;  3JCU H;  1RH5 B;  1LTJ B;  2AXT H;  3NFQ A;  1SQQ E;  2KGE A;  3WUU A;  1G1J A;  3E2D A;  4XFY A;  3H1J E;  1GXH A;  1ZLL A;  1MZ8 A;  1SS1 A;  1PPJ D;  3A7O A;  2FAD A;  3S1K A;  3OJA B;  1JY2 O;  3H1K E;  3W68 A;  3B5N D;  3H1H J;  1NTK J;  2ROQ A;  3RL0 C;  4UB8 E;  4UHP B;  2HFE D;  4AUW A;  4PD4 H;  1Y8A A;  2DGY A;  3B4S A;  4U3F J;  1RE3 C;  5BS1 A;  1HH0 A;  3H0D A;  2ZT9 B;  2KZJ A;  4M0I A;  2FYN C;  2KG6 A;  3JC2 2;  1NOH A;  2YIU C;  2NO8 A;  5DCK A;  4WBA A;  4I7Z C;  1S9K E;  1L0H A;  1RF0 A;  4XE5 B;  3I55 P;  3II6 A;  5AVW B;  1SQV E;  4W7Z A;  3EQ2 A;  2QVA A;  3L36 A;  1H0T B;  1EDJ A;  3BVH A;  3B5N C;  2Z5H A;  2JYL A;  3S4R A;  3M9H A;  1PP9 G;  4H44 D;  2Q5U A;  2Z4E A;  3MTU E;  1BE3 G;  1RNI A;  2N5I A;  1JEK A;  2KSJ A;  3L72 J;  1PEQ A;  1RE4 C;  5AW1 B;  1E0H A;  2WTY A;  2POH A;  3PRJ A;  2Y9Z A;  1PPJ G;  2R5B A;  3CCS P;  1GL2 A;  3CCM P;  4U0A A;  4EYY Q;  1IUQ A;  3M1M A;  2K93 A;  1KQS O;  1HUC A;  1YJW P;  3U1C A;  3USS A;  2LIU A;  1HWT C;  1LGH B;  5KTB A;  1WMK A;  3HZQ A;  3H1L D;  1SQX D;  2N1T C;  2VLP A;  1KYO I;  2LKI A;  1OX3 A;  2FYZ A;  1U57 A;  2JJL A;  1VF5 B;  2W6J H;  4B86 A;  2L0Q A;  3RK2 C;  2JYG A;  1KQL A;  3L73 G;  4U0E A;  3CCJ P;  2L9F A;  1PZQ A;  1WT6 A;  1IK9 A;  1PGJ A;  3B5I A;  2P58 A;  5L8R J;  5CCG A;  1LP1 B;  4H44 C;  1SQV K;  2OAR A;  3HYB A;  3CI9 A;  5B5E H;  1ZP0 C;  5AW3 B;  3VMA A;  5APS A;  5KLV J;  3G21 A;  5KJ7 C;  1EDL A;  2YMK A;  2HYN A;  1J1D B;  2WPV B;  1GMJ A;  4JF7 A;  1H89 A;  1EQ7 A;  3MIW A;  5AVX B;  1RO2 A;  1FOS F;  1PP9 E; 
#chains in the Genus database with same CATH homology
 2M8L A;  1RO0 A;  1ZMB A;  3NTE A;  1VQ9 P;  1VQ7 P;  1RNI A;  1KD1 Q;  3G28 A;  2M8N A;  4COP A;  1YJ9 P;  1K9M Q;  2XXM A;  3DS5 A;  3E2D A;  4XRO A;  4XFY A;  2ONT A;  3CCQ P;  1PEQ A;  3DPH A;  1VQP P;  1M6E X;  4U0C A;  3G71 P;  3DS0 A;  1VQO P;  3G1I A;  3DTJ A;  3VRL C;  3LRY A;  1YHQ P;  5F2K A;  3MGE A;  2EIA A;  2QEX P;  2PY8 A;  3CCL P;  3RG6 C;  3DS4 A;  4U0F A;  2PEQ A;  1W2B O;  1JJ2 O;  3CCS P;  2PEO A;  3CCM P;  4U0A A;  3H4E A;  2OTL P;  1QVF O;  3G1G A;  1IUQ A;  3DS1 A;  3M1M A;  1Q86 Q;  1PEU A;  1EOQ A;  1KQS O;  1M90 Q;  1YJW P;  4GR6 A;  5HGN A;  1YIT P;  1Q81 Q;  1YJN P;  1M74 A;  1PEO A;  4PH0 A;  3CC7 P;  5JPA A;  1Q7Y Q;  2PEN A;  2Z45 A;  3HZQ A;  4IPY A;  2M8P A;  4GR2 A;  2DGY A;  2EFJ A;  2Z46 A;  1YI2 P;  3DS3 A;  2KOD A;  3CCE P;  3OW2 O;  3CD6 P;  1BAJ A;  4XFZ A;  3CCR P;  2XV6 A;  1VQ8 P;  3CCU P;  2PEJ A;  2L6E A;  1QRJ A;  2Z44 A;  4WYM A;  3CPW O;  2BUO A;  1E6J P;  1VQL P;  2JYG A;  5BS1 A;  1VQ5 P;  2OTJ P;  4U0E A;  4U0B A;  3H0D A;  3CCJ P;  1NJI Q;  4M0I A;  1EIA A;  4XFX A;  2QA4 P;  2JO0 A;  3CMA P;  3B5I A;  1VQ4 P;  4U0D A;  2E1M A;  1A43 A;  3CXC O;  3G26 A;  5HGL A;  1AUM A;  1QVG O;  5I4T G;  2OAR A;  5DCK A;  3CC2 P;  3HYB A;  1A8O A;  3CME P;  2EG5 A;  5BS2 A;  1Q82 Q;  5HGM A;  1YIJ P;  3CC4 P;  4QNB A;  1K8A Q;  3DS2 A;  1VQN P;  1VQM P;  2PEM A;  3I55 P;  4COC A;  2XT1 A;  1K30 A;  3G0V A;  3P05 A;  5F2N A;  3G4S P;  1VQK P;  2BQ1 E;  3G21 A;  3I56 P;  3G6E P;  2BHV A;  4PH1 A;  4XRQ A;  1KC8 Q;  3WBH A;  1PEM A;  1N8R Q;  2JYL A;  3H47 A;  5F2O A;  1VQ6 P;  3CCV P;  1S72 P;  2PEK A;  1M1K Q;  1M6N A;  2PEI A;  1D1D A;  2LF4 A;  2CWO A;  1K73 Q;  1RO2 A;  3G29 A;  2P9X A;  3Q20 A;  5HGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...