2K93A

Structural modification of acyl carrier protein by butyryl group
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGQQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural modification of acyl carrier protein by butyryl group.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
molecule keywords Acyl carrier protein
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k93A00
2K94A 2KOSA 4PXHB 2QNWA 2GDYA 2XZ0D 2FQ0A 2L4BA 2MR8A 5HV8A 2FQ1A 4BPFA 2CGQA 2FHSC 2KG8A 2KW2A 2KWLA 3CE7A 3GZLA 2CG5B 4H2YC 1AF8A 4CA3A 4NEOA 5KP8B 2LIUA 2AFDA 2EHTA 2JQ4A 5EJDA 1NQ4A 2GDXA 2K92A 1L0IA 1DV5A 2KOQA 2N98A 2FADA 2JU1A 2M5RA 2LIWA 5HVCA 4MRTC 2L22A 2JU2A 2MVUA 2FVAA 2GDWA 2K2QA 2EHSA 1ACPA 1DNYA 3LMOA 2KG6A 1X3OA 1T8KA 5KP6B 2MR7A 1KLPA 2CQ8A 2KR5A 4PWVB 2DNWA 4HKGA 2LOLA 2PNGA 2CNRA 4BPGA 2KORA 3RG2A 2KGDA 2N50A 2AVAA 2FVEA 3EJDA 2N6ZA 2AFEA 2AF8A 2KG9A 4IZ6A 2X2BA 4BPHA 2XZ1C 2K0XA 2N5HA 2KGAA 4H2XC 2FQ2A 2KOOA 1OR5A 2MD9A 1HY8A 2JGPA 5KP7B 3EJEA 2MVVA 1VKUA 2FAEA 3NY7B 4H2WC 2K93A 2FVFA 2MF4A 2LMLA 2N6YA 1HQBA 1F80D 3EJBA 2VSQA 5CZDB 2FACA 2KOPA 2ROQA 3GZMA 2L0QA 2LPKA 2K0YA 2MY5A 4R0MA 2N5IA 2KGCA 2KGEA 1L0HA 2L9FA 2LL8A 2LTEA 4DG9A 2LKIA
chains in the Genus database with same CATH superfamily
1VQ5P 1AUMA 3G21A 5HGNA 1VQPP 2L4BA 1EOQA 5HV8A 2GZIA 2FQ1A 2VLPA 2XT1A 1VQMP 3CE7A 3GJNA 2QEXP 2XV6A 4UHPB 1IMQA 2EIAA 2GDXA 2K92A 1W2BO 1YITP 2N98A 1BAJA 5HVCA 3G29A 1YIJP 3DS1A 3G0VA 2PEKA 1A8OA 2MR7A 4U0FA 3CXCO 3I56P 1KQSO 1Q81Q 1QVFO 2NO8A 1Q7YQ 3CMAP 4XFZA 1VHNA 2X2BA 2XZ1C 2K0XA 1GXGA 2KGAA 3DS5A 2MF4A 3H47A 1VQ6P 1VQNP 1K73Q 5CZDB 3VRLC 1NJIQ 2ROQA 3E2DA 1M6NA 2WPTA 2PEJA 3B4QA 4R0MA 1M74A 4QNBA 2ERHA 2K94A 1MZ8A 5F2KA 4PH1A 4PXHB 3MGEA 1UJZA 2BHVA 1Q82Q 1AYIA 3U43A 3CC2P 1KC8Q 3HYBA 2JO0A 2CGQA 2VLQA 2XXMA 1Q86Q 2KW2A 1RNIA 3GZLA 2OTLP 2PEQA 2AFDA 3Q20A 3CC4P 1DV5A 1VQKP 1QVGO 2FADA 4U0AA 4QKOA 3CC7P 1VQOP 5F2NA 3CD6P 3CPWO 2GDWA 3M1MA 3CCSP 1ACPA 1Z6MA 4XFYA 1EIAA 1KLPA 3CCRP 2KR5A 2LOLA 2KORA 3RG2A 2N50A 1EMVA 3EJDA 3P05A 4BPHA 2JBGA 2N5HA 4H2XC 2GZFA 2KOOA 2MD9A 3CCMP 2JGPA 5BS2A 3EJEA 1K9MQ 2GYKA 3G71P 2M8NA 1VQLP 3G1GA 3CMEP 2FACA 1RO2A 2LPKA 2MY5A 4U0DA 1QRJA 3DS2A 2EG5A 3H0DA 1YI2P 2LF4A 2LTEA 4XROA 2KOSA 3DS0A 1D1DA 2QNWA 2XZ0D 2OARA 2FQ0A 2MR8A 1VQ8P 2GZEA 2Z44A 2P9XA 1KD1Q 2JAZA 1M6EX 3NTEA 1M1KQ 7CEIA 1E6JP 1K30A 4H2YC 1YJWP 1A43A 3G1IA 1AF8A 2LIUA 2L6EA 2EHTA 1NQ4A 3B5IA 1YJ9P 2QA4P 2OTJP 3G28A 3DS4A 2JU1A 2M5RA 4GR6A 4MRTC 5HGMA 2L22A 2FVAA 2K2QA 2MVUA 2EHSA 1VQ7P 1DNYA 3LMOA 4U0CA 2KG6A 1X3OA 2GZGA 1FR2A 3G4SP 1T8KA 1GPJA 5DCKA 5KP6B 2CQ8A 2DNWA 4HKGA 2M8LA 4BPGA 2CNRA 4U0EA 3WBHA 1VQ4P 2KGDA 2AVAA 2FVEA 3DTJA 3CCLP 2KG9A 4IZ6A 4XRQA 2Z45A 3CCEP 2FQ2A 2PEMA 3G6EP 1GXHA 2E1MA 1HY8A 2ONTA 5KP7B 1VKUA 2MVVA 2FAEA 1RO0A 5EW5E 2LMLA 2JB0A 2N6YA 1F80D 2VSQA 3I55P 2M8PA 3GKLC 2K0DX 2K0YA 4XFXA 1K8AQ 2PEOA 2EFJA 2KGCA 1L0HA 2LL8A 4DG9A 3DS3A 3HZQA 1VQ9P 2VLNA 2GDYA 4PH0A 1BXIA 2JYGA 1IMPA 3CCUP 1ZNVA 4BPFA 2VLOA 2FHSC 2KG8A 5HGLA 2BUOA 2KWLA 3RG6C 2CG5B 1M90Q 4CA3A 4NEOA 3H4EA 5KP8B 2JQ4A 5EJDA 4GR2A 1L0IA 1N8RQ 1CEIA 5I4TG 2KOQA 4COCA 4U0BA 5JPAA 4WYMA 2LIWA 1E0HA 2JU2A 1S72P 4M0IA 2PENA 1IUQA 3DPHA 1JJ2O 2CWOA 3CCJP 1YHQP 4IPYA 2JYLA 4PWVB 1UNKA 2PNGA 2PEIA 2DGYA 2N6ZA 2AFEA 2AF8A 5F2OA 3CCVP 1OR5A 2KODA 3OW2O 4H2WC 3NY7B 2K93A 3CCQP 2FVFA 3G26A 2K5XA 2Z46A 2GZJA 1HQBA 3EJBA 5BS1A 1ZMBA 3LRYA 2KOPA 5HGOA 4F37A 3GZMA 2L0QA 1YJNP 2KGEA 2L9FA 2N5IA 2PY8A 4COPA 2LKIA
chains in the Genus database with same CATH topology
2K94A 2KOSA 4PXHB 2QNWA 2GDYA 2XZ0D 2FQ0A 2L4BA 2MR8A 5HV8A 2FQ1A 4BPFA 2CGQA 2FHSC 2KG8A 2KW2A 2KWLA 3CE7A 3GZLA 2CG5B 4H2YC 1AF8A 4CA3A 4NEOA 5KP8B 2LIUA 2AFDA 2EHTA 2JQ4A 5EJDA 1NQ4A 2GDXA 2K92A 1L0IA 1DV5A 2KOQA 2N98A 2FADA 2JU1A 2M5RA 2LIWA 5HVCA 4MRTC 2L22A 2JU2A 2MVUA 2FVAA 2GDWA 2K2QA 2EHSA 1ACPA 1DNYA 3LMOA 2KG6A 1X3OA 1T8KA 5KP6B 2MR7A 1KLPA 2CQ8A 2KR5A 4PWVB 2DNWA 4HKGA 2LOLA 2PNGA 2CNRA 4BPGA 2KORA 3RG2A 2KGDA 2N50A 2AVAA 2FVEA 3EJDA 2N6ZA 2AFEA 2AF8A 2KG9A 4IZ6A 2X2BA 4BPHA 2XZ1C 2K0XA 2N5HA 2KGAA 4H2XC 2FQ2A 2KOOA 1OR5A 2MD9A 1HY8A 2JGPA 5KP7B 3EJEA 2MVVA 1VKUA 2FAEA 3NY7B 4H2WC 2K93A 2FVFA 2MF4A 2LMLA 2N6YA 1HQBA 1F80D 3EJBA 2VSQA 5CZDB 2FACA 2KOPA 2ROQA 3GZMA 2L0QA 2LPKA 2K0YA 2MY5A 4R0MA 2N5IA 2KGCA 2KGEA 1L0HA 2L9FA 2LL8A 2LTEA 4DG9A 2LKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K94 A;  2KOS A;  4PXH B;  2QNW A;  2GDY A;  2XZ0 D;  2FQ0 A;  2L4B A;  2MR8 A;  5HV8 A;  2FQ1 A;  4BPF A;  2CGQ A;  2FHS C;  2KG8 A;  2KW2 A;  2KWL A;  3CE7 A;  3GZL A;  2CG5 B;  4H2Y C;  1AF8 A;  4CA3 A;  4NEO A;  5KP8 B;  2LIU A;  2AFD A;  2EHT A;  2JQ4 A;  5EJD A;  1NQ4 A;  2GDX A;  2K92 A;  1L0I A;  1DV5 A;  2KOQ A;  2N98 A;  2FAD A;  2JU1 A;  2M5R A;  2LIW A;  5HVC A;  4MRT C;  2L22 A;  2JU2 A;  2MVU A;  2FVA A;  2GDW A;  2K2Q A;  2EHS A;  1ACP A;  1DNY A;  3LMO A;  2KG6 A;  1X3O A;  1T8K A;  5KP6 B;  2MR7 A;  1KLP A;  2CQ8 A;  2KR5 A;  4PWV B;  2DNW A;  4HKG A;  2LOL A;  2PNG A;  2CNR A;  4BPG A;  2KOR A;  3RG2 A;  2KGD A;  2N50 A;  2AVA A;  2FVE A;  3EJD A;  2N6Z A;  2AFE A;  2AF8 A;  2KG9 A;  4IZ6 A;  2X2B A;  4BPH A;  2XZ1 C;  2K0X A;  2N5H A;  2KGA A;  4H2X C;  2FQ2 A;  2KOO A;  1OR5 A;  2MD9 A;  1HY8 A;  2JGP A;  5KP7 B;  3EJE A;  2MVV A;  1VKU A;  2FAE A;  3NY7 B;  4H2W C;  2K93 A;  2FVF A;  2MF4 A;  2LML A;  2N6Y A;  1HQB A;  1F80 D;  3EJB A;  2VSQ A;  5CZD B;  2FAC A;  2KOP A;  2ROQ A;  3GZM A;  2L0Q A;  2LPK A;  2K0Y A;  2MY5 A;  4R0M A;  2N5I A;  2KGC A;  2KGE A;  1L0H A;  2L9F A;  2LL8 A;  2LTE A;  4DG9 A;  2LKI A; 
#chains in the Genus database with same CATH topology
 1VQ5 P;  1AUM A;  3G21 A;  5HGN A;  1VQP P;  2L4B A;  1EOQ A;  5HV8 A;  2GZI A;  2FQ1 A;  2VLP A;  2XT1 A;  1VQM P;  3CE7 A;  3GJN A;  2QEX P;  2XV6 A;  4UHP B;  1IMQ A;  2EIA A;  2GDX A;  2K92 A;  1W2B O;  1YIT P;  2N98 A;  1BAJ A;  5HVC A;  3G29 A;  1YIJ P;  3DS1 A;  3G0V A;  2PEK A;  1A8O A;  2MR7 A;  4U0F A;  3CXC O;  3I56 P;  1KQS O;  1Q81 Q;  1QVF O;  2NO8 A;  1Q7Y Q;  3CMA P;  4XFZ A;  1VHN A;  2X2B A;  2XZ1 C;  2K0X A;  1GXG A;  2KGA A;  3DS5 A;  2MF4 A;  3H47 A;  1VQ6 P;  1VQN P;  1K73 Q;  5CZD B;  3VRL C;  1NJI Q;  2ROQ A;  3E2D A;  1M6N A;  2WPT A;  2PEJ A;  3B4Q A;  4R0M A;  1M74 A;  4QNB A;  2ERH A;  2K94 A;  1MZ8 A;  5F2K A;  4PH1 A;  4PXH B;  3MGE A;  1UJZ A;  2BHV A;  1Q82 Q;  1AYI A;  3U43 A;  3CC2 P;  1KC8 Q;  3HYB A;  2JO0 A;  2CGQ A;  2VLQ A;  2XXM A;  1Q86 Q;  2KW2 A;  1RNI A;  3GZL A;  2OTL P;  2PEQ A;  2AFD A;  3Q20 A;  3CC4 P;  1DV5 A;  1VQK P;  1QVG O;  2FAD A;  4U0A A;  4QKO A;  3CC7 P;  1VQO P;  5F2N A;  3CD6 P;  3CPW O;  2GDW A;  3M1M A;  3CCS P;  1ACP A;  1Z6M A;  4XFY A;  1EIA A;  1KLP A;  3CCR P;  2KR5 A;  2LOL A;  2KOR A;  3RG2 A;  2N50 A;  1EMV A;  3EJD A;  3P05 A;  4BPH A;  2JBG A;  2N5H A;  4H2X C;  2GZF A;  2KOO A;  2MD9 A;  3CCM P;  2JGP A;  5BS2 A;  3EJE A;  1K9M Q;  2GYK A;  3G71 P;  2M8N A;  1VQL P;  3G1G A;  3CME P;  2FAC A;  1RO2 A;  2LPK A;  2MY5 A;  4U0D A;  1QRJ A;  3DS2 A;  2EG5 A;  3H0D A;  1YI2 P;  2LF4 A;  2LTE A;  4XRO A;  2KOS A;  3DS0 A;  1D1D A;  2QNW A;  2XZ0 D;  2OAR A;  2FQ0 A;  2MR8 A;  1VQ8 P;  2GZE A;  2Z44 A;  2P9X A;  1KD1 Q;  2JAZ A;  1M6E X;  3NTE A;  1M1K Q;  7CEI A;  1E6J P;  1K30 A;  4H2Y C;  1YJW P;  1A43 A;  3G1I A;  1AF8 A;  2LIU A;  2L6E A;  2EHT A;  1NQ4 A;  3B5I A;  1YJ9 P;  2QA4 P;  2OTJ P;  3G28 A;  3DS4 A;  2JU1 A;  2M5R A;  4GR6 A;  4MRT C;  5HGM A;  2L22 A;  2FVA A;  2K2Q A;  2MVU A;  2EHS A;  1VQ7 P;  1DNY A;  3LMO A;  4U0C A;  2KG6 A;  1X3O A;  2GZG A;  1FR2 A;  3G4S P;  1T8K A;  1GPJ A;  5DCK A;  5KP6 B;  2CQ8 A;  2DNW A;  4HKG A;  2M8L A;  4BPG A;  2CNR A;  4U0E A;  3WBH A;  1VQ4 P;  2KGD A;  2AVA A;  2FVE A;  3DTJ A;  3CCL P;  2KG9 A;  4IZ6 A;  4XRQ A;  2Z45 A;  3CCE P;  2FQ2 A;  2PEM A;  3G6E P;  1GXH A;  2E1M A;  1HY8 A;  2ONT A;  5KP7 B;  1VKU A;  2MVV A;  2FAE A;  1RO0 A;  5EW5 E;  2LML A;  2JB0 A;  2N6Y A;  1F80 D;  2VSQ A;  3I55 P;  2M8P A;  3GKL C;  2K0D X;  2K0Y A;  4XFX A;  1K8A Q;  2PEO A;  2EFJ A;  2KGC A;  1L0H A;  2LL8 A;  4DG9 A;  3DS3 A;  3HZQ A;  1VQ9 P;  2VLN A;  2GDY A;  4PH0 A;  1BXI A;  2JYG A;  1IMP A;  3CCU P;  1ZNV A;  4BPF A;  2VLO A;  2FHS C;  2KG8 A;  5HGL A;  2BUO A;  2KWL A;  3RG6 C;  2CG5 B;  1M90 Q;  4CA3 A;  4NEO A;  3H4E A;  5KP8 B;  2JQ4 A;  5EJD A;  4GR2 A;  1L0I A;  1N8R Q;  1CEI A;  5I4T G;  2KOQ A;  4COC A;  4U0B A;  5JPA A;  4WYM A;  2LIW A;  1E0H A;  2JU2 A;  1S72 P;  4M0I A;  2PEN A;  1IUQ A;  3DPH A;  1JJ2 O;  2CWO A;  3CCJ P;  1YHQ P;  4IPY A;  2JYL A;  4PWV B;  1UNK A;  2PNG A;  2PEI A;  2DGY A;  2N6Z A;  2AFE A;  2AF8 A;  5F2O A;  3CCV P;  1OR5 A;  2KOD A;  3OW2 O;  4H2W C;  3NY7 B;  2K93 A;  3CCQ P;  2FVF A;  3G26 A;  2K5X A;  2Z46 A;  2GZJ A;  1HQB A;  3EJB A;  5BS1 A;  1ZMB A;  3LRY A;  2KOP A;  5HGO A;  4F37 A;  3GZM A;  2L0Q A;  1YJN P;  2KGE A;  2L9F A;  2N5I A;  2PY8 A;  4COP A;  2LKI A; 
#chains in the Genus database with same CATH homology
 2K94 A;  2KOS A;  4PXH B;  2QNW A;  2GDY A;  2XZ0 D;  2FQ0 A;  2L4B A;  2MR8 A;  5HV8 A;  2FQ1 A;  4BPF A;  2CGQ A;  2FHS C;  2KG8 A;  2KW2 A;  2KWL A;  3CE7 A;  3GZL A;  2CG5 B;  4H2Y C;  1AF8 A;  4CA3 A;  4NEO A;  5KP8 B;  2LIU A;  2AFD A;  2EHT A;  2JQ4 A;  5EJD A;  1NQ4 A;  2GDX A;  2K92 A;  1L0I A;  1DV5 A;  2KOQ A;  2N98 A;  2FAD A;  2JU1 A;  2M5R A;  2LIW A;  5HVC A;  4MRT C;  2L22 A;  2JU2 A;  2MVU A;  2FVA A;  2GDW A;  2K2Q A;  2EHS A;  1ACP A;  1DNY A;  3LMO A;  2KG6 A;  1X3O A;  1T8K A;  5KP6 B;  2MR7 A;  1KLP A;  2CQ8 A;  2KR5 A;  4PWV B;  2DNW A;  4HKG A;  2LOL A;  2PNG A;  2CNR A;  4BPG A;  2KOR A;  3RG2 A;  2KGD A;  2N50 A;  2AVA A;  2FVE A;  3EJD A;  2N6Z A;  2AFE A;  2AF8 A;  2KG9 A;  4IZ6 A;  2X2B A;  4BPH A;  2XZ1 C;  2K0X A;  2N5H A;  2KGA A;  4H2X C;  2FQ2 A;  2KOO A;  1OR5 A;  2MD9 A;  1HY8 A;  2JGP A;  5KP7 B;  3EJE A;  2MVV A;  1VKU A;  2FAE A;  3NY7 B;  4H2W C;  2K93 A;  2FVF A;  2MF4 A;  2LML A;  2N6Y A;  1HQB A;  1F80 D;  3EJB A;  2VSQ A;  5CZD B;  2FAC A;  2KOP A;  2ROQ A;  3GZM A;  2L0Q A;  2LPK A;  2K0Y A;  2MY5 A;  4R0M A;  2N5I A;  2KGC A;  2KGE A;  1L0H A;  2L9F A;  2LL8 A;  2LTE A;  4DG9 A;  2LKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...