2K93A

Structural modification of acyl carrier protein by butyryl group
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGQQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Acyl carrier protein
publication title Structural modification of acyl carrier protein by butyryl group.
pubmed doi rcsb
source organism Escherichia coli
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k93A00
1OR5A 1AF8A 2PNGA 2EHSA 2L0QA 3LMOA 2KGAA 2N5HA 2FVEA 2GDXA 2VSQA 2N5IA 2XZ0D 2KGDA 2N50A 2LTEA 4H2XC 5KP7B 2DNWA 2FADA 2JQ4A 2MR7A 2M5RA 1NQ4A 2N6YA 2L22A 2ROQA 4BPGA 2LOLA 5CZDB 1L0IA 2KOQA 2K93A 2LL8A 2AFDA 2FHSC 2JU2A 2L9FA 2FAEA 2LPKA 3RG2A 5KP8B 2FQ0A 5HV8A 2CNRA 2MF4A 2FQ2A 1HY8A 3EJBA 2FQ1A 2N98A 2FVAA 4IZ6A 4R0MA 2AF8A 4HKGA 2MY5A 4BPHA 2KOPA 1KLPA 2AFEA 4H2WC 1L0HA 2MVUA 2MR8A 2L4BA 2CGQA 4MRTC 2LMLA 2JU1A 5HVCA 2XZ1C 2QNWA 4NEOA 4BPFA 2KOOA 3EJDA 1T8KA 4H2YC 1VKUA 3GZMA 2K94A 2K92A 2CG5B 2LIUA 2N6ZA 2GDYA 2MD9A 3EJEA 2KORA 2JGPA 4PWVB 2CQ8A 2AVAA 2KG6A 5KP6B 2LKIA 2MVVA 2KOSA 2K2QA 2GDWA 1HQBA 2KWLA 2KR5A 1DV5A 2FACA 2KG8A 4PXHB 4CA3A 2KG9A 1X3OA 5EJDA 2KGCA 2FVFA 2EHTA 2K0YA 3NY7B 2KW2A 3CE7A 3GZLA 1F80D 2X2BA 1DNYA 2K0XA 4DG9A 2KGEA 2LIWA 1ACPA
chains in the Genus database with same CATH superfamily
1M6NA 3DS2A 3G1GA 2EHSA 3CC2P 4COPA 2JAZA 5HGNA 1VQMP 2GDXA 2VSQA 2XV6A 1RO0A 3I56P 4XRQA 4U0BA 1AUMA 5CZDB 1L0IA 2KOQA 3CCJP 2K93A 1KQSO 3U43A 4WYMA 2L9FA 2FAEA 1YITP 4HKGA 4BPHA 4QKOA 2KOPA 2AFEA 2MR8A 7CEIA 2PEKA 2GYKA 1VQ5P 2KODA 5F2KA 3EJDA 2JYLA 1VQ9P 3RG6C 2OARA 2JGPA 2CQ8A 3CCSP 2PEQA 2LKIA 1IMQA 4QNBA 4XFXA 2GDWA 4F37A 1IUQA 2M8PA 2KG9A 4U0DA 1X3OA 2OTJP 1K73Q 5BS1A 3OW2O 3CD6P 2K0YA 4U0EA 4DG9A 2FQ1A 2LIWA 1ACPA 1GPJA 3CCVP 4M0IA 2KGAA 1K30A 2EG5A 2N50A 2LTEA 4H2XC 1VQKP 2FADA 3G21A 2JQ4A 3M1MA 2M5RA 1NQ4A 2N6YA 2L22A 2LF4A 3Q20A 3P05A 1BXIA 2JU2A 3RG2A 1Q7YQ 1EMVA 1VQOP 2CNRA 2MF4A 2EFJA 2VLOA 1RO2A 4IPYA 2P9XA 2FVAA 1VQ7P 2PEOA 3CCMP 2OTLP 2CWOA 3G29A 1Z6MA 1FR2A 4H2WC 1NJIQ 1L0HA 2MVUA 2M8NA 2L6EA 1KD1Q 3G28A 3CCEP 2JO0A 2EIAA 3DS0A 2JU1A 1T8KA 4H2YC 2GZIA 2K92A 2N6ZA 2GDYA 3G26A 1A8OA 2ONTA 2K5XA 3GKLC 2MVVA 2PENA 1M74A 2GZJA 5EW5E 3HYBA 2FACA 3CMEP 2KG8A 3B4QA 5EJDA 2JYGA 2XT1A 3CPWO 1F80D 1ZNVA 1DNYA 2K0XA 3GJNA 3CXCO 1OR5A 1AF8A 2PNGA 3LRYA 1D1DA 3CCUP 2L0QA 3LMOA 3G0VA 3CCLP 1VHNA 1VQLP 1GXHA 2FVEA 2XZ0D 2KGDA 4GR2A 5KP7B 2DNWA 2MR7A 4XFYA 4U0CA 4U0FA 1YJ9P 3H47A 2LL8A 2AFDA 1UJZA 4GR6A 2ERHA 4PH0A 3EJBA 3CMAP 1K8AQ 2VLQA 2Z44A 4IZ6A 1VQPP 5JPAA 1UNKA 1E6JP 2MY5A 3G6EP 1KLPA 2E1MA 3G71P 4XROA 2CGQA 4MRTC 2LMLA 2QNWA 2K94A 2VLNA 2CG5B 2LIUA 3CCQP 2MD9A 3EJEA 1YI2P 1EOQA 2KORA 4PWVB 2KG6A 1Q82Q 5F2OA 5HGOA 3NTEA 2JB0A 1KC8Q 2KOSA 2K2QA 1Q81Q 3G1IA 1YHQP 2BUOA 2WPTA 1M6EX 1HQBA 1DV5A 3H4EA 4CA3A 3DS4A 1MZ8A 2KGCA 1ZMBA 2FVFA 3G4SP 3NY7B 2KW2A 3GZLA 2X2BA 3DPHA 1BAJA 2QEXP 1VQ8P 5DCKA 2PEJA 2N5HA 1VQNP 2PY8A 2N5IA 3H0DA 2XXMA 2GZFA 1JJ2O 1E0HA 3CC7P 2JBGA 3I55P 1YJNP 1QRJA 2ROQA 4BPGA 2LOLA 1VQ4P 4PH1A 4U0AA 2FHSC 5KP8B 2LPKA 2FQ0A 5HV8A 2FQ2A 2Z46A 1HY8A 1EIAA 3DTJA 3VRLC 3DS1A 2N98A 5HGMA 1QVGO 1IMPA 4R0MA 2QA4P 2AF8A 1AYIA 1M1KQ 3HZQA 2NO8A 1GXGA 5HGLA 3CC4P 1Q86Q 1M90Q 5BS2A 2L4BA 4COCA 2VLPA 1S72P 3DS5A 5I4TG 5HVCA 2XZ1C 4NEOA 3WBHA 4BPFA 2KOOA 4UHPB 1VKUA 5F2NA 3GZMA 1RNIA 2PEMA 1VQ6P 1N8RQ 2GZEA 2K0DX 2AVAA 3B5IA 5KP6B 3MGEA 2Z45A 2M8LA 2BHVA 1W2BO 1YJWP 1QVFO 3DS3A 2KWLA 4XFZA 3CCRP 2KR5A 4PXHB 2PEIA 2DGYA 2GZGA 1A43A 2EHTA 3E2DA 1K9MQ 3CE7A 1YIJP 1CEIA 2KGEA
chains in the Genus database with same CATH topology
1OR5A 1AF8A 2PNGA 2EHSA 2L0QA 3LMOA 2KGAA 2N5HA 2FVEA 2GDXA 2VSQA 2N5IA 2XZ0D 2KGDA 2N50A 2LTEA 4H2XC 5KP7B 2DNWA 2FADA 2JQ4A 2MR7A 2M5RA 1NQ4A 2N6YA 2L22A 2ROQA 4BPGA 2LOLA 5CZDB 1L0IA 2KOQA 2K93A 2LL8A 2AFDA 2FHSC 2JU2A 2L9FA 2FAEA 2LPKA 3RG2A 5KP8B 2FQ0A 5HV8A 2CNRA 2MF4A 2FQ2A 1HY8A 3EJBA 2FQ1A 2N98A 2FVAA 4IZ6A 4R0MA 2AF8A 4HKGA 2MY5A 4BPHA 2KOPA 1KLPA 2AFEA 4H2WC 1L0HA 2MVUA 2MR8A 2L4BA 2CGQA 4MRTC 2LMLA 2JU1A 5HVCA 2XZ1C 2QNWA 4NEOA 4BPFA 2KOOA 3EJDA 1T8KA 4H2YC 1VKUA 3GZMA 2K94A 2K92A 2CG5B 2LIUA 2N6ZA 2GDYA 2MD9A 3EJEA 2KORA 2JGPA 4PWVB 2CQ8A 2AVAA 2KG6A 5KP6B 2LKIA 2MVVA 2KOSA 2K2QA 2GDWA 1HQBA 2KWLA 2KR5A 1DV5A 2FACA 2KG8A 4PXHB 4CA3A 2KG9A 1X3OA 5EJDA 2KGCA 2FVFA 2EHTA 2K0YA 3NY7B 2KW2A 3CE7A 3GZLA 1F80D 2X2BA 1DNYA 2K0XA 4DG9A 2KGEA 2LIWA 1ACPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR5 A;  1AF8 A;  2PNG A;  2EHS A;  2L0Q A;  3LMO A;  2KGA A;  2N5H A;  2FVE A;  2GDX A;  2VSQ A;  2N5I A;  2XZ0 D;  2KGD A;  2N50 A;  2LTE A;  4H2X C;  5KP7 B;  2DNW A;  2FAD A;  2JQ4 A;  2MR7 A;  2M5R A;  1NQ4 A;  2N6Y A;  2L22 A;  2ROQ A;  4BPG A;  2LOL A;  5CZD B;  1L0I A;  2KOQ A;  2K93 A;  2LL8 A;  2AFD A;  2FHS C;  2JU2 A;  2L9F A;  2FAE A;  2LPK A;  3RG2 A;  5KP8 B;  2FQ0 A;  5HV8 A;  2CNR A;  2MF4 A;  2FQ2 A;  1HY8 A;  3EJB A;  2FQ1 A;  2N98 A;  2FVA A;  4IZ6 A;  4R0M A;  2AF8 A;  4HKG A;  2MY5 A;  4BPH A;  2KOP A;  1KLP A;  2AFE A;  4H2W C;  1L0H A;  2MVU A;  2MR8 A;  2L4B A;  2CGQ A;  4MRT C;  2LML A;  2JU1 A;  5HVC A;  2XZ1 C;  2QNW A;  4NEO A;  4BPF A;  2KOO A;  3EJD A;  1T8K A;  4H2Y C;  1VKU A;  3GZM A;  2K94 A;  2K92 A;  2CG5 B;  2LIU A;  2N6Z A;  2GDY A;  2MD9 A;  3EJE A;  2KOR A;  2JGP A;  4PWV B;  2CQ8 A;  2AVA A;  2KG6 A;  5KP6 B;  2LKI A;  2MVV A;  2KOS A;  2K2Q A;  2GDW A;  1HQB A;  2KWL A;  2KR5 A;  1DV5 A;  2FAC A;  2KG8 A;  4PXH B;  4CA3 A;  2KG9 A;  1X3O A;  5EJD A;  2KGC A;  2FVF A;  2EHT A;  2K0Y A;  3NY7 B;  2KW2 A;  3CE7 A;  3GZL A;  1F80 D;  2X2B A;  1DNY A;  2K0X A;  4DG9 A;  2KGE A;  2LIW A;  1ACP A; 
#chains in the Genus database with same CATH topology
 1M6N A;  3DS2 A;  3G1G A;  2EHS A;  3CC2 P;  4COP A;  2JAZ A;  5HGN A;  1VQM P;  2GDX A;  2VSQ A;  2XV6 A;  1RO0 A;  3I56 P;  4XRQ A;  4U0B A;  1AUM A;  5CZD B;  1L0I A;  2KOQ A;  3CCJ P;  2K93 A;  1KQS O;  3U43 A;  4WYM A;  2L9F A;  2FAE A;  1YIT P;  4HKG A;  4BPH A;  4QKO A;  2KOP A;  2AFE A;  2MR8 A;  7CEI A;  2PEK A;  2GYK A;  1VQ5 P;  2KOD A;  5F2K A;  3EJD A;  2JYL A;  1VQ9 P;  3RG6 C;  2OAR A;  2JGP A;  2CQ8 A;  3CCS P;  2PEQ A;  2LKI A;  1IMQ A;  4QNB A;  4XFX A;  2GDW A;  4F37 A;  1IUQ A;  2M8P A;  2KG9 A;  4U0D A;  1X3O A;  2OTJ P;  1K73 Q;  5BS1 A;  3OW2 O;  3CD6 P;  2K0Y A;  4U0E A;  4DG9 A;  2FQ1 A;  2LIW A;  1ACP A;  1GPJ A;  3CCV P;  4M0I A;  2KGA A;  1K30 A;  2EG5 A;  2N50 A;  2LTE A;  4H2X C;  1VQK P;  2FAD A;  3G21 A;  2JQ4 A;  3M1M A;  2M5R A;  1NQ4 A;  2N6Y A;  2L22 A;  2LF4 A;  3Q20 A;  3P05 A;  1BXI A;  2JU2 A;  3RG2 A;  1Q7Y Q;  1EMV A;  1VQO P;  2CNR A;  2MF4 A;  2EFJ A;  2VLO A;  1RO2 A;  4IPY A;  2P9X A;  2FVA A;  1VQ7 P;  2PEO A;  3CCM P;  2OTL P;  2CWO A;  3G29 A;  1Z6M A;  1FR2 A;  4H2W C;  1NJI Q;  1L0H A;  2MVU A;  2M8N A;  2L6E A;  1KD1 Q;  3G28 A;  3CCE P;  2JO0 A;  2EIA A;  3DS0 A;  2JU1 A;  1T8K A;  4H2Y C;  2GZI A;  2K92 A;  2N6Z A;  2GDY A;  3G26 A;  1A8O A;  2ONT A;  2K5X A;  3GKL C;  2MVV A;  2PEN A;  1M74 A;  2GZJ A;  5EW5 E;  3HYB A;  2FAC A;  3CME P;  2KG8 A;  3B4Q A;  5EJD A;  2JYG A;  2XT1 A;  3CPW O;  1F80 D;  1ZNV A;  1DNY A;  2K0X A;  3GJN A;  3CXC O;  1OR5 A;  1AF8 A;  2PNG A;  3LRY A;  1D1D A;  3CCU P;  2L0Q A;  3LMO A;  3G0V A;  3CCL P;  1VHN A;  1VQL P;  1GXH A;  2FVE A;  2XZ0 D;  2KGD A;  4GR2 A;  5KP7 B;  2DNW A;  2MR7 A;  4XFY A;  4U0C A;  4U0F A;  1YJ9 P;  3H47 A;  2LL8 A;  2AFD A;  1UJZ A;  4GR6 A;  2ERH A;  4PH0 A;  3EJB A;  3CMA P;  1K8A Q;  2VLQ A;  2Z44 A;  4IZ6 A;  1VQP P;  5JPA A;  1UNK A;  1E6J P;  2MY5 A;  3G6E P;  1KLP A;  2E1M A;  3G71 P;  4XRO A;  2CGQ A;  4MRT C;  2LML A;  2QNW A;  2K94 A;  2VLN A;  2CG5 B;  2LIU A;  3CCQ P;  2MD9 A;  3EJE A;  1YI2 P;  1EOQ A;  2KOR A;  4PWV B;  2KG6 A;  1Q82 Q;  5F2O A;  5HGO A;  3NTE A;  2JB0 A;  1KC8 Q;  2KOS A;  2K2Q A;  1Q81 Q;  3G1I A;  1YHQ P;  2BUO A;  2WPT A;  1M6E X;  1HQB A;  1DV5 A;  3H4E A;  4CA3 A;  3DS4 A;  1MZ8 A;  2KGC A;  1ZMB A;  2FVF A;  3G4S P;  3NY7 B;  2KW2 A;  3GZL A;  2X2B A;  3DPH A;  1BAJ A;  2QEX P;  1VQ8 P;  5DCK A;  2PEJ A;  2N5H A;  1VQN P;  2PY8 A;  2N5I A;  3H0D A;  2XXM A;  2GZF A;  1JJ2 O;  1E0H A;  3CC7 P;  2JBG A;  3I55 P;  1YJN P;  1QRJ A;  2ROQ A;  4BPG A;  2LOL A;  1VQ4 P;  4PH1 A;  4U0A A;  2FHS C;  5KP8 B;  2LPK A;  2FQ0 A;  5HV8 A;  2FQ2 A;  2Z46 A;  1HY8 A;  1EIA A;  3DTJ A;  3VRL C;  3DS1 A;  2N98 A;  5HGM A;  1QVG O;  1IMP A;  4R0M A;  2QA4 P;  2AF8 A;  1AYI A;  1M1K Q;  3HZQ A;  2NO8 A;  1GXG A;  5HGL A;  3CC4 P;  1Q86 Q;  1M90 Q;  5BS2 A;  2L4B A;  4COC A;  2VLP A;  1S72 P;  3DS5 A;  5I4T G;  5HVC A;  2XZ1 C;  4NEO A;  3WBH A;  4BPF A;  2KOO A;  4UHP B;  1VKU A;  5F2N A;  3GZM A;  1RNI A;  2PEM A;  1VQ6 P;  1N8R Q;  2GZE A;  2K0D X;  2AVA A;  3B5I A;  5KP6 B;  3MGE A;  2Z45 A;  2M8L A;  2BHV A;  1W2B O;  1YJW P;  1QVF O;  3DS3 A;  2KWL A;  4XFZ A;  3CCR P;  2KR5 A;  4PXH B;  2PEI A;  2DGY A;  2GZG A;  1A43 A;  2EHT A;  3E2D A;  1K9M Q;  3CE7 A;  1YIJ P;  1CEI A;  2KGE A; 
#chains in the Genus database with same CATH homology
 1OR5 A;  1AF8 A;  2PNG A;  2EHS A;  2L0Q A;  3LMO A;  2KGA A;  2N5H A;  2FVE A;  2GDX A;  2VSQ A;  2N5I A;  2XZ0 D;  2KGD A;  2N50 A;  2LTE A;  4H2X C;  5KP7 B;  2DNW A;  2FAD A;  2JQ4 A;  2MR7 A;  2M5R A;  1NQ4 A;  2N6Y A;  2L22 A;  2ROQ A;  4BPG A;  2LOL A;  5CZD B;  1L0I A;  2KOQ A;  2K93 A;  2LL8 A;  2AFD A;  2FHS C;  2JU2 A;  2L9F A;  2FAE A;  2LPK A;  3RG2 A;  5KP8 B;  2FQ0 A;  5HV8 A;  2CNR A;  2MF4 A;  2FQ2 A;  1HY8 A;  3EJB A;  2FQ1 A;  2N98 A;  2FVA A;  4IZ6 A;  4R0M A;  2AF8 A;  4HKG A;  2MY5 A;  4BPH A;  2KOP A;  1KLP A;  2AFE A;  4H2W C;  1L0H A;  2MVU A;  2MR8 A;  2L4B A;  2CGQ A;  4MRT C;  2LML A;  2JU1 A;  5HVC A;  2XZ1 C;  2QNW A;  4NEO A;  4BPF A;  2KOO A;  3EJD A;  1T8K A;  4H2Y C;  1VKU A;  3GZM A;  2K94 A;  2K92 A;  2CG5 B;  2LIU A;  2N6Z A;  2GDY A;  2MD9 A;  3EJE A;  2KOR A;  2JGP A;  4PWV B;  2CQ8 A;  2AVA A;  2KG6 A;  5KP6 B;  2LKI A;  2MVV A;  2KOS A;  2K2Q A;  2GDW A;  1HQB A;  2KWL A;  2KR5 A;  1DV5 A;  2FAC A;  2KG8 A;  4PXH B;  4CA3 A;  2KG9 A;  1X3O A;  5EJD A;  2KGC A;  2FVF A;  2EHT A;  2K0Y A;  3NY7 B;  2KW2 A;  3CE7 A;  3GZL A;  1F80 D;  2X2B A;  1DNY A;  2K0X A;  4DG9 A;  2KGE A;  2LIW A;  1ACP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...