2K93A

Structural modification of acyl carrier protein by butyryl group
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGQQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural modification of acyl carrier protein by butyryl group.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k93A00
2FQ2A 2LKIA 2KG6A 2MR7A 2KORA 3GZLA 4H2WC 1HY8A 2CG5B 3GZMA 1F80D 2FADA 2N98A 2XZ1C 2KGEA 4R0MA 5CZDB 2EHSA 2LOLA 1NQ4A 2X2BA 2N5HA 2QNWA 1OR5A 2L0QA 2KGAA 2FAEA 4DG9A 2K2QA 2AVAA 2CGQA 3EJBA 2K94A 2MVUA 3RG2A 2N50A 2GDYA 2L4BA 4CA3A 2GDWA 4IZ6A 3EJDA 1HQBA 5KP6B 2CNRA 2MF4A 2K92A 1L0IA 2FHSC 2AF8A 2ROQA 4H2YC 2GDXA 2K0YA 2AFDA 2KG8A 2KWLA 4HKGA 2JU2A 2KW2A 2L9FA 2DNWA 3LMOA 4BPHA 2KGCA 2K0XA 5HV8A 2M5RA 5KP7B 3NY7B 1AF8A 1ACPA 2JGPA 2MD9A 2KOSA 2VSQA 4H2XC 2CQ8A 2FQ1A 4PXHB 2AFEA 2FVFA 2LMLA 4BPGA 2L22A 2LL8A 2N6ZA 2FACA 3CE7A 2KOPA 1X3OA 4MRTC 1DV5A 2LPKA 5HVCA 4NEOA 2FQ0A 1KLPA 2N6YA 2PNGA 2KR5A 2FVAA 1T8KA 4BPFA 2EHTA 2JU1A 2FVEA 3EJEA 2K93A 2KOOA 2JQ4A 4PWVB 2LTEA 2N5IA 2KOQA 2KG9A 2LIWA 2MVVA 2KGDA 2MY5A 5KP8B 2XZ0D 1VKUA 5EJDA 1DNYA 1L0HA 2MR8A 2LIUA
chains in the Genus database with same CATH superfamily
2MR7A 2KORA 3CPWO 3DPHA 2DGYA 3CC7P 2XZ1C 1A43A 3H0DA 3RG6C 1AYIA 2GZFA 2QNWA 3NTEA 3CMAP 1A8OA 2AVAA 1M74A 2ERHA 2JYGA 3CCMP 1ZNVA 3H47A 5JPAA 2L4BA 4UHPB 2MF4A 2JBGA 2AFDA 3CCLP 4HKGA 4F37A 1RNIA 2Z45A 4WYMA 4U0CA 2GZJA 1VQ9P 3NY7B 2MD9A 4PXHB 3DTJA 4BPGA 5I4TG 2N6ZA 3VRLC 1YITP 2KOPA 4MRTC 2BHVA 4GR2A 1K73Q 4BPFA 5F2NA 1D1DA 1Q7YQ 2K93A 1RO2A 4PWVB 1UNKA 3CCVP 3OW2O 2LTEA 4COCA 3Q20A 1VQ7P 1BAJA 4XFXA 1EIAA 1N8RQ 2GYKA 1VQ8P 1QRJA 1BXIA 3CCEP 2KG6A 3DS2A 1IMPA 3I56P 4QNBA 2FADA 2L6EA 2JO0A 2EHSA 2X2BA 1NQ4A 1K9MQ 3G1IA 4XFYA 4XFZA 3CCQP 2L0QA 1EOQA 2FAEA 2K2QA 3EJBA 2BUOA 2MVUA 5HGMA 1VQ6P 3RG2A 2N50A 2M8LA 2PEJA 2PEIA 3DS1A 2GDYA 2GDWA 3EJDA 1HQBA 5KP6B 4U0AA 2CNRA 2ROQA 2PEOA 3DS4A 2XXMA 3B4QA 3LMOA 2K0XA 1QVGO 3G1GA 2OARA 1YJNP 1E0HA 5KP7B 3DS5A 1ACPA 3CXCO 2VSQA 1W2BO 2FQ1A 1YIJP 3CMEP 2LMLA 1M90Q 1GXHA 4XROA 1QVFO 2FACA 5F2OA 2EG5A 2LF4A 4NEOA 3CC2P 2FQ0A 2N6YA 1K8AQ 2EIAA 1IUQA 2GZIA 3HZQA 1Q81Q 2JU1A 2JYLA 2KOOA 2JQ4A 5BS2A 3I55P 3G28A 1VQPP 2N5IA 2KOQA 2JB0A 2KODA 2M8PA 2KGDA 5KP8B 2XZ0D 1DNYA 1L0HA 2MR8A 2LIUA 1Q82Q 1VQNP 2XV6A 2FQ2A 2GZEA 5F2KA 1AUMA 1VQKP 4H2WC 4PH1A 1YJWP 1VQLP 2N98A 1EMVA 2KGEA 4QKOA 5CZDB 3CCJP 2N5HA 1FR2A 2ONTA 3GJNA 3M1MA 3G71P 2K94A 1E6JP 4IZ6A 3MGEA 2K92A 1M1KQ 1L0IA 2FHSC 1GXGA 2GDXA 2KG8A 3G0VA 2JU2A 2L9FA 3CCRP 3CCSP 2M8NA 2DNWA 4BPHA 5DCKA 2M5RA 3B5IA 2OTJP 3CC4P 2VLPA 3GKLC 2JGPA 4H2XC 1IMQA 2AFEA 4GR6A 3LRYA 2LL8A 3P05A 2P9XA 1X3OA 1DV5A 4XRQA 3DS0A 1Q86Q 5HVCA 1VQ5P 2PEKA 2Z46A 1VQ4P 5HGOA 4M0IA 2QA4P 7CEIA 2NO8A 2VLNA 5HGNA 5EW5E 1VHNA 2KG9A 1KD1Q 4COPA 2OTLP 2PENA 3E2DA 1M6NA 2MVVA 2MY5A 3DS3A 3U43A 2VLQA 3G4SP 1ZMBA 2LKIA 4IPYA 3GZLA 1HY8A 2CG5B 3GZMA 1F80D 1JJ2O 4R0MA 1VQOP 2LOLA 2PY8A 3G29A 1OR5A 2JAZA 2KGAA 4DG9A 2PEQA 2CGQA 1CEIA 4U0FA 2EFJA 3G21A 1KC8Q 1MZ8A 4CA3A 3H4EA 3HYBA 4U0DA 2AF8A 4H2YC 2K0YA 3G26A 2VLOA 2KWLA 1UJZA 2KW2A 1NJIQ 1YJ9P 2KGCA 1S72P 2K5XA 5HV8A 2PEMA 1AF8A 2KOSA 2K0DX 3G6EP 1GPJA 2CQ8A 2FVFA 4U0BA 1M6EX 4U0EA 2L22A 3WBHA 3CD6P 3CE7A 4PH0A 2LPKA 5BS1A 1KLPA 2PNGA 2KR5A 1KQSO 2FVAA 3CCUP 1YI2P 1T8KA 2EHTA 1K30A 2FVEA 3EJEA 5HGLA 1RO0A 2QEXP 2E1MA 1YHQP 2Z44A 2WPTA 2LIWA 2CWOA 1Z6MA 2XT1A 1VKUA 5EJDA 2GZGA 1VQMP
chains in the Genus database with same CATH topology
2FQ2A 2LKIA 2KG6A 2MR7A 2KORA 3GZLA 4H2WC 1HY8A 2CG5B 3GZMA 1F80D 2FADA 2N98A 2XZ1C 2KGEA 4R0MA 5CZDB 2EHSA 2LOLA 1NQ4A 2X2BA 2N5HA 2QNWA 1OR5A 2L0QA 2KGAA 2FAEA 4DG9A 2K2QA 2AVAA 2CGQA 3EJBA 2K94A 2MVUA 3RG2A 2N50A 2GDYA 2L4BA 4CA3A 2GDWA 4IZ6A 3EJDA 1HQBA 5KP6B 2CNRA 2MF4A 2K92A 1L0IA 2FHSC 2AF8A 2ROQA 4H2YC 2GDXA 2K0YA 2AFDA 2KG8A 2KWLA 4HKGA 2JU2A 2KW2A 2L9FA 2DNWA 3LMOA 4BPHA 2KGCA 2K0XA 5HV8A 2M5RA 5KP7B 3NY7B 1AF8A 1ACPA 2JGPA 2MD9A 2KOSA 2VSQA 4H2XC 2CQ8A 2FQ1A 4PXHB 2AFEA 2FVFA 2LMLA 4BPGA 2L22A 2LL8A 2N6ZA 2FACA 3CE7A 2KOPA 1X3OA 4MRTC 1DV5A 2LPKA 5HVCA 4NEOA 2FQ0A 1KLPA 2N6YA 2PNGA 2KR5A 2FVAA 1T8KA 4BPFA 2EHTA 2JU1A 2FVEA 3EJEA 2K93A 2KOOA 2JQ4A 4PWVB 2LTEA 2N5IA 2KOQA 2KG9A 2LIWA 2MVVA 2KGDA 2MY5A 5KP8B 2XZ0D 1VKUA 5EJDA 1DNYA 1L0HA 2MR8A 2LIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQ2 A;  2LKI A;  2KG6 A;  2MR7 A;  2KOR A;  3GZL A;  4H2W C;  1HY8 A;  2CG5 B;  3GZM A;  1F80 D;  2FAD A;  2N98 A;  2XZ1 C;  2KGE A;  4R0M A;  5CZD B;  2EHS A;  2LOL A;  1NQ4 A;  2X2B A;  2N5H A;  2QNW A;  1OR5 A;  2L0Q A;  2KGA A;  2FAE A;  4DG9 A;  2K2Q A;  2AVA A;  2CGQ A;  3EJB A;  2K94 A;  2MVU A;  3RG2 A;  2N50 A;  2GDY A;  2L4B A;  4CA3 A;  2GDW A;  4IZ6 A;  3EJD A;  1HQB A;  5KP6 B;  2CNR A;  2MF4 A;  2K92 A;  1L0I A;  2FHS C;  2AF8 A;  2ROQ A;  4H2Y C;  2GDX A;  2K0Y A;  2AFD A;  2KG8 A;  2KWL A;  4HKG A;  2JU2 A;  2KW2 A;  2L9F A;  2DNW A;  3LMO A;  4BPH A;  2KGC A;  2K0X A;  5HV8 A;  2M5R A;  5KP7 B;  3NY7 B;  1AF8 A;  1ACP A;  2JGP A;  2MD9 A;  2KOS A;  2VSQ A;  4H2X C;  2CQ8 A;  2FQ1 A;  4PXH B;  2AFE A;  2FVF A;  2LML A;  4BPG A;  2L22 A;  2LL8 A;  2N6Z A;  2FAC A;  3CE7 A;  2KOP A;  1X3O A;  4MRT C;  1DV5 A;  2LPK A;  5HVC A;  4NEO A;  2FQ0 A;  1KLP A;  2N6Y A;  2PNG A;  2KR5 A;  2FVA A;  1T8K A;  4BPF A;  2EHT A;  2JU1 A;  2FVE A;  3EJE A;  2K93 A;  2KOO A;  2JQ4 A;  4PWV B;  2LTE A;  2N5I A;  2KOQ A;  2KG9 A;  2LIW A;  2MVV A;  2KGD A;  2MY5 A;  5KP8 B;  2XZ0 D;  1VKU A;  5EJD A;  1DNY A;  1L0H A;  2MR8 A;  2LIU A; 
#chains in the Genus database with same CATH topology
 2MR7 A;  2KOR A;  3CPW O;  3DPH A;  2DGY A;  3CC7 P;  2XZ1 C;  1A43 A;  3H0D A;  3RG6 C;  1AYI A;  2GZF A;  2QNW A;  3NTE A;  3CMA P;  1A8O A;  2AVA A;  1M74 A;  2ERH A;  2JYG A;  3CCM P;  1ZNV A;  3H47 A;  5JPA A;  2L4B A;  4UHP B;  2MF4 A;  2JBG A;  2AFD A;  3CCL P;  4HKG A;  4F37 A;  1RNI A;  2Z45 A;  4WYM A;  4U0C A;  2GZJ A;  1VQ9 P;  3NY7 B;  2MD9 A;  4PXH B;  3DTJ A;  4BPG A;  5I4T G;  2N6Z A;  3VRL C;  1YIT P;  2KOP A;  4MRT C;  2BHV A;  4GR2 A;  1K73 Q;  4BPF A;  5F2N A;  1D1D A;  1Q7Y Q;  2K93 A;  1RO2 A;  4PWV B;  1UNK A;  3CCV P;  3OW2 O;  2LTE A;  4COC A;  3Q20 A;  1VQ7 P;  1BAJ A;  4XFX A;  1EIA A;  1N8R Q;  2GYK A;  1VQ8 P;  1QRJ A;  1BXI A;  3CCE P;  2KG6 A;  3DS2 A;  1IMP A;  3I56 P;  4QNB A;  2FAD A;  2L6E A;  2JO0 A;  2EHS A;  2X2B A;  1NQ4 A;  1K9M Q;  3G1I A;  4XFY A;  4XFZ A;  3CCQ P;  2L0Q A;  1EOQ A;  2FAE A;  2K2Q A;  3EJB A;  2BUO A;  2MVU A;  5HGM A;  1VQ6 P;  3RG2 A;  2N50 A;  2M8L A;  2PEJ A;  2PEI A;  3DS1 A;  2GDY A;  2GDW A;  3EJD A;  1HQB A;  5KP6 B;  4U0A A;  2CNR A;  2ROQ A;  2PEO A;  3DS4 A;  2XXM A;  3B4Q A;  3LMO A;  2K0X A;  1QVG O;  3G1G A;  2OAR A;  1YJN P;  1E0H A;  5KP7 B;  3DS5 A;  1ACP A;  3CXC O;  2VSQ A;  1W2B O;  2FQ1 A;  1YIJ P;  3CME P;  2LML A;  1M90 Q;  1GXH A;  4XRO A;  1QVF O;  2FAC A;  5F2O A;  2EG5 A;  2LF4 A;  4NEO A;  3CC2 P;  2FQ0 A;  2N6Y A;  1K8A Q;  2EIA A;  1IUQ A;  2GZI A;  3HZQ A;  1Q81 Q;  2JU1 A;  2JYL A;  2KOO A;  2JQ4 A;  5BS2 A;  3I55 P;  3G28 A;  1VQP P;  2N5I A;  2KOQ A;  2JB0 A;  2KOD A;  2M8P A;  2KGD A;  5KP8 B;  2XZ0 D;  1DNY A;  1L0H A;  2MR8 A;  2LIU A;  1Q82 Q;  1VQN P;  2XV6 A;  2FQ2 A;  2GZE A;  5F2K A;  1AUM A;  1VQK P;  4H2W C;  4PH1 A;  1YJW P;  1VQL P;  2N98 A;  1EMV A;  2KGE A;  4QKO A;  5CZD B;  3CCJ P;  2N5H A;  1FR2 A;  2ONT A;  3GJN A;  3M1M A;  3G71 P;  2K94 A;  1E6J P;  4IZ6 A;  3MGE A;  2K92 A;  1M1K Q;  1L0I A;  2FHS C;  1GXG A;  2GDX A;  2KG8 A;  3G0V A;  2JU2 A;  2L9F A;  3CCR P;  3CCS P;  2M8N A;  2DNW A;  4BPH A;  5DCK A;  2M5R A;  3B5I A;  2OTJ P;  3CC4 P;  2VLP A;  3GKL C;  2JGP A;  4H2X C;  1IMQ A;  2AFE A;  4GR6 A;  3LRY A;  2LL8 A;  3P05 A;  2P9X A;  1X3O A;  1DV5 A;  4XRQ A;  3DS0 A;  1Q86 Q;  5HVC A;  1VQ5 P;  2PEK A;  2Z46 A;  1VQ4 P;  5HGO A;  4M0I A;  2QA4 P;  7CEI A;  2NO8 A;  2VLN A;  5HGN A;  5EW5 E;  1VHN A;  2KG9 A;  1KD1 Q;  4COP A;  2OTL P;  2PEN A;  3E2D A;  1M6N A;  2MVV A;  2MY5 A;  3DS3 A;  3U43 A;  2VLQ A;  3G4S P;  1ZMB A;  2LKI A;  4IPY A;  3GZL A;  1HY8 A;  2CG5 B;  3GZM A;  1F80 D;  1JJ2 O;  4R0M A;  1VQO P;  2LOL A;  2PY8 A;  3G29 A;  1OR5 A;  2JAZ A;  2KGA A;  4DG9 A;  2PEQ A;  2CGQ A;  1CEI A;  4U0F A;  2EFJ A;  3G21 A;  1KC8 Q;  1MZ8 A;  4CA3 A;  3H4E A;  3HYB A;  4U0D A;  2AF8 A;  4H2Y C;  2K0Y A;  3G26 A;  2VLO A;  2KWL A;  1UJZ A;  2KW2 A;  1NJI Q;  1YJ9 P;  2KGC A;  1S72 P;  2K5X A;  5HV8 A;  2PEM A;  1AF8 A;  2KOS A;  2K0D X;  3G6E P;  1GPJ A;  2CQ8 A;  2FVF A;  4U0B A;  1M6E X;  4U0E A;  2L22 A;  3WBH A;  3CD6 P;  3CE7 A;  4PH0 A;  2LPK A;  5BS1 A;  1KLP A;  2PNG A;  2KR5 A;  1KQS O;  2FVA A;  3CCU P;  1YI2 P;  1T8K A;  2EHT A;  1K30 A;  2FVE A;  3EJE A;  5HGL A;  1RO0 A;  2QEX P;  2E1M A;  1YHQ P;  2Z44 A;  2WPT A;  2LIW A;  2CWO A;  1Z6M A;  2XT1 A;  1VKU A;  5EJD A;  2GZG A;  1VQM P; 
#chains in the Genus database with same CATH homology
 2FQ2 A;  2LKI A;  2KG6 A;  2MR7 A;  2KOR A;  3GZL A;  4H2W C;  1HY8 A;  2CG5 B;  3GZM A;  1F80 D;  2FAD A;  2N98 A;  2XZ1 C;  2KGE A;  4R0M A;  5CZD B;  2EHS A;  2LOL A;  1NQ4 A;  2X2B A;  2N5H A;  2QNW A;  1OR5 A;  2L0Q A;  2KGA A;  2FAE A;  4DG9 A;  2K2Q A;  2AVA A;  2CGQ A;  3EJB A;  2K94 A;  2MVU A;  3RG2 A;  2N50 A;  2GDY A;  2L4B A;  4CA3 A;  2GDW A;  4IZ6 A;  3EJD A;  1HQB A;  5KP6 B;  2CNR A;  2MF4 A;  2K92 A;  1L0I A;  2FHS C;  2AF8 A;  2ROQ A;  4H2Y C;  2GDX A;  2K0Y A;  2AFD A;  2KG8 A;  2KWL A;  4HKG A;  2JU2 A;  2KW2 A;  2L9F A;  2DNW A;  3LMO A;  4BPH A;  2KGC A;  2K0X A;  5HV8 A;  2M5R A;  5KP7 B;  3NY7 B;  1AF8 A;  1ACP A;  2JGP A;  2MD9 A;  2KOS A;  2VSQ A;  4H2X C;  2CQ8 A;  2FQ1 A;  4PXH B;  2AFE A;  2FVF A;  2LML A;  4BPG A;  2L22 A;  2LL8 A;  2N6Z A;  2FAC A;  3CE7 A;  2KOP A;  1X3O A;  4MRT C;  1DV5 A;  2LPK A;  5HVC A;  4NEO A;  2FQ0 A;  1KLP A;  2N6Y A;  2PNG A;  2KR5 A;  2FVA A;  1T8K A;  4BPF A;  2EHT A;  2JU1 A;  2FVE A;  3EJE A;  2K93 A;  2KOO A;  2JQ4 A;  4PWV B;  2LTE A;  2N5I A;  2KOQ A;  2KG9 A;  2LIW A;  2MVV A;  2KGD A;  2MY5 A;  5KP8 B;  2XZ0 D;  1VKU A;  5EJD A;  1DNY A;  1L0H A;  2MR8 A;  2LIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...