2K93A

Structural modification of acyl carrier protein by butyryl group
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
77
structure length
77
Chain Sequence
STIEERVKKIIGQQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title Structural modification of acyl carrier protein by butyryl group.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lipid transport
total genus 17
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2008-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2k93A00
2MR8A 2CG5B 2LIWA 3EJDA 2CNRA 2EHSA 2FQ0A 2N5IA 1HQBA 2GDYA 2N50A 4BPGA 2X2BA 2KGEA 2AFDA 2MF4A 2LPKA 4R0MA 2LIUA 2K93A 4H2WC 2FVAA 2KR5A 2L22A 2CGQA 2K0XA 2KG6A 2M5RA 3NY7B 2L9FA 1DV5A 1F80D 3CE7A 2JU1A 2N5HA 5HVCA 2K2QA 2JGPA 2KG8A 2XZ0D 2N6YA 2K92A 2MR7A 2KORA 2FADA 5KP6B 2AVAA 3EJEA 1L0HA 2LKIA 3LMOA 2CQ8A 2EHTA 2JU2A 5EJDA 2KGCA 4IZ6A 1T8KA 4H2XC 1VKUA 3EJBA 4DG9A 5KP7B 2N98A 1KLPA 2FQ1A 2GDXA 2KOSA 2L4BA 3GZLA 2QNWA 4H2YC 2FAEA 2KOQA 2KGDA 2LOLA 4BPHA 5CZDB 2MVVA 3GZMA 2LTEA 1ACPA 2MD9A 5KP8B 2LMLA 4PWVB 2JQ4A 2DNWA 2FACA 2KG9A 1AF8A 1HY8A 2N6ZA 2FHSC 2KOOA 2XZ1C 2LL8A 4MRTC 2AF8A 2PNGA 2KWLA 3RG2A 2MVUA 4CA3A 2ROQA 1X3OA 1NQ4A 2GDWA 2L0QA 4HKGA 2FQ2A 2MY5A 2FVFA 2KGAA 4NEOA 4PXHB 5HV8A 2KW2A 1OR5A 2KOPA 2AFEA 2K94A 2K0YA 1L0IA 4BPFA 2FVEA 1DNYA 2VSQA
chains in the Genus database with same CATH superfamily
3CCRP 1Q7YQ 1EIAA 2KODA 5HGNA 3G21A 2N5IA 5BS1A 1HQBA 4U0AA 5F2NA 1CEIA 1M74A 4R0MA 1AYIA 3DS3A 4IPYA 2K93A 4H2WC 3CD6P 3H4EA 2L22A 2XXMA 2KG6A 1DV5A 2N5HA 1K30A 1UNKA 2JGPA 2KORA 2Z46A 1YHQP 3CC2P 1A43A 2WPTA 3EJEA 3CMAP 3LMOA 2Z45A 5EJDA 2KGCA 4H2XC 2JBGA 1KD1Q 2KOSA 3CCSP 5I4TG 2GZIA 1M6EX 2FAEA 1VQPP 3P05A 3CCEP 2EFJA 2VLOA 1VQ6P 5CZDB 1FR2A 4GR6A 5F2KA 2DNWA 2OTJP 2JYLA 2KOOA 2GZJA 2JB0A 2XZ1C 3CCUP 1K73Q 1K8AQ 2PNGA 3H0DA 1YJWP 2KWLA 2LF4A 3G4SP 1VQ7P 2L0QA 3CCJP 2P9XA 2JO0A 2VLQA 4F37A 1VQMP 1RO2A 3G6EP 2MR8A 2CG5B 3I56P 2EHSA 2GDYA 5F2OA 2AFDA 4UHPB 2LIUA 2DGYA 3OW2O 2M8PA 4XFYA 2K0XA 1YITP 2L9FA 1Q81Q 2K2QA 3G26A 2K92A 2MR7A 1YJNP 5KP6B 1D1DA 4GR2A 4M0IA 1L0HA 2BHVA 2LKIA 2VLNA 4IZ6A 1VHNA 2M8NA 3U43A 3EJBA 1MZ8A 4DG9A 2N98A 1QVFO 4XFZA 1GXHA 2GZFA 2LOLA 2MVVA 5KP8B 2LMLA 1VQ9P 2JQ4A 3CCQP 2ERHA 5EW5E 2PENA 4U0BA 1AF8A 1HY8A 2GZEA 1M90Q 2N6ZA 1VQ8P 3G1GA 1N8RQ 2LL8A 3LRYA 4U0DA 1VQ4P 1IMPA 1QRJA 2PEIA 5HGOA 1AUMA 4MRTC 2EIAA 1ZMBA 1GPJA 2ROQA 2GDWA 2FQ2A 1VQKP 3DTJA 2VLPA 5JPAA 1W2BO 7CEIA 5HV8A 2AFEA 1IUQA 2K0YA 2K94A 1E0HA 1L0IA 2FVEA 3DPHA 2VSQA 4COCA 3G0VA 2CNRA 4WYMA 2PY8A 2FQ0A 3M1MA 1YIJP 4BPGA 2X2BA 2KGEA 3DS0A 1KQSO 3H47A 3MGEA 2FVAA 2PEMA 4U0EA 2PEKA 5BS2A 1Z6MA 2K5XA 2XZ0D 3CXCO 2OTLP 3DS5A 2FADA 2XV6A 4XRQA 2QEXP 2CQ8A 2EHTA 2JU2A 1T8KA 4QKOA 5KP7B 1QVGO 2L6EA 5HGMA 2QNWA 2XT1A 3G28A 1YI2P 1YJ9P 1ACPA 3Q20A 3G1IA 1M1KQ 4U0FA 2FACA 2EG5A 3B4QA 4QNBA 3CPWO 1A8OA 1UJZA 2Z44A 1BXIA 1GXGA 3RG2A 4CA3A 1NQ4A 1X3OA 5DCKA 1EMVA 4XFXA 2FVFA 1ZNVA 2KGAA 4NEOA 1BAJA 3HYBA 2CWOA 2KW2A 1OR5A 2KOPA 4U0CA 5HGLA 3B5IA 3DS1A 2OARA 2M8LA 3G71P 3CC7P 2LIWA 3EJDA 1Q86Q 1JJ2O 2N50A 3VRLC 3CCMP 2MF4A 2LPKA 2BUOA 1Q82Q 2KR5A 2CGQA 2M5RA 3NY7B 2JYGA 2PEOA 1F80D 3CE7A 2JU1A 1M6NA 5HVCA 2KG8A 4XROA 2N6YA 3RG6C 3WBHA 3I55P 1VQLP 1IMQA 4COPA 1RO0A 2AVAA 1KC8Q 1S72P 3GKLC 3HZQA 2NO8A 2PEJA 1EOQA 2ONTA 3CCLP 1VKUA 2GYKA 2GZGA 1KLPA 2FQ1A 2GDXA 1NJIQ 2L4BA 3DS4A 3E2DA 3GZLA 3CMEP 4H2YC 1VQNP 2JAZA 2KOQA 2KGDA 4BPHA 3GZMA 2LTEA 2MD9A 1E6JP 4PWVB 4PH0A 2KG9A 2K0DX 2FHSC 2E1MA 1RNIA 3CC4P 3G29A 2PEQA 4PH1A 2AF8A 2QA4P 2MVUA 3GJNA 3DS2A 1VQ5P 1K9MQ 4HKGA 2MY5A 1VQOP 4PXHB 3CCVP 4BPFA 1DNYA 3NTEA
chains in the Genus database with same CATH topology
2MR8A 2CG5B 2LIWA 3EJDA 2CNRA 2EHSA 2FQ0A 2N5IA 1HQBA 2GDYA 2N50A 4BPGA 2X2BA 2KGEA 2AFDA 2MF4A 2LPKA 4R0MA 2LIUA 2K93A 4H2WC 2FVAA 2KR5A 2L22A 2CGQA 2K0XA 2KG6A 2M5RA 3NY7B 2L9FA 1DV5A 1F80D 3CE7A 2JU1A 2N5HA 5HVCA 2K2QA 2JGPA 2KG8A 2XZ0D 2N6YA 2K92A 2MR7A 2KORA 2FADA 5KP6B 2AVAA 3EJEA 1L0HA 2LKIA 3LMOA 2CQ8A 2EHTA 2JU2A 5EJDA 2KGCA 4IZ6A 1T8KA 4H2XC 1VKUA 3EJBA 4DG9A 5KP7B 2N98A 1KLPA 2FQ1A 2GDXA 2KOSA 2L4BA 3GZLA 2QNWA 4H2YC 2FAEA 2KOQA 2KGDA 2LOLA 4BPHA 5CZDB 2MVVA 3GZMA 2LTEA 1ACPA 2MD9A 5KP8B 2LMLA 4PWVB 2JQ4A 2DNWA 2FACA 2KG9A 1AF8A 1HY8A 2N6ZA 2FHSC 2KOOA 2XZ1C 2LL8A 4MRTC 2AF8A 2PNGA 2KWLA 3RG2A 2MVUA 4CA3A 2ROQA 1X3OA 1NQ4A 2GDWA 2L0QA 4HKGA 2FQ2A 2MY5A 2FVFA 2KGAA 4NEOA 4PXHB 5HV8A 2KW2A 1OR5A 2KOPA 2AFEA 2K94A 2K0YA 1L0IA 4BPFA 2FVEA 1DNYA 2VSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MR8 A;  2CG5 B;  2LIW A;  3EJD A;  2CNR A;  2EHS A;  2FQ0 A;  2N5I A;  1HQB A;  2GDY A;  2N50 A;  4BPG A;  2X2B A;  2KGE A;  2AFD A;  2MF4 A;  2LPK A;  4R0M A;  2LIU A;  2K93 A;  4H2W C;  2FVA A;  2KR5 A;  2L22 A;  2CGQ A;  2K0X A;  2KG6 A;  2M5R A;  3NY7 B;  2L9F A;  1DV5 A;  1F80 D;  3CE7 A;  2JU1 A;  2N5H A;  5HVC A;  2K2Q A;  2JGP A;  2KG8 A;  2XZ0 D;  2N6Y A;  2K92 A;  2MR7 A;  2KOR A;  2FAD A;  5KP6 B;  2AVA A;  3EJE A;  1L0H A;  2LKI A;  3LMO A;  2CQ8 A;  2EHT A;  2JU2 A;  5EJD A;  2KGC A;  4IZ6 A;  1T8K A;  4H2X C;  1VKU A;  3EJB A;  4DG9 A;  5KP7 B;  2N98 A;  1KLP A;  2FQ1 A;  2GDX A;  2KOS A;  2L4B A;  3GZL A;  2QNW A;  4H2Y C;  2FAE A;  2KOQ A;  2KGD A;  2LOL A;  4BPH A;  5CZD B;  2MVV A;  3GZM A;  2LTE A;  1ACP A;  2MD9 A;  5KP8 B;  2LML A;  4PWV B;  2JQ4 A;  2DNW A;  2FAC A;  2KG9 A;  1AF8 A;  1HY8 A;  2N6Z A;  2FHS C;  2KOO A;  2XZ1 C;  2LL8 A;  4MRT C;  2AF8 A;  2PNG A;  2KWL A;  3RG2 A;  2MVU A;  4CA3 A;  2ROQ A;  1X3O A;  1NQ4 A;  2GDW A;  2L0Q A;  4HKG A;  2FQ2 A;  2MY5 A;  2FVF A;  2KGA A;  4NEO A;  4PXH B;  5HV8 A;  2KW2 A;  1OR5 A;  2KOP A;  2AFE A;  2K94 A;  2K0Y A;  1L0I A;  4BPF A;  2FVE A;  1DNY A;  2VSQ A; 
#chains in the Genus database with same CATH topology
 3CCR P;  1Q7Y Q;  1EIA A;  2KOD A;  5HGN A;  3G21 A;  2N5I A;  5BS1 A;  1HQB A;  4U0A A;  5F2N A;  1CEI A;  1M74 A;  4R0M A;  1AYI A;  3DS3 A;  4IPY A;  2K93 A;  4H2W C;  3CD6 P;  3H4E A;  2L22 A;  2XXM A;  2KG6 A;  1DV5 A;  2N5H A;  1K30 A;  1UNK A;  2JGP A;  2KOR A;  2Z46 A;  1YHQ P;  3CC2 P;  1A43 A;  2WPT A;  3EJE A;  3CMA P;  3LMO A;  2Z45 A;  5EJD A;  2KGC A;  4H2X C;  2JBG A;  1KD1 Q;  2KOS A;  3CCS P;  5I4T G;  2GZI A;  1M6E X;  2FAE A;  1VQP P;  3P05 A;  3CCE P;  2EFJ A;  2VLO A;  1VQ6 P;  5CZD B;  1FR2 A;  4GR6 A;  5F2K A;  2DNW A;  2OTJ P;  2JYL A;  2KOO A;  2GZJ A;  2JB0 A;  2XZ1 C;  3CCU P;  1K73 Q;  1K8A Q;  2PNG A;  3H0D A;  1YJW P;  2KWL A;  2LF4 A;  3G4S P;  1VQ7 P;  2L0Q A;  3CCJ P;  2P9X A;  2JO0 A;  2VLQ A;  4F37 A;  1VQM P;  1RO2 A;  3G6E P;  2MR8 A;  2CG5 B;  3I56 P;  2EHS A;  2GDY A;  5F2O A;  2AFD A;  4UHP B;  2LIU A;  2DGY A;  3OW2 O;  2M8P A;  4XFY A;  2K0X A;  1YIT P;  2L9F A;  1Q81 Q;  2K2Q A;  3G26 A;  2K92 A;  2MR7 A;  1YJN P;  5KP6 B;  1D1D A;  4GR2 A;  4M0I A;  1L0H A;  2BHV A;  2LKI A;  2VLN A;  4IZ6 A;  1VHN A;  2M8N A;  3U43 A;  3EJB A;  1MZ8 A;  4DG9 A;  2N98 A;  1QVF O;  4XFZ A;  1GXH A;  2GZF A;  2LOL A;  2MVV A;  5KP8 B;  2LML A;  1VQ9 P;  2JQ4 A;  3CCQ P;  2ERH A;  5EW5 E;  2PEN A;  4U0B A;  1AF8 A;  1HY8 A;  2GZE A;  1M90 Q;  2N6Z A;  1VQ8 P;  3G1G A;  1N8R Q;  2LL8 A;  3LRY A;  4U0D A;  1VQ4 P;  1IMP A;  1QRJ A;  2PEI A;  5HGO A;  1AUM A;  4MRT C;  2EIA A;  1ZMB A;  1GPJ A;  2ROQ A;  2GDW A;  2FQ2 A;  1VQK P;  3DTJ A;  2VLP A;  5JPA A;  1W2B O;  7CEI A;  5HV8 A;  2AFE A;  1IUQ A;  2K0Y A;  2K94 A;  1E0H A;  1L0I A;  2FVE A;  3DPH A;  2VSQ A;  4COC A;  3G0V A;  2CNR A;  4WYM A;  2PY8 A;  2FQ0 A;  3M1M A;  1YIJ P;  4BPG A;  2X2B A;  2KGE A;  3DS0 A;  1KQS O;  3H47 A;  3MGE A;  2FVA A;  2PEM A;  4U0E A;  2PEK A;  5BS2 A;  1Z6M A;  2K5X A;  2XZ0 D;  3CXC O;  2OTL P;  3DS5 A;  2FAD A;  2XV6 A;  4XRQ A;  2QEX P;  2CQ8 A;  2EHT A;  2JU2 A;  1T8K A;  4QKO A;  5KP7 B;  1QVG O;  2L6E A;  5HGM A;  2QNW A;  2XT1 A;  3G28 A;  1YI2 P;  1YJ9 P;  1ACP A;  3Q20 A;  3G1I A;  1M1K Q;  4U0F A;  2FAC A;  2EG5 A;  3B4Q A;  4QNB A;  3CPW O;  1A8O A;  1UJZ A;  2Z44 A;  1BXI A;  1GXG A;  3RG2 A;  4CA3 A;  1NQ4 A;  1X3O A;  5DCK A;  1EMV A;  4XFX A;  2FVF A;  1ZNV A;  2KGA A;  4NEO A;  1BAJ A;  3HYB A;  2CWO A;  2KW2 A;  1OR5 A;  2KOP A;  4U0C A;  5HGL A;  3B5I A;  3DS1 A;  2OAR A;  2M8L A;  3G71 P;  3CC7 P;  2LIW A;  3EJD A;  1Q86 Q;  1JJ2 O;  2N50 A;  3VRL C;  3CCM P;  2MF4 A;  2LPK A;  2BUO A;  1Q82 Q;  2KR5 A;  2CGQ A;  2M5R A;  3NY7 B;  2JYG A;  2PEO A;  1F80 D;  3CE7 A;  2JU1 A;  1M6N A;  5HVC A;  2KG8 A;  4XRO A;  2N6Y A;  3RG6 C;  3WBH A;  3I55 P;  1VQL P;  1IMQ A;  4COP A;  1RO0 A;  2AVA A;  1KC8 Q;  1S72 P;  3GKL C;  3HZQ A;  2NO8 A;  2PEJ A;  1EOQ A;  2ONT A;  3CCL P;  1VKU A;  2GYK A;  2GZG A;  1KLP A;  2FQ1 A;  2GDX A;  1NJI Q;  2L4B A;  3DS4 A;  3E2D A;  3GZL A;  3CME P;  4H2Y C;  1VQN P;  2JAZ A;  2KOQ A;  2KGD A;  4BPH A;  3GZM A;  2LTE A;  2MD9 A;  1E6J P;  4PWV B;  4PH0 A;  2KG9 A;  2K0D X;  2FHS C;  2E1M A;  1RNI A;  3CC4 P;  3G29 A;  2PEQ A;  4PH1 A;  2AF8 A;  2QA4 P;  2MVU A;  3GJN A;  3DS2 A;  1VQ5 P;  1K9M Q;  4HKG A;  2MY5 A;  1VQO P;  4PXH B;  3CCV P;  4BPF A;  1DNY A;  3NTE A; 
#chains in the Genus database with same CATH homology
 2MR8 A;  2CG5 B;  2LIW A;  3EJD A;  2CNR A;  2EHS A;  2FQ0 A;  2N5I A;  1HQB A;  2GDY A;  2N50 A;  4BPG A;  2X2B A;  2KGE A;  2AFD A;  2MF4 A;  2LPK A;  4R0M A;  2LIU A;  2K93 A;  4H2W C;  2FVA A;  2KR5 A;  2L22 A;  2CGQ A;  2K0X A;  2KG6 A;  2M5R A;  3NY7 B;  2L9F A;  1DV5 A;  1F80 D;  3CE7 A;  2JU1 A;  2N5H A;  5HVC A;  2K2Q A;  2JGP A;  2KG8 A;  2XZ0 D;  2N6Y A;  2K92 A;  2MR7 A;  2KOR A;  2FAD A;  5KP6 B;  2AVA A;  3EJE A;  1L0H A;  2LKI A;  3LMO A;  2CQ8 A;  2EHT A;  2JU2 A;  5EJD A;  2KGC A;  4IZ6 A;  1T8K A;  4H2X C;  1VKU A;  3EJB A;  4DG9 A;  5KP7 B;  2N98 A;  1KLP A;  2FQ1 A;  2GDX A;  2KOS A;  2L4B A;  3GZL A;  2QNW A;  4H2Y C;  2FAE A;  2KOQ A;  2KGD A;  2LOL A;  4BPH A;  5CZD B;  2MVV A;  3GZM A;  2LTE A;  1ACP A;  2MD9 A;  5KP8 B;  2LML A;  4PWV B;  2JQ4 A;  2DNW A;  2FAC A;  2KG9 A;  1AF8 A;  1HY8 A;  2N6Z A;  2FHS C;  2KOO A;  2XZ1 C;  2LL8 A;  4MRT C;  2AF8 A;  2PNG A;  2KWL A;  3RG2 A;  2MVU A;  4CA3 A;  2ROQ A;  1X3O A;  1NQ4 A;  2GDW A;  2L0Q A;  4HKG A;  2FQ2 A;  2MY5 A;  2FVF A;  2KGA A;  4NEO A;  4PXH B;  5HV8 A;  2KW2 A;  1OR5 A;  2KOP A;  2AFE A;  2K94 A;  2K0Y A;  1L0I A;  4BPF A;  2FVE A;  1DNY A;  2VSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...