1Z6MA

Structure of conserved protein of unknown function from enterococcus faecalis v583
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
175
structure length
175
Chain Sequence
SNAMDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELLAQSVKSGKVERIIKLFDKEKESLQRGNVMHHYIDYSAPEQALSALHKMFATQDEWGNLTLEEVATYAEKNLGLKEQKDATLVSAVIAEANAAHIQFVPTIIIGEYIFDESVTEEELRGYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a conserved hypothetical protein from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 57
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.90 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A DsbA-like domain 1z6mA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1z6mA01
1HYUA 5F07A 5D96A 1AXDA 5B7CA 3DWVA 4YQVA 2E2MA 1GUHA 4EUYA 3FW2A 1EZKA 3EE2A 4CHSA 1M2DA 4DSSB 1PKZA 3LSZA 5DALB 3L9SA 4GWRA 1AQXA 1TU8A 1GNWA 4ZBBA 5AN1A 2K9FA 2FGXA 2I81A 4EF0A 3IV4A 3TJKA 1YF1A 3VWXA 1WE0A 3TDGA 4F82A 1UC7A 1Z3EA 2ON5A 2VO4A 5GZZB 1U3IA 1EEMA 2YWMA 3K8NA 4HS1A 4HDEA 4KDUA 4CDOA 3QOUA 4BVXA 2VLVA 4F9ZA 5CNWA 2K18A 1HNBA 4I97A 1PL1A 4YH2A 2RM6A 4KUNA 14GSA 4FYUA 2OADA 5A4VA 2JSYA 3QFAC 2R4VA 2YZUA 5D9VA 2R3XA 4V2MA 2F3MA 3CTFA 2C0GA 1S3CA 2A2SA 4MZWA 3D22A 2GSSA 2B3SA 1PD21 2F51A 3N9JA 3G7IA 2WULA 5DVBA 4MF5A 19GSA 5D8IA 1O8XA 5FHIA 3NZNA 6GSWA 1OKDA 3TKRA 3FRCA 2H70A 5G5FA 2DLXA 2HYXA 2GDRA 5IMAA 2VCWA 5CRDA 2FUG2 1B9YC 3GRXA 1G0TA 7GSSA 1EOGA 2C3TA 1OC9B 4IJIA 5EY6A 4G2EA 3KH9A 2VIMA 1YEPA 4FIWA 3GFKA 2N5BA 3US3A 3EYTA 2OE1A 2OE3A 1WRYA 1DE2A 3HYPA 2NVLA 1OE7A 6GSSA 1X5CA 2LS5A 5JCGA 1K0BA 1J0FA 2Z9SA 1B4QA 2VL9A 4MA9A 4IELA 3IAM2 1AUCA 5JWOB 1Y6EA 3ZZXA 2GSQA 1EWXA 3LYKA 4K0GA 1RK4A 1JZWA 2IMIA 4ZB9A 5IMFA 3J7Yb 3H93A 3KM6A 3KEBA 3EURA 1HD2A 2KLXA 2JSZA 2HSHA 4K0NA 2P0GA 2REMA 3UARA 1AQWA 2PBJA 4JRRA 4HJMA 3FR9A 3FHKA 1GNEA 1ST9A 4MF6A 2MBSA 2EIRA 4AJ7A 3BCKA 4I6XA 3BBYA 1W89A 4Q5QA 3KP8A 2IMFA 1YZXA 4KNDA 4JU5A 1QXHA 1IYIA 1TKDB 1M9AA 4FO5A 2DIZA 1SL1B 2C1YA 3F3RA 3FZAA 4H86A 5F0GA 1VGLA 4XIHA 3VURA 4JEDA 1QK8A 4HI7A 2RUEA 3GSTA 3IHQA 2LUSA 1GUMA 2XBIA 2CZ3A 1TU7A 5ECOB 4GXZA 3VWUA 1TW9A 4K7IA 3FKFA 3TOUA 3C1RA 1Q4JA 4DVCA 2LRNA 1F3BA 2IJYA 5J41A 2L4CA 3IK9A 3PGTA 5L71A 1G6YA 2FD3A 1EOHA 2R5GA 1R26A 4KE3A 1ZZYA 2EIOA 3PH9A 4HJ2A 3A2VA 5D9XA 3ZIJA 4TR1A 2OKAA 2FWGA 1E6BA 2WDUA 2LV3A 2F9SA 3FEUA 2YPMA 2H0IA 3M1GA 2LNTA 2H1BA 3KCMA 1SYXA 4KW6A 5ENUA 2P5RA 3JCML 2HZFA 5KN1A 4WKWA 5IOWA 4IKHA 4J2FA 5ECIB 1TK5B 1JZOA 3U5RE 1XVWA 1XWAA 3A2XA 3SBCA 4G10A 1ZYQB 4TR4A 1A0RP 1Z6NA 5GSTA 4IS0A 3I43A 5E4WA 1X5DA 3LFLA 3GV1A 5C00A 5IQYA 1W4VA 1TP9A 1MD4A 2XC2A 4BPYA 2VM1A 3LXTA 4D73A 3ZYWA 4OWYA 3MDKA 5D93A 5J9CA 3HVSA 4MPGA 3M3MA 4JBBA 1AQVA 4N30A 3ZVJD 2LRCA 2V41A 3ME7A 1F3AA 5J5NA 5KEJA 4MP4A 2VOCA 1XWBA 4DSSA 3HA9A 5DAKB 5ELAA 5JWRB 1O7UA 2YJHA 1OE8A 2GQMA 3F8UA 2OBIA 4EL1A 1ACVA 3FZ5A 2R37A 3ZREA 1SL2B 2HRFA 1X5EA 4BWQA 4WBJA 2C3QA 3HJMA 4F2IA 1USBA 1XXUA 4TOPA 3UVHA 4N0ZA 2ZCTA 5AGYA 2LKUA 3LQ7A 2J9HA 4RI7A 4PURA 5FWGA 5CAXA 10GSA 3FY7A 4ACSA 3ZVJA 5CO3A 3ERFA 5ECQB 5CRGA 2FHEA 4RI6A 4MZBA 4ZL8A 4MJBA 1N2AA 2VL2C 4K9ZA 2PN8A 1XFLA 3AY8A 4IN0A 3QAWA 2ZUPA 3EMXA 4K7NA 2YCDA 1JFUA 1TI3A 3ZTLA 2CVBA 4HQSA 3F9UA 3GA4A 3J7Yk 1THOA 1JHBA 4XS6A 1UN2A 1V98A 18GSA 5EPFA 1YDKA 2C4JA 5AIVA 1SJZA 2MMZA 1R4WA 4WR5A 1YJ6A 1FVJA 2QSIA 2PGTA 4JR6A 1SKWB 4GSSA 2F8AA 4LL1B 3TKSC 3KGKA 4O92A 1OYJA 1K3LA 3MAKA 3UVTA 3D4MA 3GX0A 4TXVA 1EEJA 22GSA 5ECPB 3DVXA 3HHVA 2K8VA 1T00A 5ECNB 4ZIJA 2L4QA 2CZ2A 3UEMA 4BA7A 3C73A 2FY6A 4PNFA 9GSSA 3UAPA 4KSMA 4KDXA 4G19A 2C0FA 3GH6A 1MDJA 1FO5A 4IW9A 2ON7A 1K0NA 3F4TA 3I6AA 1BYEA 4MJEA 3PR8A 1A2JA 3CSIA 4ZL7A 1J08A 2OE0A 3R2QA 4WXTA 1PSQA 1K0CA 3I9V2 3IOSA 1XWGA 4ECJA 3ZFBA 3DMLA 4ZB6A 1ERWA 2IIYA 1A24A 3IE3A 4YAPA 2OJLA 2A4VA 1PX7A 5D73A 1XWKA 4NPBA 1YQ1A 3FZ9A 3GYKA 2FWHA 1SK2A 2H1AA 2CX3A 1RQMA 5HR0A 4N11A 1I5GA 4KCEA 1HNCA 2LJAA 2GSTA 1KNGA 2LSTA 13GSA 16GSA 1BEDA 2MMAA 2L59A 1GTUA 4IBPA 2GVPA 2X8CA 3GNJA 4ULXA 1GP1A 1Y25A 4NV5A 5F05A 2PU9C 1NHYA 4ZBDA 4TW5A 1O8WA 2L5OA 3APOA 3WYWA 1G7OA 5CRHA 4PNGA 1ERUA 2PVQA 3KTLA 1MDKA 4HUAA 1XW9A 3EC3A 3IXRA 1VRSD 1FOVA 2WJUA 1KBNA 1JLWA 1WP0A 3W8SA 4IJ3A 6GSVA 4ZBAA 2FCHA 17GSA 3M0FA 4K8MA 4F03A 1GL8A 5JWQB 3SWLA 2FNOA 2O89A 4KGIA 1UVZA 2TIRA 4MJCA 4V1Ap 5EVOA 1H75A 2IFQB 2V6KA 4XS1A 1QMVA 5HFIA 2N5AA 5B8AA 3QCPA 3H79A 4GQCA 4OMVA 3VI5A 4BWSA 1AAZA 2H0GA 1VF4A 3H1NA 3TJFA 2HZEB 2B7JA 4MABA 5HR3A 3ZFLA 2RM5A 2VCTA 1ZGNA 3RAZA 3TRXA 2YN1A 3TKPA 6GSTA 1ILOA 3RPPA 1Q98A 3E0UA 4FYBA 1FB0A 3A2WA 4EDZA 1J9BA 4EXJA 1FVKA 1GSFA 1R5PA 3CYNA 3HCZA 3A5WA 2LRTA 5JCUA 2LEGA 1M7TA 1GSUA 4WF5A 4YAVA 3G7JA 2I4AA 2E0QA 3FR6A 3LWAA 4MH3A 5CRWA 1Z6MA 2GZZA 4HU7A 2BJXA 4XCSA 2YOIA 3F3QA 6GSXA 1THXA 2ALBA 2ES7A 1JZDA 2CVKA 1TOFA 3KZQA 3NIVA 3C71A 3IPZA 3LG6A 1A23A 5GAPD 1LJRA 2ZNMA 3GHAA 2YP6A 4L8EA 5E59A 3UIWA 1K0AA 8GSSA 3DEXA 2JL4A 3TKQA 2E2GA 1PMTA 3KH7A 5ABRA 1AIUA 2JU5A 3IBHA 4PXOA 4ILFA 4RQXA 1T4ZA 3GL5A 1B8XA 3KD0A 1TRVA 4ML1A 2PPTA 3KP9A 3VWVA 1TXXA 2K6VA 3HJOA 4XRAA 2HXKA 3IK7A 5DQSA 4I2UA 4NHZA 1MD3A 3U6VA 1SJIA 3P90A 2VM2A 4IGJA 1AW9A 3P8WA 5HR1A 1I9DA 3VPTA 1X9SB 4OD7A 4LMWA 2O87A 1TDIA 1F37A 4HQZA 2JZRA 4TXOA 5H5SA 1ERVA 1YKAA 3BCIA 2B6MA 2IMDA 1UA5A 4L5OA 2FWFA 5D9WA 5IIZA 3UMAA 4OFMA 2MYGA 5B6NA 4L0UA 5G1KA 1F6MC 3NOFA 4KCAA 1OVNA 5D9TA 2PWJA 3ED3A 2V6OA 3Q74A 2YV7A 1K3YA 1N8JA 1EV4A 2GQLA 3MSZA 2DMMA 5ID2A 4HEA2 3F4SA 1K0OA 3Q18A 4NXIA 1C72A 2L5LA 2YV9A 2PUKC 1GTBA 2WB9A 4NHWA 2VCXA 2VLTA 3BD2A 3KIJA 4FH8A 1NM3A 2OBKA 3KXOA 4AGSA 1G6WA 4YQMA 3ME8A 3N5OA 1SU9A 2CV4A 3ERWA 2C8UA 4ZXGA 5HFGA 4K6XA 1YKCA 3WD6A 2PMTA 3D5JA 4MK3A 4MPFA 3S9FA 1SJ6A 1GLQA 2CVDA 2KP1A 5GSSA 3EINA 2FA8A 4WF4A 1Z5YE 2DJ1A 5IPHA 3HKRA 1T7PB 1XWCA 3VLNA 2P31A 3ZIVA 1DBYA 3CTGA 2YWIA 2MZCA 4KAEA 2DJKA 4V1Ag 1SYRA 1X9MB 5ECHB 4AF2A 2M72A 1GSQA 4PGTA 4TVEA 1GSEA 3FK8A 3MNGA 2DSAA 2TRXA 4TR1B 1WMJA 3TKSE 5H5RA 1DSBA 2GS3A 4ZL9A 4Q5FA 4N10A 2DIYA 3IAS2 2R2JA 1WIKA 5INYA 1XZOA 4XS4A 4JR4A 2VUPA 1B48A 1DE1A 1FHEA 2H6YA 1YY7A 3QAVA 2X99A 5J4UA 3LEFA 4V2LA 4ML6A 4TKYA 5IMVA 1YEXA 4KX4A 2LQQA 3C8EA 4KA0A 3TKSA 2X64A 1HNAA 3QFBC 4L0WA 4GF0A 1PA3A 1PRXA 2J23A 1O81A 3A3TA 3ISOA 2X8HA 4E8HA 3W8JA 5GAND 5AISA 1M9BA 3G7YA 2L6DA 1WPIA 1V2AA 1XW6A 1GTAA 5CREA 3I69A 4NV2A 5JCWA 2YWOA 2AJQB 3LJRA 4CW9A 1ZL9A 1MEKA 2G0FA 2GLRA 4BL7A 1FB6A 4XS4B 1GH2A 2IL3A 2RIIA 6GSYA 1QQ2A 4MMMA 4ECCA 3TB2A 2MMNA 2O8VB 2WRTA 4EDYA 2VCQA 5COHA 1A2MA 3GKKA 1BJXA 3TOTA 5F06A 1H4OA 5A4UA 4POLA 4JE1A 2VD0A 3H8QA 3CSHA 3F6FA 2D2ZA 2FA4A 3BOAA 5G5EA 4MF7A 5KN3A 2RLIA 1FG4A 4AJ6A 3GTUA 4ZB8A 3L4NA 2JACA 2H30A 2WZ9A 2L6CA 1WJKA 2FLSA 4XRDA 5IMZA 3O3TA 3KMOA 5ELGA 2A2RA 3CMIA 5H5QA 1XPVA 2GZYA 3IRAA 1O85A 2C0EA 1BAYA 4QL9A 4HU9A 4X43A 3DIEA 3TJBA 3ZMKA 1S3DA 4KH7A 2M80A 2YWNA 4JZQA 1XVQA 3GUSA 5G1LA 3M8NA 4LMVA 1M2BA 3M9JA 1GTIA 5EL8A 4OO5A 4F0CA 5HQPA 2H8LA 4XHMA 3IA1A 3KJYA 4LA1A 2H72A 2AYTA 1NW2A 1B9XC 1ML6A 5LCZA 2CAIA 3H4KA 2I3YA 3LXZA 5HR2A 1LBKA 3HD5A 4GQFA 1SK1A 3D0ZA 1V57A 3ERGA 1R7HA 2I1UA 5DBQA 1EP8A 5ECKB 2H6XA 1VF1A 4DSQA 4O5RA 1OC9A 3VK9A 2IN3A 2KHPA 2YZHA 3QDNA 3GIXA 1G7EA 5LD0A 4HZ2A 5G31A 5C04A 11GSA 4GTUA 1XCCA 1S3AA 1XIYA 2DJ0A 20GSA 3QR6A 3DVWA 2B5YA 2VD1A 5KN2A 4PQHA 3TJGA 3CBUA 2CA8A 3WGDA 2GGTA 2GZPA 1TRSA 3EU3A 2LQOA 3D6IA 2LJKA 4EE0A 3DRNA 4OFNA 2CAQA 2FWEA 1U6TA 3HXSA 3HZ8A 2YANA 3QD9A 3BJ5A 2HLSA 4HZ4A 2KOKA 4MLYA 2HNLA 1A0FA 3HVVA 2H19A 1QUWA 5J3RA 1EV9A 1TJDA 3E3EA 2H74A 3CRTA 2KP2A 1SKSB 1ZYEA 2XPEA 2N5FA 4POMA 4LLRA 5IM9A 1A8YA 2O85A 1PN9A 1WWJA 3GURA 1TI1A 1EGRA 4MCUA 1QGVA 3QAGA 1O6JA 2HFDA 4MZCA 1ZCPA 1T8EB 1GULA 1BX9A 3WT1A 2B7KA 3L0HA 4GLTA 1X9WB 1OC3A 3DXBA 3VWWA 1NHOA 5DJLA 2XPDA 3G9BA 2VL2A 2AUVA 4TXOB 2LTKA 2QKEA 3WGEA 4WBRD 4NWYA 3PINA 2XBQA 4IHUA 1T3BA 3GMFA 4KB3A 3ZITA 4DEJA 2NBSA 4K2DA 5DJMA 2MMOA 5F8BA 5ECLB 3VFIA 2WGRA 3P7XA 2AHEA 4DSRA 3HVXA 5CP1A 2NTOA 4XTSA 2M46A 3EU4A 4OCEA 4POKA 4EKZA 2JZTA 4I8BA 1RW1A 4P3YB 3F0IA 3KMNA 4OFTA 3QPMA 2IFQA 1TRUA 4OCFA 2H71A 2AAWA 4BVYA 3CXGA 1ABAA 2DBCA 1U87A 2H76A 1OKTA 3GSSA 2GQKA 3F63A 3CSJA 1PQNA 1FW1A 1GRXA 2WS2A 1OAZA 4GCIA 1XOBA 1VF3A 2AB6A 1SK0A 1QFNA 2X8GA 1F9MA 3GKMA 1V40A 3LGCA 3P2AA 5DCHA 1EGOA 2YNXA 4TRXA 1K0DA 4MJAA 3DD3A 4KDYA 2WFCA 4EO3A 1XBSA 1GSDA 2PVOC 1CQHA 1TK8B 4PUAA 2C80A 3TJJA 3WGXA 3W6GA 4QQ7A 3EWLA 4Q5NA 4GSTA 4X1UA 2B1KA 1M0UA 2XHFA 3KTBA 3E9JB 3ZMLA 5KN0A 2P5QA 4PQ1A 2BTOT 3V1WA 1Z7RA 1B4PA 2JADA 3FZ4A 2H66A 3Q6OA 2DJJA 4PX1A 4L5LA 1XW5A 2CT6A 3UBKA 4EVMA 2VCZA 1ZMAA 1SENA 4O7HA 2PERA 3RPNA 3MWHA 2TRCP 1A2LA 4GSNA 3WT2A 2HZEA 3ZL5A 4TR3A 1R5AA 5ID2B 5CYYA 4WR4A 2YJ7A 4ID0A 1SL0B 1ERTA 2H75A 2GT5A 3GKXA 3OR5A 3HJPA 3L9UA 3M9KA 3TCOA 4MDCA 5DDLA 1FAAA 5IMCA 3TUEA 1SKRB 1M2AA 2RUFA 3QMXA 1ZOFA 3EVIA 2HRNA 1T4YA 2GTUA 1GWCA 3UBLA 4NAXA 4TR0A 2LJRA 4OO4A 1M99A 4MH2A 2QC7A 5AIXA 3IDVA 1F2EA 1PKWA 3FR3A 4KSOA 3GKNA 2B5EA 1HQOA 2VL3A 2R6KA 2DC5A 4LL4B 1KEBA 1SD9A 3F6DA 5IOXA 3L78A 4NMUA 1O73A 1WOUA 5FT3A 3DYRA 3GL3A 2V32A 3APSA 2VLUA 3O6TA 1BQ7A 5A4WA 5IO2A 1GSYA 6GSUA 2HI7A 2WCIA 2B1LA 3GTUB 2V1MA 2NDOA 4IP6A 1PL2A 5DALA 2E7PA 2G2QA 4WEYA 5J9BA 2C3NA 3UL3A 4F0BA 2I9HA 4GRFA 1X0RA 2VAFA 1K3OA 1PX6A 1Z7PA 5LNKe 4K7OA 1MTCA 1V9WA 4IQAA 5DQYA 3C7MA 3APQA 1T1VA 2H0HA 4AJ8A 3D4TA 3CRUA 4EC0A 3O76A 1U88A 2QGVA 4ECIA 1YF0A 4K1FA 2GT6A 2HSYA 4YQUA 5ECSA 4ECBA 3L9VA 2AV4A 3IC4A 4N0VA 3ZRDA 1TRWA 1K0MA 2HT9A 3HY2A 1URMA 3GN3A 4FYCA 2JZSA 2HE3A 3IR4A 1V58A 4Q5RA 3ZLPA 1E2YA 5HFKA 4ISDA 1CQGA 2EIQA 3DGQA 3LYPA 1GSSA 5B6MA 3TRQA 5IO0A 5G2ZA 1VF2A 2H01A 3VPQA 1XOAA 5ECMB 2BMXA 4E8EA 2KUCA 4ZILA 3HDCA 3GX8A 1ON4A 3UJ1A 3UOMA 4Z7XA 1OC8A 1SD8A 4V2NA 5DAKA 2K8SA 5ECRB 1JZRA 4I2TA 2IMKA 3GH9A 1NSWA 2V2GA 2H6ZA 3F4RA 3Q19A 2LNSA 4PUFC 2IMEA 12GSA 2H1DA 2VCVA 2H73A 3FYGA 3LORA 3RBTA 3HZ4A 4D73B 4IP1A 1MDIA 4J57E 2O7KA 3DKSA 2C0DA 2H1GA 3D21A 4G9HA 1IYHA 4X0XA 4RUVA 2DJ2A 2NPBA 1TK0B 4IQ1A 1GUKA 3EMPA 2GSRA 4RQRA 4POBA 2OACA 1Z9HA 2EC4A 1BG5A 4HOJA 2CX4A 4I5QA 5IMDA 4WETA 2MBTA 3RHCA 3TGZA 5IPGA 1A8LA 2OA7A 1U3AA 1DUGA 5B8BA 2F8FA 4O32A 4IVFA 5G30A 2DMLA 1EP7A 3C1SA 2IWTA 3RDWA 4PQIA 1JLVA 3TRPA 4TN8A 2IPAA 3RHBA 1LU4A 1KTEA 2CQ9A 1GLPA 1AC1A 5A5KA 3VI7A 1TTZA 2DJ3A 4J56E 2B5XA 2L57A 1PGTA 5DCGA 4QL7A
chains in the Genus database with same CATH superfamily
2WPTA 1HYUA 5F07A 5D96A 1AXDA 5B7CA 3DWVA 4YQVA 2E2MA 1GUHA 4XFZA 5KP6B 2P9XA 4EUYA 3FW2A 4WYMA 1EZKA 3EE2A 4CHSA 1M2DA 4DSSB 1PKZA 3LSZA 5DALB 2N50A 3L9SA 4GWRA 2A4HA 1D1DA 1YIJP 1AQXA 1TU8A 1GNWA 4ZBBA 5AN1A 2K9FA 2FGXA 2I81A 4EF0A 3CCEP 3G6EP 3IV4A 3TJKA 2LL8A 1VQ9P 1YF1A 3VWXA 1AF8A 1WE0A 3TDGA 4F82A 1UC7A 1Z3EA 2GZJA 2ON5A 2VO4A 1U3IA 5GZZB 1EEMA 2YWMA 3K8NA 4HS1A 4HDEA 4KDUA 4CDOA 3QOUA 4BVXA 2VLVA 4F9ZA 5CNWA 1L0HA 2K18A 2LIWA 1HNBA 4I97A 1PL1A 4YH2A 2RM6A 4KUNA 1YJ9P 2N5HA 14GSA 4FYUA 2OADA 2QA2A 1M90Q 5A4VA 2XXMA 2JSYA 3QFAC 2R4VA 2YZUA 5F2NA 3DS5A 5D9VA 2R3XA 4V2MA 2F3MA 3CTFA 2C0GA 1S3CA 2A2SA 4MZWA 3D22A 2GSSA 2B3SA 1PD21 2F51A 3N9JA 3G7IA 1VQNP 3LRYA 2WULA 5DVBA 4MF5A 19GSA 5D8IA 4QKOA 1O8XA 5FHIA 3NZNA 2QEXP 6GSWA 1OKDA 3TKRA 3FRCA 2H70A 5G5FA 2DLXA 2HYXA 2GDRA 5IMAA 2VCWA 5CRDA 1VQMP 2FUG2 1B9YC 2LKIA 3GRXA 2FAEA 1G0TA 7GSSA 1EOGA 2C3TA 1OC9B 4IJIA 5EY6A 4G2EA 3KH9A 2VIMA 1YEPA 4FIWA 3GFKA 2N5BA 3US3A 3EYTA 2OE1A 2QA1A 2OE3A 1WRYA 1DE2A 3HYPA 2NVLA 1OE7A 6GSSA 1X5CA 2LS5A 5JCGA 1K0BA 2K2QA 2EIAA 3DS4A 1J0FA 2X4AA 2Z9SA 1B4QA 2VL9A 4MA9A 4IELA 3IAM2 3G1GA 1AUCA 5JWOB 2M8NA 1Y6EA 4H2WC 3ZZXA 2GSQA 2EHSA 1EWXA 3LYKA 4K0GA 1RK4A 1JZWA 2IMIA 4ZB9A 5IMFA 3J7Yb 3H93A 2OTJP 3KM6A 2EFJA 3EURA 1HD2A 2KLXA 3KEBA 1IMQA 3B4QA 2JSZA 2HSHA 4K0NA 2P0GA 1Q7YQ 2REMA 4NEOA 3UARA 1AQWA 4CY8A 2PBJA 4JRRA 4HJMA 2VLPA 3FR9A 3FHKA 3IHGA 1KQSO 1GNEA 1ST9A 4MF6A 2MBSA 2EIRA 4AJ7A 3BCKA 4BPFA 4I6XA 3BBYA 1A43A 1W89A 4Q5QA 2EHTA 3KP8A 2MVUA 2IMFA 1YZXA 1HQBA 4KNDA 4JU5A 1QXHA 1IYIA 1TKDB 1M9AA 4FO5A 2DIZA 1SL1B 3GZLA 3OW2O 2C1YA 3F3RA 3FZAA 2GDYA 2KODA 4H86A 5F0GA 3H0DA 1ACPA 1VGLA 4XIHA 3VURA 4JEDA 3G1IA 1QK8A 5CZDB 4HI7A 2RUEA 4EIQA 3CCJP 3GSTA 3H4EA 3IHQA 2LUSA 1GUMA 2XBIA 2DNWA 2CZ3A 1TU7A 5ECOB 4GXZA 2K0XA 3VWUA 1TW9A 4K7IA 3FKFA 3TOUA 3C1RA 1K8AQ 2JO0A 1Q4JA 4DVCA 2LRNA 1F3BA 2IJYA 5J41A 2FVFA 1DNYA 2L4CA 3IK9A 3PGTA 5L71A 1G6YA 2FD3A 1EOHA 2R5GA 1R26A 4KE3A 2A2PA 1ZZYA 2EIOA 3PH9A 4HJ2A 2GDXA 3A2VA 5D9XA 3ZIJA 4TR1A 3DS3A 2OKAA 3CCMP 2FWGA 1E6BA 2WDUA 2LV3A 4XRQA 2LTEA 2F9SA 3FEUA 2YPMA 2H0IA 3M1GA 4G0KA 2LNTA 2H1BA 3KCMA 1SYXA 3A5IA 3CMAP 4KW6A 5ENUA 4PH1A 2P5RA 3IC8A 3JCML 2HZFA 5KN1A 4WKWA 5IOWA 4U0EA 4IKHA 4J2FA 5ECIB 1TK5B 1JZOA 1VQLP 3U5RE 5I4TG 1XVWA 1XWAA 7CEIA 3A2XA 1BXIA 4G10A 3SBCA 4TR4A 1ZYQB 1A0RP 1Z6NA 5GSTA 4IS0A 3I43A 5E4WA 2N5IA 1X5DA 2JBGA 4MNNA 3LFLA 2R0GA 3GV1A 5C00A 5IQYA 2R0CA 1W4VA 1TP9A 1MD4A 2XC2A 2K0YA 4BPYA 2FQ1A 2VM1A 3LXTA 4D73A 3ZYWA 4OWYA 3MDKA 5D93A 5J9CA 3HVSA 4MPGA 3M3MA 4JBBA 1AQVA 4N30A 3ZVJD 2LRCA 2V41A 3ME7A 1F3AA 5J5NA 5KEJA 4MP4A 2VOCA 1XWBA 4DSSA 3HA9A 5DAKB 5ELAA 5JWRB 2BUOA 1O7UA 2YJHA 1OE8A 2GQMA 3NTEA 3F8UA 2OBIA 2N6ZA 4EL1A 1BAJA 1ACVA 3FZ5A 1GPJA 2R37A 2AF8A 4XROA 3ZREA 1SL2B 2HRFA 1X5EA 4BWQA 4WBJA 1KD1Q 2C3QA 3HJMA 4F2IA 1ZNVA 1USBA 2MF4A 1XXUA 4TOPA 3UVHA 2ZCTA 4N0ZA 5AGYA 2LKUA 3LQ7A 2J9HA 4RI7A 4PURA 5FWGA 5CAXA 10GSA 3FY7A 3I56P 4ACSA 3ZVJA 5CO3A 3ERFA 5ECQB 5CRGA 2FHEA 4RI6A 4MZBA 4ZL8A 4MJBA 1N2AA 2VL2C 4K9ZA 2PN8A 1XFLA 3AY8A 4IN0A 3QAWA 1KC8Q 2ZUPA 3EMXA 4K7NA 2Z44A 2YCDA 1JFUA 1TI3A 3ZTLA 2CVBA 4HQSA 3F9UA 3GA4A 3J7Yk 1THOA 1JHBA 1A8OA 2KOPA 1VQ6P 4XS6A 1UN2A 3MGEA 1V98A 18GSA 4KF9A 2L9FA 2L0QA 5EPFA 1YDKA 2C4JA 5AIVA 1SJZA 2MMZA 1R4WA 1VQ5P 4WR5A 2HRAA 1YJ6A 2R0PA 1FVJA 2QSIA 2PGTA 4JR6A 1SKWB 4GSSA 2KG6A 2F8AA 4LL1B 3TKSC 4COCA 3KGKA 1M74A 4O92A 1OYJA 1K3LA 3MAKA 3UVTA 3FMWA 3D4MA 3GX0A 4TXVA 1EEJA 22GSA 5ECPB 2X2BA 3DVXA 3HHVA 2JAZA 3EJEA 2K8VA 1T00A 5ECNB 4ZIJA 2L4QA 2CZ2A 2CG5B 3UEMA 2PY8A 4BA7A 3C73A 2FY6A 4PNFA 4PH0A 9GSSA 2GZFA 3UAPA 1UNKA 4KSMA 4KDXA 4G19A 2C0FA 2KOOA 3GH6A 1MDJA 1FO5A 4IW9A 2ON7A 1K0NA 3F4TA 3I6AA 1BYEA 4MJEA 3PR8A 1A2JA 3CSIA 4ZL7A 1J08A 2OE0A 3Q20A 3R2QA 1GXHA 4WXTA 1PSQA 1K0CA 3I9V2 3IOSA 1XWGA 4ECJA 3ZFBA 3DMLA 4ZB6A 1ERWA 2IIYA 1A24A 3IE3A 4YAPA 2OJLA 2A4VA 1PX7A 4PXHB 4K5SA 5D73A 1XWKA 3U43A 4NPBA 1YQ1A 3FZ9A 3GYKA 2FWHA 1SK2A 2H1AA 1M1KQ 2CX3A 1RQMA 5HR0A 4N11A 1VQOP 1I5GA 4KCEA 1HNCA 2LJAA 2GSTA 1KNGA 2XZ0D 2LSTA 13GSA 4U0DA 16GSA 1BEDA 2MMAA 2L59A 1GTUA 4IBPA 2GVPA 2X8CA 3GNJA 4ULXA 3EJDA 1GP1A 1Y25A 4NV5A 5F05A 2PU9C 4O5QA 1NHYA 4ZBDA 4TW5A 1O8WA 2L5OA 2AFDA 3APOA 3WYWA 2MR8A 1G7OA 5CRHA 4PNGA 4U0FA 1ERUA 2PVQA 3KTLA 1MDKA 2LOLA 4HUAA 3MYDA 1XW9A 5JPAA 3EC3A 3IXRA 3CCVP 1VQ8P 3DS1A 2PNGA 2KG8A 1VRSD 1FOVA 2WJUA 1KBNA 1JLWA 1WP0A 3W8SA 1OR5A 4IJ3A 6GSVA 4ZBAA 2FCHA 17GSA 3M0FA 1Q86Q 4K8MA 4F03A 2KORA 1GL8A 2Z45A 5JWQB 3SWLA 2FNOA 2O89A 4KGIA 1UVZA 2TIRA 4MJCA 4V1Ap 5EVOA 1H75A 2IFQB 3I55P 2V6KA 2KOSA 2JYLA 4U0AA 4XS1A 1QMVA 5HFIA 2NO8A 1Q82Q 2N5AA 5B8AA 1KLPA 4GQCA 3H79A 3QCPA 4OMVA 5HGNA 2GZEA 3VI5A 1S72P 4BWSA 1AAZA 2H0GA 1VF4A 3H1NA 1GXGA 3G26A 3TJFA 1L0IA 2HZEB 2B7JA 4MABA 5HR3A 1RO2A 2GYKA 3ZFLA 2RM5A 2VCTA 1ZGNA 4PWVB 2DKIA 4QNBA 3RAZA 4DG9A 3TRXA 2YN1A 3TKPA 6GSTA 1ILOA 3RPPA 1Q98A 3E0UA 4FYBA 3G4SP 1FB0A 3A2WA 4EDZA 1J9BA 4EXJA 1FVKA 1GSFA 1R5PA 3CYNA 3HCZA 2MY5A 3A5WA 4R0MA 3DS2A 2N98A 2LRTA 5JCUA 2LEGA 1M7TA 2M5RA 2MVVA 1GSUA 4WF5A 4YAVA 3G7JA 4UHPB 2I4AA 3DS0A 1ZMBA 2E0QA 3FR6A 3LWAA 4MH3A 5CRWA 1Z6MA 2GZZA 4HU7A 2BJXA 4XCSA 2YOIA 3F3QA 6GSXA 1THXA 2ALBA 2ES7A 1JZDA 2CVKA 1TOFA 3KZQA 3NIVA 4Z2RA 3C71A 3IPZA 4H2YC 3CC4P 3LG6A 1A23A 5GAPD 4PTSA 1LJRA 2ZNMA 3GHAA 2YP6A 4L8EA 5E59A 3UIWA 1K0AA 8GSSA 3DEXA 2JL4A 3TKQA 2E2GA 1PMTA 3KH7A 5ABRA 1AIUA 2JU5A 1ZYNA 2E1MA 3IBHA 1QVFO 2LMLA 4PXOA 4ILFA 4RQXA 1T4ZA 3GL5A 2KOQA 1B8XA 3KD0A 1TRVA 4ML1A 1NQ4A 2PPTA 3KP9A 3VWVA 1TXXA 2K6VA 3HJOA 4XRAA 1N8RQ 1EOQA 2HXKA 3IK7A 5BS2A 5DQSA 3GKLC 4I2UA 4NHZA 1MD3A 2LF4A 3U6VA 1IMPA 1SJIA 3P90A 4CY6A 3CXCO 2VM2A 4IGJA 1AW9A 3P8WA 5HVCA 5HR1A 1I9DA 3VPTA 2OTLP 1X9SB 4OD7A 2FQ2A 4LMWA 1VQPP 2L4BA 2O87A 1TDIA 1F37A 4HQZA 2K94A 2JZRA 4TXOA 5H5SA 1ERVA 2FACA 1YKAA 3BCIA 2B6MA 2IMDA 1UA5A 4L5OA 4BL7B 2FQ0A 2FWFA 5D9WA 5IIZA 3UMAA 4OFMA 2MYGA 5B6NA 3HVNA 4L0UA 2FVEA 5G1KA 1F6MC 3NOFA 4KCAA 1OVNA 2HRKA 2XV6A 5D9TA 2PWJA 3ED3A 5BMUA 2V6OA 3Q74A 2YV7A 1K3YA 1N8JA 1EV4A 2GQLA 3MSZA 2DMMA 5ID2A 4HEA2 4XFXA 2L22A 3F4SA 1K0OA 2K92A 3Q18A 4NXIA 1C72A 5F2OA 3E2DA 2L5LA 5KP7B 1EMVA 2YV9A 2PUKC 1GTBA 2WB9A 1NJIQ 4NHWA 2VCXA 1QRJA 2VLTA 3BD2A 3KIJA 4FH8A 1NM3A 4IPYA 3G0VA 2OBKA 3KXOA 4AGSA 1G6WA 2PEMA 4YQMA 4Z2UA 3ME8A 3N5OA 1SU9A 2CV4A 3B5IA 3ERWA 2C8UA 4ZXGA 4K6XA 5HFGA 1YKCA 3WD6A 2PMTA 4YKGA 3D5JA 1ZYPA 1M6NA 3LMOA 1CEIA 4MK3A 4MPFA 3S9FA 1SJ6A 1GLQA 2CVDA 2KP1A 4BVXB 5GSSA 3EINA 3G21A 2PEQA 2FA8A 1Z5YE 2DJ1A 4WF4A 5IPHA 3HKRA 1T7PB 1K73Q 1XWCA 3VLNA 2P31A 3ZIVA 1W2BO 1DBYA 3CTGA 2KR5A 1YI2P 2YWIA 2MZCA 4KAEA 2DJKA 4V1Ag 1SYRA 1X9MB 5ECHB 4AF2A 3MIXA 2M72A 1GSQA 4PGTA 4TVEA 1GSEA 3FK8A 3MNGA 2DSAA 3CCLP 2TRXA 4TR1B 1WMJA 3TKSE 5H5RA 1DSBA 2GS3A 4ZL9A 4Q5FA 4N10A 2DIYA 3IAS2 2R2JA 3GZMA 1WIKA 5INYA 1XZOA 3G28A 1IUQA 4XS4A 3M1MA 4JR4A 2VUPA 1B48A 1DE1A 1FHEA 2H6YA 1PFOA 1YY7A 3QAVA 2X99A 5J4UA 3LEFA 4BVYB 2LPKA 4V2LA 4ML6A 1X3OA 4TKYA 2N6YA 5IMVA 1YEXA 4KX4A 2LQQA 3C8EA 4KA0A 3TKSA 2X64A 1HNAA 3QFBC 4L0WA 4M0IA 4GF0A 2AFEA 1PA3A 1PRXA 2J23A 1FR2A 2XT1A 1O81A 3A3TA 3ISOA 2X8HA 1QVGO 4E8HA 3W8JA 2ONTA 5GAND 5AISA 1M9BA 3G7YA 2L6DA 1WPIA 1V2AA 2M8PA 1XW6A 1GTAA 1VQ4P 5CREA 3I69A 4NV2A 5JCWA 2YWOA 3RG6C 2AJQB 3LJRA 4CW9A 1ZL9A 1MEKA 2G0FA 3H47A 2GLRA 4BL7A 1FB6A 4XS4B 1GH2A 2IL3A 4K5RA 2RIIA 4BPGA 6GSYA 1QQ2A 5EW5E 4MMMA 2K5XA 3P05A 4ECCA 1DV5A 3TB2A 2ERHA 2MMNA 5F2KA 2O8VB 2WRTA 5HGMA 4EDYA 2VCQA 5COHA 1A2MA 3GKKA 1BJXA 3TOTA 5F06A 1H4OA 5A4UA 4POLA 4JE1A 2VD0A 3H8QA 3CSHA 3F6FA 2D2ZA 2GDWA 5HGLA 1M3IA 2FA4A 3BOAA 4MF7A 5G5EA 5KN3A 2RLIA 1FG4A 4AJ6A 3GTUA 4ZB8A 3L4NA 2JACA 2H30A 2WZ9A 1K30A 2L6CA 1WJKA 2FLSA 4XRDA 5IMZA 3O3TA 3KMOA 5ELGA 2A2RA 3CE7A 3CMIA 5H5QA 1XPVA 2GZYA 3IRAA 1O85A 1E0HA 2C0EA 1BAYA 4QL9A 4HU9A 4X43A 3DIEA 3TJBA 3ZMKA 1S3DA 4KH7A 2M80A 2YWNA 4JZQA 1XVQA 3GUSA 4USSA 5G1LA 3M8NA 4LMVA 1M2BA 2M8LA 4MRTC 3M9JA 1GTIA 5EL8A 4OO5A 3CC7P 4F0CA 2BHVA 5HQPA 5KP8B 2H8LA 4XHMA 3IA1A 3KJYA 4LA1A 2H72A 2AYTA 1NW2A 2MR7A 4FQUA 1B9XC 1ML6A 5LCZA 2CAIA 3H4KA 2I3YA 2CGQA 3LXZA 5HR2A 1LBKA 3HD5A 3EJBA 3CD6P 4GQFA 1SK1A 3CQFA 1VQ7P 3D0ZA 1RO0A 1V57A 3ERGA 1R7HA 2I1UA 5DBQA 1EP8A 5ECKB 2H6XA 2DGYA 3LW9A 1VF1A 4DSQA 3GJNA 2CWOA 4O5RA 1OC9A 2IN3A 3VK9A 2LIUA 4XFYA 2KHPA 2YZHA 3QDNA 3CMEP 3GIXA 1G7EA 5LD0A 4HZ2A 5G31A 4BIKA 2PEJA 5C04A 11GSA 4GTUA 1XCCA 1S3AA 1XIYA 2DJ0A 20GSA 3QR6A 3DVWA 2B5YA 4U0CA 2VD1A 5KN2A 4PQHA 1XG8A 3TJGA 3EPTA 3CBUA 2CA8A 3WGDA 2GGTA 2QNWA 2GZPA 1TRSA 3EU3A 5DCKA 2LQOA 2CNRA 3D6IA 1VQKP 2LJKA 4EE0A 3DRNA 4OFNA 2CAQA 2KW2A 2FWEA 1U6TA 3HXSA 2ROQA 1VKUA 2YANA 3HZ8A 3QD9A 2JU2A 3BJ5A 2HLSA 4HZ4A 2KOKA 1K9MQ 4MLYA 2HNLA 1A0FA 3HVVA 2H19A 1QUWA 5J3RA 1EV9A 1TJDA 3E3EA 4IZ6A 2H74A 3CRTA 1HY8A 2KP2A 3RG2A 1SKSB 1ZYEA 2XPEA 2N5FA 4POMA 4LLRA 5IM9A 1A8YA 2O85A 1PN9A 1WWJA 3GURA 1TI1A 1EGRA 4MCUA 1QGVA 3QAGA 1O6JA 2HFDA 3G29A 4G0IA 4MZCA 1F80D 1ZCPA 1T8EB 1GULA 1BX9A 1AUMA 3WT1A 1YJWP 1M6EX 2B7KA 3L0HA 4GLTA 1X9WB 3HZQA 1OC3A 2KG9A 3CC2P 3DXBA 3VWWA 4F37A 1NHOA 4O5UA 1VHNA 2K93A 5DJLA 1UJZA 2XPDA 3G9BA 4CA3A 2AUVA 2VL2A 4TXOB 2LTKA 2QKEA 3WGEA 4WBRD 4NWYA 3PINA 2XBQA 4IHUA 1T3BA 2KWLA 3GMFA 4KB3A 2JYGA 3ZITA 4ICYA 4DEJA 2NBSA 4K2DA 5DJMA 2MMOA 5F8BA 5ECLB 3VFIA 2PENA 2WGRA 3P7XA 2AHEA 4DSRA 3HVXA 4XTSA 2NTOA 5CP1A 2M46A 4G0LA 3EU4A 4OCEA 4POKA 4EKZA 2JZTA 4I8BA 1RW1A 2VLNA 4P3YB 3F0IA 3KMNA 4OFTA 3QPMA 2IFQA 1TRUA 4OCFA 2H71A 2AAWA 4BVYA 3CXGA 1ABAA 2DBCA 2JQ4A 2FVAA 1U87A 1T8KA 2H76A 1OKTA 3GSSA 2GQKA 3F63A 3CSJA 1PQNA 1FW1A 1GRXA 2WS2A 1OAZA 4GCIA 1XOBA 1VF3A 2AB6A 1SK0A 1QFNA 1YJNP 2X8GA 1F9MA 3GKMA 1V40A 3LGCA 3P2AA 5DCHA 4H2XC 1EGOA 2YNXA 4TRXA 1K0DA 4MJAA 3DD3A 2AVAA 4EIPA 4KDYA 2WFCA 4EO3A 1XBSA 5HV8A 1GSDA 2PVOC 1CQHA 1TK8B 4PUAA 2C80A 3TJJA 3WGXA 3CPWO 3W6GA 2OARA 4QQ7A 3EWLA 4COPA 3CCQP 2JGPA 4Q5NA 4GSTA 4X1UA 4GR2A 2GZGA 1M0UA 2B1KA 2XHFA 3KTBA 3E9JB 3ZMLA 5BRTA 5KN0A 2GZIA 1S3RA 2P5QA 4PQ1A 2BTOT 3V1WA 1Z7RA 1B4PA 2JADA 3CCSP 3FZ4A 2K0DX 2H66A 3Q6OA 2DJJA 4PX1A 4L5LA 1YITP 1XW5A 2CT6A 3UBKA 2KGCA 4EVMA 2VCZA 5KOXA 1ZMAA 1SENA 4O7HA 2PERA 3RPNA 3MWHA 2QA4P 1E6JP 2TRCP 1A2LA 4GSNA 3WT2A 3VRLC 2HZEA 3ZL5A 4TR3A 1R5AA 5ID2B 5CYYA 4WR4A 2YJ7A 4ID0A 1SL0B 1ERTA 2H75A 2GT5A 3GKXA 3OR5A 3HJPA 3L9UA 3M9KA 3TCOA 4MDCA 5DDLA 2VLOA 4BPHA 1FAAA 3R3EA 5IMCA 3TUEA 1SKRB 5KOWA 1M2AA 2RUFA 3QMXA 2KGEA 1ZOFA 3EVIA 2HRNA 1T4YA 2GTUA 1GWCA 3UBLA 4NAXA 4TR0A 2VLQA 2LJRA 4OO4A 1M99A 4MH2A 2QC7A 5AIXA 3IDVA 1F2EA 1PKWA 3FR3A 1M3JA 4KSOA 3GKNA 3PPUA 2B5EA 1HQOA 2VL3A 2R6KA 2DC5A 4HSCX 4LL4B 1KEBA 3DTJA 1SD9A 3F6DA 5IOXA 3L78A 2JU1A 4NMUA 1O73A 1WOUA 5FT3A 3DYRA 3GL3A 2V32A 3APSA 2VLUA 3O6TA 1BQ7A 5A4WA 5IO2A 1GSYA 6GSUA 2HI7A 2PEIA 2WCIA 2B1LA 2EG5A 3GTUB 2V1MA 2NDOA 4IP6A 2FADA 1PL2A 5DALA 2E7PA 2G2QA 4WEYA 5J9BA 2L6EA 2C3NA 3UL3A 4F0BA 2I9HA 4GRFA 1X0RA 2VAFA 2X49A 1K3OA 1PX6A 1Z7PA 5LNKe 4K7OA 1MTCA 3CCRP 1V9WA 4IQAA 2KGDA 5DQYA 3C7MA 4HKGA 3APQA 1T1VA 2UZ8A 2H0HA 4AJ8A 3D4TA 3CRUA 4EC0A 3O76A 1U88A 2QGVA 4A5PA 4ECIA 1YF0A 4K1FA 2GT6A 2HSYA 4YQUA 5ECSA 2MD9A 4Z2TA 4ECBA 3L9VA 3G71P 1FOHA 3CCUP 2AV4A 3IC4A 4N0VA 1MZ8A 3ZRDA 1TRWA 1K0MA 1PN0A 2HT9A 3HY2A 1URMA 3GN3A 2PEOA 4FYCA 2JZSA 2HE3A 2Z46A 3IR4A 1V58A 4Q5RA 3ZLPA 1E2YA 5HFKA 4ISDA 1CQGA 2EIQA 3DGQA 3LYPA 1GSSA 5B6MA 2HSMA 3TRQA 5EJDA 2KGAA 5IO0A 5G2ZA 1VF2A 2H01A 3VPQA 1XOAA 4U0BA 1AYIA 2BMXA 5ECMB 4E8EA 2KUCA 4ZILA 3HDCA 3GX8A 3WBHA 1ON4A 4Z7XA 3UJ1A 3UOMA 1OC8A 1SD8A 4V2NA 5DAKA 1YHQP 2K8SA 5ECRB 1JZRA 4I2TA 2IMKA 3GH9A 1NSWA 2V2GA 2H6ZA 3F4RA 3Q19A 2LNSA 4PUFC 2IMEA 12GSA 2H1DA 2VCVA 2H73A 3FYGA 3LORA 5BS1A 5HGOA 3RBTA 3HZ4A 3DPHA 4D73B 1JJ2O 4IP1A 1MDIA 1EIAA 4X4JA 4J57E 2O7KA 3DKSA 2C0DA 2H1GA 3D21A 4GR6A 4G9HA 1IYHA 4X0XA 4RUVA 2CQ8A 2DJ2A 2NPBA 1TK0B 4IQ1A 1GUKA 2FHSC 3EMPA 3NY7B 2GSRA 4RQRA 4POBA 2OACA 1Z9HA 2EC4A 1BG5A 4HOJA 2CX4A 4I5QA 5IMDA 4WETA 2MBTA 3RHCA 3TGZA 4YKFA 2XZ1C 5IPGA 1A8LA 2OA7A 1U3AA 2DKHA 1DUGA 5B8BA 2F8FA 4O32A 1Q81Q 4IVFA 5G30A 2DMLA 1EP7A 1RNIA 3C1SA 2IWTA 3RDWA 4PQIA 1JLVA 3TRPA 3HYBA 4TN8A 2IPAA 3RHBA 1LU4A 1KTEA 2CQ9A 1GLPA 1AC1A 5A5KA 3VI7A 2PEKA 1TTZA 2DJ3A 4J56E 2B5XA 2L57A 1PGTA 5DCGA 4QL7A 2JB0A 2VSQA 4K2XA
chains in the Genus database with same CATH topology
1HYUA 5F07A 5D96A 1AXDA 5B7CA 3DWVA 4YQVA 2E2MA 1GUHA 4EUYA 3FW2A 1EZKA 3EE2A 4CHSA 1M2DA 4DSSB 1PKZA 3LSZA 5DALB 3L9SA 4GWRA 2A4HA 1AQXA 1TU8A 1GNWA 4ZBBA 5AN1A 2K9FA 2FGXA 2I81A 4EF0A 3IV4A 3TJKA 1YF1A 3VWXA 1WE0A 3TDGA 4F82A 1UC7A 1Z3EA 2ON5A 2VO4A 5GZZB 1U3IA 1EEMA 2YWMA 3K8NA 4HS1A 4HDEA 4KDUA 4CDOA 3QOUA 4BVXA 2VLVA 4F9ZA 5CNWA 2K18A 1HNBA 4I97A 1PL1A 4YH2A 2RM6A 4KUNA 14GSA 4FYUA 2OADA 2QA2A 5A4VA 2JSYA 3QFAC 2R4VA 2YZUA 5D9VA 2R3XA 4V2MA 2F3MA 3CTFA 2C0GA 1S3CA 2A2SA 4MZWA 3D22A 2GSSA 2B3SA 1PD21 2F51A 3N9JA 3G7IA 2WULA 5DVBA 4MF5A 19GSA 5D8IA 1O8XA 5FHIA 3NZNA 6GSWA 1OKDA 3TKRA 3FRCA 2H70A 5G5FA 2DLXA 2HYXA 2GDRA 5IMAA 2VCWA 5CRDA 2FUG2 1B9YC 3GRXA 1G0TA 7GSSA 1EOGA 2C3TA 1OC9B 4IJIA 5EY6A 4G2EA 3KH9A 2VIMA 1YEPA 4FIWA 3GFKA 2N5BA 3US3A 3EYTA 2OE1A 2QA1A 2OE3A 1WRYA 1DE2A 3HYPA 2NVLA 1OE7A 6GSSA 1X5CA 2LS5A 5JCGA 1K0BA 1J0FA 2X4AA 2Z9SA 1B4QA 2VL9A 4MA9A 4IELA 3IAM2 1AUCA 5JWOB 1Y6EA 3ZZXA 2GSQA 1EWXA 3LYKA 4K0GA 1RK4A 1JZWA 2IMIA 4ZB9A 5IMFA 3J7Yb 3H93A 3KM6A 3KEBA 3EURA 1HD2A 2KLXA 2JSZA 2HSHA 4K0NA 2P0GA 2REMA 3UARA 1AQWA 4CY8A 2PBJA 4JRRA 4HJMA 3FR9A 3FHKA 3IHGA 1GNEA 1ST9A 4MF6A 2MBSA 2EIRA 4AJ7A 3BCKA 4I6XA 3BBYA 1W89A 4Q5QA 3KP8A 2IMFA 1YZXA 4KNDA 4JU5A 1QXHA 1IYIA 1TKDB 1M9AA 4FO5A 2DIZA 1SL1B 2C1YA 3F3RA 3FZAA 4H86A 5F0GA 1VGLA 4XIHA 3VURA 4JEDA 1QK8A 4HI7A 2RUEA 4EIQA 3GSTA 3IHQA 2LUSA 1GUMA 2XBIA 2CZ3A 1TU7A 5ECOB 4GXZA 3VWUA 1TW9A 4K7IA 3FKFA 3TOUA 3C1RA 1Q4JA 4DVCA 2LRNA 1F3BA 2IJYA 5J41A 2L4CA 3IK9A 3PGTA 5L71A 1G6YA 2FD3A 1EOHA 2R5GA 1R26A 4KE3A 2A2PA 1ZZYA 2EIOA 3PH9A 4HJ2A 3A2VA 5D9XA 3ZIJA 4TR1A 2OKAA 2FWGA 1E6BA 2WDUA 2LV3A 2F9SA 3FEUA 2YPMA 2H0IA 3M1GA 4G0KA 2LNTA 2H1BA 3KCMA 1SYXA 3A5IA 4KW6A 5ENUA 2P5RA 3JCML 3IC8A 2HZFA 5KN1A 4WKWA 5IOWA 4IKHA 4J2FA 5ECIB 1TK5B 1JZOA 3U5RE 1XVWA 1XWAA 3A2XA 3SBCA 4G10A 1ZYQB 4TR4A 1A0RP 1Z6NA 5GSTA 4IS0A 3I43A 5E4WA 1X5DA 4MNNA 3LFLA 2R0GA 3GV1A 5C00A 5IQYA 2R0CA 1W4VA 1TP9A 1MD4A 2XC2A 4BPYA 2VM1A 3LXTA 4D73A 3ZYWA 4OWYA 3MDKA 5D93A 5J9CA 3HVSA 4MPGA 3M3MA 4JBBA 1AQVA 4N30A 3ZVJD 2LRCA 2V41A 3ME7A 1F3AA 5J5NA 5KEJA 4MP4A 2VOCA 1XWBA 4DSSA 3HA9A 5DAKB 5ELAA 5JWRB 1O7UA 2YJHA 1OE8A 2GQMA 3F8UA 2OBIA 4EL1A 1ACVA 3FZ5A 2R37A 3ZREA 1SL2B 2HRFA 1X5EA 4BWQA 4WBJA 2C3QA 3HJMA 4F2IA 1USBA 1XXUA 4TOPA 3UVHA 4N0ZA 2ZCTA 5AGYA 2LKUA 3LQ7A 2J9HA 4RI7A 4PURA 5FWGA 5CAXA 10GSA 3FY7A 4ACSA 3ZVJA 5CO3A 3ERFA 5ECQB 5CRGA 2FHEA 4RI6A 4MZBA 4ZL8A 4MJBA 1N2AA 2VL2C 4K9ZA 2PN8A 1XFLA 3AY8A 4IN0A 3QAWA 2ZUPA 3EMXA 4K7NA 2YCDA 1JFUA 1TI3A 3ZTLA 2CVBA 4HQSA 3F9UA 3GA4A 3J7Yk 1THOA 1JHBA 4XS6A 1UN2A 1V98A 18GSA 4KF9A 5EPFA 1YDKA 2C4JA 5AIVA 1SJZA 2MMZA 1R4WA 4WR5A 2HRAA 1YJ6A 2R0PA 1FVJA 2QSIA 2PGTA 4JR6A 1SKWB 4GSSA 2F8AA 4LL1B 3TKSC 3KGKA 4O92A 1OYJA 1K3LA 3MAKA 3UVTA 3FMWA 3D4MA 3GX0A 4TXVA 1EEJA 22GSA 5ECPB 3DVXA 3HHVA 2K8VA 1T00A 5ECNB 4ZIJA 2L4QA 2CZ2A 3UEMA 4BA7A 3C73A 2FY6A 4PNFA 9GSSA 3UAPA 4KSMA 4KDXA 4G19A 2C0FA 3GH6A 1MDJA 1FO5A 4IW9A 2ON7A 1K0NA 3F4TA 3I6AA 1BYEA 4MJEA 3PR8A 1A2JA 3CSIA 4ZL7A 1J08A 2OE0A 3R2QA 4WXTA 1PSQA 1K0CA 3I9V2 3IOSA 1XWGA 4ECJA 3ZFBA 3DMLA 4ZB6A 1ERWA 2IIYA 1A24A 3IE3A 4YAPA 2OJLA 2A4VA 1PX7A 4K5SA 5D73A 1XWKA 4NPBA 1YQ1A 3FZ9A 3GYKA 2FWHA 1SK2A 2H1AA 2CX3A 1RQMA 5HR0A 4N11A 1I5GA 4KCEA 1HNCA 2LJAA 2GSTA 1KNGA 2LSTA 13GSA 16GSA 1BEDA 2MMAA 2L59A 1GTUA 4IBPA 2GVPA 2X8CA 3GNJA 4ULXA 1GP1A 1Y25A 4NV5A 5F05A 2PU9C 4O5QA 1NHYA 4ZBDA 4TW5A 1O8WA 2L5OA 3APOA 3WYWA 1G7OA 5CRHA 4PNGA 1ERUA 2PVQA 3KTLA 1MDKA 4HUAA 3MYDA 1XW9A 3EC3A 3IXRA 1VRSD 1FOVA 2WJUA 1KBNA 1JLWA 1WP0A 3W8SA 4IJ3A 6GSVA 4ZBAA 2FCHA 17GSA 3M0FA 4K8MA 4F03A 1GL8A 5JWQB 3SWLA 2FNOA 2O89A 4KGIA 1UVZA 2TIRA 4MJCA 4V1Ap 5EVOA 1H75A 2IFQB 2V6KA 4XS1A 1QMVA 5HFIA 2N5AA 5B8AA 3QCPA 3H79A 4GQCA 4OMVA 3VI5A 4BWSA 1AAZA 2H0GA 1VF4A 3H1NA 3TJFA 2HZEB 2B7JA 4MABA 5HR3A 3ZFLA 2RM5A 2VCTA 1ZGNA 2DKIA 3RAZA 3TRXA 2YN1A 3TKPA 6GSTA 1ILOA 3RPPA 1Q98A 3E0UA 4FYBA 1FB0A 3A2WA 4EDZA 1J9BA 4EXJA 1FVKA 1GSFA 1R5PA 3CYNA 3HCZA 3A5WA 2LRTA 5JCUA 2LEGA 1M7TA 1GSUA 4WF5A 4YAVA 3G7JA 2I4AA 2E0QA 3FR6A 3LWAA 4MH3A 5CRWA 1Z6MA 2GZZA 4HU7A 2BJXA 4XCSA 2YOIA 3F3QA 6GSXA 1THXA 2ALBA 2ES7A 1JZDA 2CVKA 1TOFA 3KZQA 3NIVA 4Z2RA 3C71A 3IPZA 3LG6A 1A23A 5GAPD 4PTSA 1LJRA 2ZNMA 3GHAA 2YP6A 4L8EA 5E59A 3UIWA 1K0AA 8GSSA 3DEXA 2JL4A 3TKQA 2E2GA 1PMTA 3KH7A 5ABRA 1AIUA 2JU5A 1ZYNA 3IBHA 4PXOA 4ILFA 4RQXA 1T4ZA 3GL5A 1B8XA 3KD0A 1TRVA 4ML1A 2PPTA 3KP9A 3VWVA 1TXXA 2K6VA 3HJOA 4XRAA 2HXKA 3IK7A 5DQSA 4I2UA 4NHZA 1MD3A 3U6VA 1SJIA 3P90A 4CY6A 2VM2A 4IGJA 1AW9A 3P8WA 5HR1A 1I9DA 3VPTA 1X9SB 4OD7A 4LMWA 2O87A 1TDIA 1F37A 4HQZA 2JZRA 4TXOA 5H5SA 1ERVA 1YKAA 3BCIA 2B6MA 2IMDA 1UA5A 4L5OA 4BL7B 2FWFA 5D9WA 5IIZA 3UMAA 4OFMA 2MYGA 5B6NA 4L0UA 5G1KA 1F6MC 3NOFA 4KCAA 1OVNA 2HRKA 5D9TA 2PWJA 3ED3A 5BMUA 2V6OA 3Q74A 2YV7A 1K3YA 1N8JA 1EV4A 2GQLA 3MSZA 2DMMA 5ID2A 4HEA2 3F4SA 1K0OA 3Q18A 4NXIA 1C72A 2L5LA 2YV9A 2PUKC 1GTBA 2WB9A 4NHWA 2VCXA 2VLTA 3BD2A 3KIJA 4FH8A 1NM3A 2OBKA 3KXOA 4AGSA 1G6WA 4YQMA 4Z2UA 3ME8A 3N5OA 1SU9A 2CV4A 3ERWA 2C8UA 4ZXGA 5HFGA 4K6XA 1YKCA 3WD6A 2PMTA 4YKGA 3D5JA 1ZYPA 4MK3A 4MPFA 3S9FA 1SJ6A 1GLQA 2CVDA 2KP1A 4BVXB 5GSSA 3EINA 2FA8A 4WF4A 1Z5YE 2DJ1A 5IPHA 3HKRA 1T7PB 1XWCA 3VLNA 2P31A 3ZIVA 1DBYA 3CTGA 2YWIA 2MZCA 4KAEA 2DJKA 4V1Ag 1SYRA 1X9MB 5ECHB 4AF2A 3MIXA 2M72A 1GSQA 4PGTA 4TVEA 1GSEA 3FK8A 3MNGA 2DSAA 2TRXA 4TR1B 1WMJA 3TKSE 5H5RA 1DSBA 2GS3A 4ZL9A 4Q5FA 4N10A 2DIYA 3IAS2 2R2JA 1WIKA 5INYA 1XZOA 4XS4A 4JR4A 2VUPA 1B48A 1DE1A 1FHEA 2H6YA 1YY7A 3QAVA 2X99A 5J4UA 3LEFA 4BVYB 4V2LA 4ML6A 4TKYA 5IMVA 1YEXA 4KX4A 2LQQA 3C8EA 4KA0A 3TKSA 2X64A 1HNAA 3QFBC 4L0WA 4GF0A 1PA3A 1PRXA 2J23A 1O81A 3A3TA 3ISOA 2X8HA 4E8HA 3W8JA 5GAND 5AISA 1M9BA 3G7YA 2L6DA 1WPIA 1V2AA 1XW6A 1GTAA 5CREA 3I69A 4NV2A 5JCWA 2YWOA 2AJQB 3LJRA 4CW9A 1ZL9A 1MEKA 2G0FA 2GLRA 4BL7A 1FB6A 4XS4B 1GH2A 2IL3A 4K5RA 2RIIA 6GSYA 1QQ2A 4MMMA 4ECCA 3TB2A 2MMNA 2O8VB 2WRTA 4EDYA 2VCQA 5COHA 1A2MA 3GKKA 1BJXA 3TOTA 5F06A 1H4OA 5A4UA 4POLA 4JE1A 2VD0A 3H8QA 3CSHA 3F6FA 2D2ZA 2FA4A 3BOAA 5G5EA 4MF7A 5KN3A 2RLIA 1FG4A 4AJ6A 3GTUA 4ZB8A 3L4NA 2JACA 2H30A 2WZ9A 2L6CA 1WJKA 2FLSA 4XRDA 5IMZA 3O3TA 3KMOA 5ELGA 2A2RA 3CMIA 5H5QA 1XPVA 2GZYA 3IRAA 1O85A 2C0EA 1BAYA 4QL9A 4HU9A 4X43A 3DIEA 3TJBA 3ZMKA 1S3DA 4KH7A 2M80A 2YWNA 4JZQA 1XVQA 3GUSA 4USSA 5G1LA 3M8NA 4LMVA 1M2BA 3M9JA 1GTIA 5EL8A 4OO5A 4F0CA 5HQPA 2H8LA 4XHMA 3IA1A 3KJYA 4LA1A 2H72A 2AYTA 1NW2A 4FQUA 1B9XC 1ML6A 5LCZA 2CAIA 3H4KA 2I3YA 3LXZA 5HR2A 1LBKA 3HD5A 4GQFA 1SK1A 3D0ZA 1V57A 3ERGA 1R7HA 2I1UA 5DBQA 1EP8A 5ECKB 2H6XA 3LW9A 1VF1A 4DSQA 4O5RA 1OC9A 2IN3A 3VK9A 2KHPA 2YZHA 3QDNA 3GIXA 1G7EA 5LD0A 4HZ2A 5G31A 5C04A 11GSA 4GTUA 1XCCA 1S3AA 1XIYA 2DJ0A 20GSA 3QR6A 3DVWA 2B5YA 2VD1A 5KN2A 4PQHA 3TJGA 3EPTA 3CBUA 2CA8A 3WGDA 2GGTA 2GZPA 1TRSA 3EU3A 2LQOA 3D6IA 2LJKA 4EE0A 3DRNA 4OFNA 2CAQA 2FWEA 1U6TA 3HXSA 3HZ8A 2YANA 3QD9A 3BJ5A 2HLSA 4HZ4A 2KOKA 4MLYA 2HNLA 1A0FA 3HVVA 2H19A 1QUWA 5J3RA 1EV9A 1TJDA 3E3EA 2H74A 3CRTA 2KP2A 1SKSB 1ZYEA 2XPEA 2N5FA 4POMA 4LLRA 5IM9A 1A8YA 2O85A 1PN9A 1WWJA 3GURA 1TI1A 1EGRA 4MCUA 1QGVA 3QAGA 1O6JA 2HFDA 4G0IA 4MZCA 1ZCPA 1T8EB 1GULA 1BX9A 3WT1A 2B7KA 3L0HA 4GLTA 1X9WB 1OC3A 3DXBA 3VWWA 1NHOA 4O5UA 5DJLA 2XPDA 3G9BA 2VL2A 2AUVA 4TXOB 2LTKA 2QKEA 3WGEA 4WBRD 4NWYA 3PINA 2XBQA 4IHUA 1T3BA 3GMFA 4KB3A 3ZITA 4ICYA 4DEJA 2NBSA 4K2DA 5DJMA 2MMOA 5F8BA 5ECLB 3VFIA 2WGRA 3P7XA 2AHEA 4DSRA 3HVXA 5CP1A 2NTOA 4XTSA 2M46A 4G0LA 3EU4A 4OCEA 4POKA 4EKZA 2JZTA 4I8BA 1RW1A 4P3YB 3F0IA 3KMNA 4OFTA 3QPMA 2IFQA 1TRUA 4OCFA 2H71A 2AAWA 4BVYA 3CXGA 1ABAA 2DBCA 1U87A 2H76A 1OKTA 3GSSA 2GQKA 3F63A 3CSJA 1PQNA 1FW1A 1GRXA 2WS2A 1OAZA 4GCIA 1XOBA 1VF3A 2AB6A 1SK0A 1QFNA 2X8GA 1F9MA 3GKMA 1V40A 3LGCA 3P2AA 5DCHA 1EGOA 2YNXA 4TRXA 1K0DA 4MJAA 3DD3A 4EIPA 4KDYA 2WFCA 4EO3A 1XBSA 1GSDA 2PVOC 1CQHA 1TK8B 4PUAA 2C80A 3TJJA 3WGXA 3W6GA 4QQ7A 3EWLA 4Q5NA 4GSTA 4X1UA 2B1KA 1M0UA 2XHFA 3KTBA 3E9JB 3ZMLA 5BRTA 5KN0A 2P5QA 4PQ1A 2BTOT 3V1WA 1Z7RA 1B4PA 2JADA 3FZ4A 2H66A 3Q6OA 2DJJA 4PX1A 4L5LA 1XW5A 2CT6A 3UBKA 4EVMA 2VCZA 5KOXA 1ZMAA 1SENA 4O7HA 2PERA 3RPNA 3MWHA 2TRCP 1A2LA 4GSNA 3WT2A 2HZEA 3ZL5A 4TR3A 1R5AA 5ID2B 5CYYA 4WR4A 2YJ7A 4ID0A 1SL0B 1ERTA 2H75A 2GT5A 3GKXA 3OR5A 3HJPA 3L9UA 3M9KA 3TCOA 4MDCA 5DDLA 1FAAA 3R3EA 5IMCA 3TUEA 1SKRB 5KOWA 1M2AA 2RUFA 3QMXA 1ZOFA 3EVIA 2HRNA 1T4YA 2GTUA 1GWCA 3UBLA 4NAXA 4TR0A 2LJRA 4OO4A 1M99A 4MH2A 2QC7A 5AIXA 3IDVA 1F2EA 1PKWA 3FR3A 4KSOA 3GKNA 3PPUA 2B5EA 1HQOA 2VL3A 2R6KA 2DC5A 4LL4B 1KEBA 1SD9A 3F6DA 5IOXA 3L78A 4NMUA 1O73A 1WOUA 5FT3A 3DYRA 3GL3A 2V32A 3APSA 2VLUA 3O6TA 1BQ7A 5A4WA 5IO2A 1GSYA 6GSUA 2HI7A 2WCIA 2B1LA 3GTUB 2V1MA 2NDOA 4IP6A 1PL2A 5DALA 2E7PA 2G2QA 4WEYA 5J9BA 2C3NA 3UL3A 4F0BA 2I9HA 4GRFA 1X0RA 2VAFA 2X49A 1K3OA 1PX6A 1Z7PA 5LNKe 4K7OA 1MTCA 1V9WA 4IQAA 5DQYA 3C7MA 3APQA 1T1VA 2UZ8A 2H0HA 4AJ8A 3D4TA 3CRUA 4EC0A 3O76A 1U88A 2QGVA 4A5PA 4ECIA 1YF0A 4K1FA 2GT6A 2HSYA 4YQUA 5ECSA 4Z2TA 4ECBA 3L9VA 1FOHA 2AV4A 3IC4A 4N0VA 3ZRDA 1TRWA 1K0MA 1PN0A 2HT9A 3HY2A 1URMA 3GN3A 4FYCA 2JZSA 2HE3A 3IR4A 1V58A 4Q5RA 3ZLPA 1E2YA 5HFKA 4ISDA 1CQGA 2EIQA 3DGQA 3LYPA 1GSSA 5B6MA 2HSMA 3TRQA 5IO0A 5G2ZA 1VF2A 2H01A 3VPQA 1XOAA 5ECMB 2BMXA 4E8EA 2KUCA 4ZILA 3HDCA 3GX8A 1ON4A 3UJ1A 3UOMA 4Z7XA 1OC8A 1SD8A 4V2NA 5DAKA 2K8SA 5ECRB 1JZRA 4I2TA 2IMKA 3GH9A 1NSWA 2V2GA 2H6ZA 3F4RA 3Q19A 2LNSA 4PUFC 2IMEA 12GSA 2H1DA 2VCVA 2H73A 3FYGA 3LORA 3RBTA 3HZ4A 4D73B 4IP1A 1MDIA 4X4JA 4J57E 2O7KA 3DKSA 2C0DA 2H1GA 3D21A 4G9HA 1IYHA 4X0XA 4RUVA 2DJ2A 2NPBA 1TK0B 4IQ1A 1GUKA 3EMPA 2GSRA 4RQRA 4POBA 2OACA 1Z9HA 2EC4A 1BG5A 4HOJA 2CX4A 4I5QA 5IMDA 4WETA 2MBTA 3RHCA 3TGZA 4YKFA 5IPGA 1A8LA 2OA7A 1U3AA 2DKHA 1DUGA 5B8BA 2F8FA 4O32A 4IVFA 5G30A 2DMLA 1EP7A 3C1SA 2IWTA 3RDWA 4PQIA 1JLVA 3TRPA 4TN8A 2IPAA 3RHBA 1LU4A 1KTEA 2CQ9A 1GLPA 1AC1A 5A5KA 3VI7A 1TTZA 2DJ3A 4J56E 2B5XA 2L57A 1PGTA 5DCGA 4QL7A 4K2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYU A;  5F07 A;  5D96 A;  1AXD A;  5B7C A;  3DWV A;  4YQV A;  2E2M A;  1GUH A;  4EUY A;  3FW2 A;  1EZK A;  3EE2 A;  4CHS A;  1M2D A;  4DSS B;  1PKZ A;  3LSZ A;  5DAL B;  3L9S A;  4GWR A;  1AQX A;  1TU8 A;  1GNW A;  4ZBB A;  5AN1 A;  2K9F A;  2FGX A;  2I81 A;  4EF0 A;  3IV4 A;  3TJK A;  1YF1 A;  3VWX A;  1WE0 A;  3TDG A;  4F82 A;  1UC7 A;  1Z3E A;  2ON5 A;  2VO4 A;  5GZZ B;  1U3I A;  1EEM A;  2YWM A;  3K8N A;  4HS1 A;  4HDE A;  4KDU A;  4CDO A;  3QOU A;  4BVX A;  2VLV A;  4F9Z A;  5CNW A;  2K18 A;  1HNB A;  4I97 A;  1PL1 A;  4YH2 A;  2RM6 A;  4KUN A;  14GS A;  4FYU A;  2OAD A;  5A4V A;  2JSY A;  3QFA C;  2R4V A;  2YZU A;  5D9V A;  2R3X A;  4V2M A;  2F3M A;  3CTF A;  2C0G A;  1S3C A;  2A2S A;  4MZW A;  3D22 A;  2GSS A;  2B3S A;  1PD2 1;  2F51 A;  3N9J A;  3G7I A;  2WUL A;  5DVB A;  4MF5 A;  19GS A;  5D8I A;  1O8X A;  5FHI A;  3NZN A;  6GSW A;  1OKD A;  3TKR A;  3FRC A;  2H70 A;  5G5F A;  2DLX A;  2HYX A;  2GDR A;  5IMA A;  2VCW A;  5CRD A;  2FUG 2;  1B9Y C;  3GRX A;  1G0T A;  7GSS A;  1EOG A;  2C3T A;  1OC9 B;  4IJI A;  5EY6 A;  4G2E A;  3KH9 A;  2VIM A;  1YEP A;  4FIW A;  3GFK A;  2N5B A;  3US3 A;  3EYT A;  2OE1 A;  2OE3 A;  1WRY A;  1DE2 A;  3HYP A;  2NVL A;  1OE7 A;  6GSS A;  1X5C A;  2LS5 A;  5JCG A;  1K0B A;  1J0F A;  2Z9S A;  1B4Q A;  2VL9 A;  4MA9 A;  4IEL A;  3IAM 2;  1AUC A;  5JWO B;  1Y6E A;  3ZZX A;  2GSQ A;  1EWX A;  3LYK A;  4K0G A;  1RK4 A;  1JZW A;  2IMI A;  4ZB9 A;  5IMF A;  3J7Y b;  3H93 A;  3KM6 A;  3KEB A;  3EUR A;  1HD2 A;  2KLX A;  2JSZ A;  2HSH A;  4K0N A;  2P0G A;  2REM A;  3UAR A;  1AQW A;  2PBJ A;  4JRR A;  4HJM A;  3FR9 A;  3FHK A;  1GNE A;  1ST9 A;  4MF6 A;  2MBS A;  2EIR A;  4AJ7 A;  3BCK A;  4I6X A;  3BBY A;  1W89 A;  4Q5Q A;  3KP8 A;  2IMF A;  1YZX A;  4KND A;  4JU5 A;  1QXH A;  1IYI A;  1TKD B;  1M9A A;  4FO5 A;  2DIZ A;  1SL1 B;  2C1Y A;  3F3R A;  3FZA A;  4H86 A;  5F0G A;  1VGL A;  4XIH A;  3VUR A;  4JED A;  1QK8 A;  4HI7 A;  2RUE A;  3GST A;  3IHQ A;  2LUS A;  1GUM A;  2XBI A;  2CZ3 A;  1TU7 A;  5ECO B;  4GXZ A;  3VWU A;  1TW9 A;  4K7I A;  3FKF A;  3TOU A;  3C1R A;  1Q4J A;  4DVC A;  2LRN A;  1F3B A;  2IJY A;  5J41 A;  2L4C A;  3IK9 A;  3PGT A;  5L71 A;  1G6Y A;  2FD3 A;  1EOH A;  2R5G A;  1R26 A;  4KE3 A;  1ZZY A;  2EIO A;  3PH9 A;  4HJ2 A;  3A2V A;  5D9X A;  3ZIJ A;  4TR1 A;  2OKA A;  2FWG A;  1E6B A;  2WDU A;  2LV3 A;  2F9S A;  3FEU A;  2YPM A;  2H0I A;  3M1G A;  2LNT A;  2H1B A;  3KCM A;  1SYX A;  4KW6 A;  5ENU A;  2P5R A;  3JCM L;  2HZF A;  5KN1 A;  4WKW A;  5IOW A;  4IKH A;  4J2F A;  5ECI B;  1TK5 B;  1JZO A;  3U5R E;  1XVW A;  1XWA A;  3A2X A;  3SBC A;  4G10 A;  1ZYQ B;  4TR4 A;  1A0R P;  1Z6N A;  5GST A;  4IS0 A;  3I43 A;  5E4W A;  1X5D A;  3LFL A;  3GV1 A;  5C00 A;  5IQY A;  1W4V A;  1TP9 A;  1MD4 A;  2XC2 A;  4BPY A;  2VM1 A;  3LXT A;  4D73 A;  3ZYW A;  4OWY A;  3MDK A;  5D93 A;  5J9C A;  3HVS A;  4MPG A;  3M3M A;  4JBB A;  1AQV A;  4N30 A;  3ZVJ D;  2LRC A;  2V41 A;  3ME7 A;  1F3A A;  5J5N A;  5KEJ A;  4MP4 A;  2VOC A;  1XWB A;  4DSS A;  3HA9 A;  5DAK B;  5ELA A;  5JWR B;  1O7U A;  2YJH A;  1OE8 A;  2GQM A;  3F8U A;  2OBI A;  4EL1 A;  1ACV A;  3FZ5 A;  2R37 A;  3ZRE A;  1SL2 B;  2HRF A;  1X5E A;  4BWQ A;  4WBJ A;  2C3Q A;  3HJM A;  4F2I A;  1USB A;  1XXU A;  4TOP A;  3UVH A;  4N0Z A;  2ZCT A;  5AGY A;  2LKU A;  3LQ7 A;  2J9H A;  4RI7 A;  4PUR A;  5FWG A;  5CAX A;  10GS A;  3FY7 A;  4ACS A;  3ZVJ A;  5CO3 A;  3ERF A;  5ECQ B;  5CRG A;  2FHE A;  4RI6 A;  4MZB A;  4ZL8 A;  4MJB A;  1N2A A;  2VL2 C;  4K9Z A;  2PN8 A;  1XFL A;  3AY8 A;  4IN0 A;  3QAW A;  2ZUP A;  3EMX A;  4K7N A;  2YCD A;  1JFU A;  1TI3 A;  3ZTL A;  2CVB A;  4HQS A;  3F9U A;  3GA4 A;  3J7Y k;  1THO A;  1JHB A;  4XS6 A;  1UN2 A;  1V98 A;  18GS A;  5EPF A;  1YDK A;  2C4J A;  5AIV A;  1SJZ A;  2MMZ A;  1R4W A;  4WR5 A;  1YJ6 A;  1FVJ A;  2QSI A;  2PGT A;  4JR6 A;  1SKW B;  4GSS A;  2F8A A;  4LL1 B;  3TKS C;  3KGK A;  4O92 A;  1OYJ A;  1K3L A;  3MAK A;  3UVT A;  3D4M A;  3GX0 A;  4TXV A;  1EEJ A;  22GS A;  5ECP B;  3DVX A;  3HHV A;  2K8V A;  1T00 A;  5ECN B;  4ZIJ A;  2L4Q A;  2CZ2 A;  3UEM A;  4BA7 A;  3C73 A;  2FY6 A;  4PNF A;  9GSS A;  3UAP A;  4KSM A;  4KDX A;  4G19 A;  2C0F A;  3GH6 A;  1MDJ A;  1FO5 A;  4IW9 A;  2ON7 A;  1K0N A;  3F4T A;  3I6A A;  1BYE A;  4MJE A;  3PR8 A;  1A2J A;  3CSI A;  4ZL7 A;  1J08 A;  2OE0 A;  3R2Q A;  4WXT A;  1PSQ A;  1K0C A;  3I9V 2;  3IOS A;  1XWG A;  4ECJ A;  3ZFB A;  3DML A;  4ZB6 A;  1ERW A;  2IIY A;  1A24 A;  3IE3 A;  4YAP A;  2OJL A;  2A4V A;  1PX7 A;  5D73 A;  1XWK A;  4NPB A;  1YQ1 A;  3FZ9 A;  3GYK A;  2FWH A;  1SK2 A;  2H1A A;  2CX3 A;  1RQM A;  5HR0 A;  4N11 A;  1I5G A;  4KCE A;  1HNC A;  2LJA A;  2GST A;  1KNG A;  2LST A;  13GS A;  16GS A;  1BED A;  2MMA A;  2L59 A;  1GTU A;  4IBP A;  2GVP A;  2X8C A;  3GNJ A;  4ULX A;  1GP1 A;  1Y25 A;  4NV5 A;  5F05 A;  2PU9 C;  1NHY A;  4ZBD A;  4TW5 A;  1O8W A;  2L5O A;  3APO A;  3WYW A;  1G7O A;  5CRH A;  4PNG A;  1ERU A;  2PVQ A;  3KTL A;  1MDK A;  4HUA A;  1XW9 A;  3EC3 A;  3IXR A;  1VRS D;  1FOV A;  2WJU A;  1KBN A;  1JLW A;  1WP0 A;  3W8S A;  4IJ3 A;  6GSV A;  4ZBA A;  2FCH A;  17GS A;  3M0F A;  4K8M A;  4F03 A;  1GL8 A;  5JWQ B;  3SWL A;  2FNO A;  2O89 A;  4KGI A;  1UVZ A;  2TIR A;  4MJC A;  4V1A p;  5EVO A;  1H75 A;  2IFQ B;  2V6K A;  4XS1 A;  1QMV A;  5HFI A;  2N5A A;  5B8A A;  3QCP A;  3H79 A;  4GQC A;  4OMV A;  3VI5 A;  4BWS A;  1AAZ A;  2H0G A;  1VF4 A;  3H1N A;  3TJF A;  2HZE B;  2B7J A;  4MAB A;  5HR3 A;  3ZFL A;  2RM5 A;  2VCT A;  1ZGN A;  3RAZ A;  3TRX A;  2YN1 A;  3TKP A;  6GST A;  1ILO A;  3RPP A;  1Q98 A;  3E0U A;  4FYB A;  1FB0 A;  3A2W A;  4EDZ A;  1J9B A;  4EXJ A;  1FVK A;  1GSF A;  1R5P A;  3CYN A;  3HCZ A;  3A5W A;  2LRT A;  5JCU A;  2LEG A;  1M7T A;  1GSU A;  4WF5 A;  4YAV A;  3G7J A;  2I4A A;  2E0Q A;  3FR6 A;  3LWA A;  4MH3 A;  5CRW A;  1Z6M A;  2GZZ A;  4HU7 A;  2BJX A;  4XCS A;  2YOI A;  3F3Q A;  6GSX A;  1THX A;  2ALB A;  2ES7 A;  1JZD A;  2CVK A;  1TOF A;  3KZQ A;  3NIV A;  3C71 A;  3IPZ A;  3LG6 A;  1A23 A;  5GAP D;  1LJR A;  2ZNM A;  3GHA A;  2YP6 A;  4L8E A;  5E59 A;  3UIW A;  1K0A A;  8GSS A;  3DEX A;  2JL4 A;  3TKQ A;  2E2G A;  1PMT A;  3KH7 A;  5ABR A;  1AIU A;  2JU5 A;  3IBH A;  4PXO A;  4ILF A;  4RQX A;  1T4Z A;  3GL5 A;  1B8X A;  3KD0 A;  1TRV A;  4ML1 A;  2PPT A;  3KP9 A;  3VWV A;  1TXX A;  2K6V A;  3HJO A;  4XRA A;  2HXK A;  3IK7 A;  5DQS A;  4I2U A;  4NHZ A;  1MD3 A;  3U6V A;  1SJI A;  3P90 A;  2VM2 A;  4IGJ A;  1AW9 A;  3P8W A;  5HR1 A;  1I9D A;  3VPT A;  1X9S B;  4OD7 A;  4LMW A;  2O87 A;  1TDI A;  1F37 A;  4HQZ A;  2JZR A;  4TXO A;  5H5S A;  1ERV A;  1YKA A;  3BCI A;  2B6M A;  2IMD A;  1UA5 A;  4L5O A;  2FWF A;  5D9W A;  5IIZ A;  3UMA A;  4OFM A;  2MYG A;  5B6N A;  4L0U A;  5G1K A;  1F6M C;  3NOF A;  4KCA A;  1OVN A;  5D9T A;  2PWJ A;  3ED3 A;  2V6O A;  3Q74 A;  2YV7 A;  1K3Y A;  1N8J A;  1EV4 A;  2GQL A;  3MSZ A;  2DMM A;  5ID2 A;  4HEA 2;  3F4S A;  1K0O A;  3Q18 A;  4NXI A;  1C72 A;  2L5L A;  2YV9 A;  2PUK C;  1GTB A;  2WB9 A;  4NHW A;  2VCX A;  2VLT A;  3BD2 A;  3KIJ A;  4FH8 A;  1NM3 A;  2OBK A;  3KXO A;  4AGS A;  1G6W A;  4YQM A;  3ME8 A;  3N5O A;  1SU9 A;  2CV4 A;  3ERW A;  2C8U A;  4ZXG A;  5HFG A;  4K6X A;  1YKC A;  3WD6 A;  2PMT A;  3D5J A;  4MK3 A;  4MPF A;  3S9F A;  1SJ6 A;  1GLQ A;  2CVD A;  2KP1 A;  5GSS A;  3EIN A;  2FA8 A;  4WF4 A;  1Z5Y E;  2DJ1 A;  5IPH A;  3HKR A;  1T7P B;  1XWC A;  3VLN A;  2P31 A;  3ZIV A;  1DBY A;  3CTG A;  2YWI A;  2MZC A;  4KAE A;  2DJK A;  4V1A g;  1SYR A;  1X9M B;  5ECH B;  4AF2 A;  2M72 A;  1GSQ A;  4PGT A;  4TVE A;  1GSE A;  3FK8 A;  3MNG A;  2DSA A;  2TRX A;  4TR1 B;  1WMJ A;  3TKS E;  5H5R A;  1DSB A;  2GS3 A;  4ZL9 A;  4Q5F A;  4N10 A;  2DIY A;  3IAS 2;  2R2J A;  1WIK A;  5INY A;  1XZO A;  4XS4 A;  4JR4 A;  2VUP A;  1B48 A;  1DE1 A;  1FHE A;  2H6Y A;  1YY7 A;  3QAV A;  2X99 A;  5J4U A;  3LEF A;  4V2L A;  4ML6 A;  4TKY A;  5IMV A;  1YEX A;  4KX4 A;  2LQQ A;  3C8E A;  4KA0 A;  3TKS A;  2X64 A;  1HNA A;  3QFB C;  4L0W A;  4GF0 A;  1PA3 A;  1PRX A;  2J23 A;  1O81 A;  3A3T A;  3ISO A;  2X8H A;  4E8H A;  3W8J A;  5GAN D;  5AIS A;  1M9B A;  3G7Y A;  2L6D A;  1WPI A;  1V2A A;  1XW6 A;  1GTA A;  5CRE A;  3I69 A;  4NV2 A;  5JCW A;  2YWO A;  2AJQ B;  3LJR A;  4CW9 A;  1ZL9 A;  1MEK A;  2G0F A;  2GLR A;  4BL7 A;  1FB6 A;  4XS4 B;  1GH2 A;  2IL3 A;  2RII A;  6GSY A;  1QQ2 A;  4MMM A;  4ECC A;  3TB2 A;  2MMN A;  2O8V B;  2WRT A;  4EDY A;  2VCQ A;  5COH A;  1A2M A;  3GKK A;  1BJX A;  3TOT A;  5F06 A;  1H4O A;  5A4U A;  4POL A;  4JE1 A;  2VD0 A;  3H8Q A;  3CSH A;  3F6F A;  2D2Z A;  2FA4 A;  3BOA A;  5G5E A;  4MF7 A;  5KN3 A;  2RLI A;  1FG4 A;  4AJ6 A;  3GTU A;  4ZB8 A;  3L4N A;  2JAC A;  2H30 A;  2WZ9 A;  2L6C A;  1WJK A;  2FLS A;  4XRD A;  5IMZ A;  3O3T A;  3KMO A;  5ELG A;  2A2R A;  3CMI A;  5H5Q A;  1XPV A;  2GZY A;  3IRA A;  1O85 A;  2C0E A;  1BAY A;  4QL9 A;  4HU9 A;  4X43 A;  3DIE A;  3TJB A;  3ZMK A;  1S3D A;  4KH7 A;  2M80 A;  2YWN A;  4JZQ A;  1XVQ A;  3GUS A;  5G1L A;  3M8N A;  4LMV A;  1M2B A;  3M9J A;  1GTI A;  5EL8 A;  4OO5 A;  4F0C A;  5HQP A;  2H8L A;  4XHM A;  3IA1 A;  3KJY A;  4LA1 A;  2H72 A;  2AYT A;  1NW2 A;  1B9X C;  1ML6 A;  5LCZ A;  2CAI A;  3H4K A;  2I3Y A;  3LXZ A;  5HR2 A;  1LBK A;  3HD5 A;  4GQF A;  1SK1 A;  3D0Z A;  1V57 A;  3ERG A;  1R7H A;  2I1U A;  5DBQ A;  1EP8 A;  5ECK B;  2H6X A;  1VF1 A;  4DSQ A;  4O5R A;  1OC9 A;  3VK9 A;  2IN3 A;  2KHP A;  2YZH A;  3QDN A;  3GIX A;  1G7E A;  5LD0 A;  4HZ2 A;  5G31 A;  5C04 A;  11GS A;  4GTU A;  1XCC A;  1S3A A;  1XIY A;  2DJ0 A;  20GS A;  3QR6 A;  3DVW A;  2B5Y A;  2VD1 A;  5KN2 A;  4PQH A;  3TJG A;  3CBU A;  2CA8 A;  3WGD A;  2GGT A;  2GZP A;  1TRS A;  3EU3 A;  2LQO A;  3D6I A;  2LJK A;  4EE0 A;  3DRN A;  4OFN A;  2CAQ A;  2FWE A;  1U6T A;  3HXS A;  3HZ8 A;  2YAN A;  3QD9 A;  3BJ5 A;  2HLS A;  4HZ4 A;  2KOK A;  4MLY A;  2HNL A;  1A0F A;  3HVV A;  2H19 A;  1QUW A;  5J3R A;  1EV9 A;  1TJD A;  3E3E A;  2H74 A;  3CRT A;  2KP2 A;  1SKS B;  1ZYE A;  2XPE A;  2N5F A;  4POM A;  4LLR A;  5IM9 A;  1A8Y A;  2O85 A;  1PN9 A;  1WWJ A;  3GUR A;  1TI1 A;  1EGR A;  4MCU A;  1QGV A;  3QAG A;  1O6J A;  2HFD A;  4MZC A;  1ZCP A;  1T8E B;  1GUL A;  1BX9 A;  3WT1 A;  2B7K A;  3L0H A;  4GLT A;  1X9W B;  1OC3 A;  3DXB A;  3VWW A;  1NHO A;  5DJL A;  2XPD A;  3G9B A;  2VL2 A;  2AUV A;  4TXO B;  2LTK A;  2QKE A;  3WGE A;  4WBR D;  4NWY A;  3PIN A;  2XBQ A;  4IHU A;  1T3B A;  3GMF A;  4KB3 A;  3ZIT A;  4DEJ A;  2NBS A;  4K2D A;  5DJM A;  2MMO A;  5F8B A;  5ECL B;  3VFI A;  2WGR A;  3P7X A;  2AHE A;  4DSR A;  3HVX A;  5CP1 A;  2NTO A;  4XTS A;  2M46 A;  3EU4 A;  4OCE A;  4POK A;  4EKZ A;  2JZT A;  4I8B A;  1RW1 A;  4P3Y B;  3F0I A;  3KMN A;  4OFT A;  3QPM A;  2IFQ A;  1TRU A;  4OCF A;  2H71 A;  2AAW A;  4BVY A;  3CXG A;  1ABA A;  2DBC A;  1U87 A;  2H76 A;  1OKT A;  3GSS A;  2GQK A;  3F63 A;  3CSJ A;  1PQN A;  1FW1 A;  1GRX A;  2WS2 A;  1OAZ A;  4GCI A;  1XOB A;  1VF3 A;  2AB6 A;  1SK0 A;  1QFN A;  2X8G A;  1F9M A;  3GKM A;  1V40 A;  3LGC A;  3P2A A;  5DCH A;  1EGO A;  2YNX A;  4TRX A;  1K0D A;  4MJA A;  3DD3 A;  4KDY A;  2WFC A;  4EO3 A;  1XBS A;  1GSD A;  2PVO C;  1CQH A;  1TK8 B;  4PUA A;  2C80 A;  3TJJ A;  3WGX A;  3W6G A;  4QQ7 A;  3EWL A;  4Q5N A;  4GST A;  4X1U A;  2B1K A;  1M0U A;  2XHF A;  3KTB A;  3E9J B;  3ZML A;  5KN0 A;  2P5Q A;  4PQ1 A;  2BTO T;  3V1W A;  1Z7R A;  1B4P A;  2JAD A;  3FZ4 A;  2H66 A;  3Q6O A;  2DJJ A;  4PX1 A;  4L5L A;  1XW5 A;  2CT6 A;  3UBK A;  4EVM A;  2VCZ A;  1ZMA A;  1SEN A;  4O7H A;  2PER A;  3RPN A;  3MWH A;  2TRC P;  1A2L A;  4GSN A;  3WT2 A;  2HZE A;  3ZL5 A;  4TR3 A;  1R5A A;  5ID2 B;  5CYY A;  4WR4 A;  2YJ7 A;  4ID0 A;  1SL0 B;  1ERT A;  2H75 A;  2GT5 A;  3GKX A;  3OR5 A;  3HJP A;  3L9U A;  3M9K A;  3TCO A;  4MDC A;  5DDL A;  1FAA A;  5IMC A;  3TUE A;  1SKR B;  1M2A A;  2RUF A;  3QMX A;  1ZOF A;  3EVI A;  2HRN A;  1T4Y A;  2GTU A;  1GWC A;  3UBL A;  4NAX A;  4TR0 A;  2LJR A;  4OO4 A;  1M99 A;  4MH2 A;  2QC7 A;  5AIX A;  3IDV A;  1F2E A;  1PKW A;  3FR3 A;  4KSO A;  3GKN A;  2B5E A;  1HQO A;  2VL3 A;  2R6K A;  2DC5 A;  4LL4 B;  1KEB A;  1SD9 A;  3F6D A;  5IOX A;  3L78 A;  4NMU A;  1O73 A;  1WOU A;  5FT3 A;  3DYR A;  3GL3 A;  2V32 A;  3APS A;  2VLU A;  3O6T A;  1BQ7 A;  5A4W A;  5IO2 A;  1GSY A;  6GSU A;  2HI7 A;  2WCI A;  2B1L A;  3GTU B;  2V1M A;  2NDO A;  4IP6 A;  1PL2 A;  5DAL A;  2E7P A;  2G2Q A;  4WEY A;  5J9B A;  2C3N A;  3UL3 A;  4F0B A;  2I9H A;  4GRF A;  1X0R A;  2VAF A;  1K3O A;  1PX6 A;  1Z7P A;  5LNK e;  4K7O A;  1MTC A;  1V9W A;  4IQA A;  5DQY A;  3C7M A;  3APQ A;  1T1V A;  2H0H A;  4AJ8 A;  3D4T A;  3CRU A;  4EC0 A;  3O76 A;  1U88 A;  2QGV A;  4ECI A;  1YF0 A;  4K1F A;  2GT6 A;  2HSY A;  4YQU A;  5ECS A;  4ECB A;  3L9V A;  2AV4 A;  3IC4 A;  4N0V A;  3ZRD A;  1TRW A;  1K0M A;  2HT9 A;  3HY2 A;  1URM A;  3GN3 A;  4FYC A;  2JZS A;  2HE3 A;  3IR4 A;  1V58 A;  4Q5R A;  3ZLP A;  1E2Y A;  5HFK A;  4ISD A;  1CQG A;  2EIQ A;  3DGQ A;  3LYP A;  1GSS A;  5B6M A;  3TRQ A;  5IO0 A;  5G2Z A;  1VF2 A;  2H01 A;  3VPQ A;  1XOA A;  5ECM B;  2BMX A;  4E8E A;  2KUC A;  4ZIL A;  3HDC A;  3GX8 A;  1ON4 A;  3UJ1 A;  3UOM A;  4Z7X A;  1OC8 A;  1SD8 A;  4V2N A;  5DAK A;  2K8S A;  5ECR B;  1JZR A;  4I2T A;  2IMK A;  3GH9 A;  1NSW A;  2V2G A;  2H6Z A;  3F4R A;  3Q19 A;  2LNS A;  4PUF C;  2IME A;  12GS A;  2H1D A;  2VCV A;  2H73 A;  3FYG A;  3LOR A;  3RBT A;  3HZ4 A;  4D73 B;  4IP1 A;  1MDI A;  4J57 E;  2O7K A;  3DKS A;  2C0D A;  2H1G A;  3D21 A;  4G9H A;  1IYH A;  4X0X A;  4RUV A;  2DJ2 A;  2NPB A;  1TK0 B;  4IQ1 A;  1GUK A;  3EMP A;  2GSR A;  4RQR A;  4POB A;  2OAC A;  1Z9H A;  2EC4 A;  1BG5 A;  4HOJ A;  2CX4 A;  4I5Q A;  5IMD A;  4WET A;  2MBT A;  3RHC A;  3TGZ A;  5IPG A;  1A8L A;  2OA7 A;  1U3A A;  1DUG A;  5B8B A;  2F8F A;  4O32 A;  4IVF A;  5G30 A;  2DML A;  1EP7 A;  3C1S A;  2IWT A;  3RDW A;  4PQI A;  1JLV A;  3TRP A;  4TN8 A;  2IPA A;  3RHB A;  1LU4 A;  1KTE A;  2CQ9 A;  1GLP A;  1AC1 A;  5A5K A;  3VI7 A;  1TTZ A;  2DJ3 A;  4J56 E;  2B5X A;  2L57 A;  1PGT A;  5DCG A;  4QL7 A; 
#chains in the Genus database with same CATH topology
 2WPT A;  1HYU A;  5F07 A;  5D96 A;  1AXD A;  5B7C A;  3DWV A;  4YQV A;  2E2M A;  1GUH A;  4XFZ A;  5KP6 B;  2P9X A;  4EUY A;  3FW2 A;  4WYM A;  1EZK A;  3EE2 A;  4CHS A;  1M2D A;  4DSS B;  1PKZ A;  3LSZ A;  5DAL B;  2N50 A;  3L9S A;  4GWR A;  2A4H A;  1D1D A;  1YIJ P;  1AQX A;  1TU8 A;  1GNW A;  4ZBB A;  5AN1 A;  2K9F A;  2FGX A;  2I81 A;  4EF0 A;  3CCE P;  3G6E P;  3IV4 A;  3TJK A;  2LL8 A;  1VQ9 P;  1YF1 A;  3VWX A;  1AF8 A;  1WE0 A;  3TDG A;  4F82 A;  1UC7 A;  1Z3E A;  2GZJ A;  2ON5 A;  2VO4 A;  1U3I A;  5GZZ B;  1EEM A;  2YWM A;  3K8N A;  4HS1 A;  4HDE A;  4KDU A;  4CDO A;  3QOU A;  4BVX A;  2VLV A;  4F9Z A;  5CNW A;  1L0H A;  2K18 A;  2LIW A;  1HNB A;  4I97 A;  1PL1 A;  4YH2 A;  2RM6 A;  4KUN A;  1YJ9 P;  2N5H A;  14GS A;  4FYU A;  2OAD A;  2QA2 A;  1M90 Q;  5A4V A;  2XXM A;  2JSY A;  3QFA C;  2R4V A;  2YZU A;  5F2N A;  3DS5 A;  5D9V A;  2R3X A;  4V2M A;  2F3M A;  3CTF A;  2C0G A;  1S3C A;  2A2S A;  4MZW A;  3D22 A;  2GSS A;  2B3S A;  1PD2 1;  2F51 A;  3N9J A;  3G7I A;  1VQN P;  3LRY A;  2WUL A;  5DVB A;  4MF5 A;  19GS A;  5D8I A;  4QKO A;  1O8X A;  5FHI A;  3NZN A;  2QEX P;  6GSW A;  1OKD A;  3TKR A;  3FRC A;  2H70 A;  5G5F A;  2DLX A;  2HYX A;  2GDR A;  5IMA A;  2VCW A;  5CRD A;  1VQM P;  2FUG 2;  1B9Y C;  2LKI A;  3GRX A;  2FAE A;  1G0T A;  7GSS A;  1EOG A;  2C3T A;  1OC9 B;  4IJI A;  5EY6 A;  4G2E A;  3KH9 A;  2VIM A;  1YEP A;  4FIW A;  3GFK A;  2N5B A;  3US3 A;  3EYT A;  2OE1 A;  2QA1 A;  2OE3 A;  1WRY A;  1DE2 A;  3HYP A;  2NVL A;  1OE7 A;  6GSS A;  1X5C A;  2LS5 A;  5JCG A;  1K0B A;  2K2Q A;  2EIA A;  3DS4 A;  1J0F A;  2X4A A;  2Z9S A;  1B4Q A;  2VL9 A;  4MA9 A;  4IEL A;  3IAM 2;  3G1G A;  1AUC A;  5JWO B;  2M8N A;  1Y6E A;  4H2W C;  3ZZX A;  2GSQ A;  2EHS A;  1EWX A;  3LYK A;  4K0G A;  1RK4 A;  1JZW A;  2IMI A;  4ZB9 A;  5IMF A;  3J7Y b;  3H93 A;  2OTJ P;  3KM6 A;  2EFJ A;  3EUR A;  1HD2 A;  2KLX A;  3KEB A;  1IMQ A;  3B4Q A;  2JSZ A;  2HSH A;  4K0N A;  2P0G A;  1Q7Y Q;  2REM A;  4NEO A;  3UAR A;  1AQW A;  4CY8 A;  2PBJ A;  4JRR A;  4HJM A;  2VLP A;  3FR9 A;  3FHK A;  3IHG A;  1KQS O;  1GNE A;  1ST9 A;  4MF6 A;  2MBS A;  2EIR A;  4AJ7 A;  3BCK A;  4BPF A;  4I6X A;  3BBY A;  1A43 A;  1W89 A;  4Q5Q A;  2EHT A;  3KP8 A;  2MVU A;  2IMF A;  1YZX A;  1HQB A;  4KND A;  4JU5 A;  1QXH A;  1IYI A;  1TKD B;  1M9A A;  4FO5 A;  2DIZ A;  1SL1 B;  3GZL A;  3OW2 O;  2C1Y A;  3F3R A;  3FZA A;  2GDY A;  2KOD A;  4H86 A;  5F0G A;  3H0D A;  1ACP A;  1VGL A;  4XIH A;  3VUR A;  4JED A;  3G1I A;  1QK8 A;  5CZD B;  4HI7 A;  2RUE A;  4EIQ A;  3CCJ P;  3GST A;  3H4E A;  3IHQ A;  2LUS A;  1GUM A;  2XBI A;  2DNW A;  2CZ3 A;  1TU7 A;  5ECO B;  4GXZ A;  2K0X A;  3VWU A;  1TW9 A;  4K7I A;  3FKF A;  3TOU A;  3C1R A;  1K8A Q;  2JO0 A;  1Q4J A;  4DVC A;  2LRN A;  1F3B A;  2IJY A;  5J41 A;  2FVF A;  1DNY A;  2L4C A;  3IK9 A;  3PGT A;  5L71 A;  1G6Y A;  2FD3 A;  1EOH A;  2R5G A;  1R26 A;  4KE3 A;  2A2P A;  1ZZY A;  2EIO A;  3PH9 A;  4HJ2 A;  2GDX A;  3A2V A;  5D9X A;  3ZIJ A;  4TR1 A;  3DS3 A;  2OKA A;  3CCM P;  2FWG A;  1E6B A;  2WDU A;  2LV3 A;  4XRQ A;  2LTE A;  2F9S A;  3FEU A;  2YPM A;  2H0I A;  3M1G A;  4G0K A;  2LNT A;  2H1B A;  3KCM A;  1SYX A;  3A5I A;  3CMA P;  4KW6 A;  5ENU A;  4PH1 A;  2P5R A;  3IC8 A;  3JCM L;  2HZF A;  5KN1 A;  4WKW A;  5IOW A;  4U0E A;  4IKH A;  4J2F A;  5ECI B;  1TK5 B;  1JZO A;  1VQL P;  3U5R E;  5I4T G;  1XVW A;  1XWA A;  7CEI A;  3A2X A;  1BXI A;  4G10 A;  3SBC A;  4TR4 A;  1ZYQ B;  1A0R P;  1Z6N A;  5GST A;  4IS0 A;  3I43 A;  5E4W A;  2N5I A;  1X5D A;  2JBG A;  4MNN A;  3LFL A;  2R0G A;  3GV1 A;  5C00 A;  5IQY A;  2R0C A;  1W4V A;  1TP9 A;  1MD4 A;  2XC2 A;  2K0Y A;  4BPY A;  2FQ1 A;  2VM1 A;  3LXT A;  4D73 A;  3ZYW A;  4OWY A;  3MDK A;  5D93 A;  5J9C A;  3HVS A;  4MPG A;  3M3M A;  4JBB A;  1AQV A;  4N30 A;  3ZVJ D;  2LRC A;  2V41 A;  3ME7 A;  1F3A A;  5J5N A;  5KEJ A;  4MP4 A;  2VOC A;  1XWB A;  4DSS A;  3HA9 A;  5DAK B;  5ELA A;  5JWR B;  2BUO A;  1O7U A;  2YJH A;  1OE8 A;  2GQM A;  3NTE A;  3F8U A;  2OBI A;  2N6Z A;  4EL1 A;  1BAJ A;  1ACV A;  3FZ5 A;  1GPJ A;  2R37 A;  2AF8 A;  4XRO A;  3ZRE A;  1SL2 B;  2HRF A;  1X5E A;  4BWQ A;  4WBJ A;  1KD1 Q;  2C3Q A;  3HJM A;  4F2I A;  1ZNV A;  1USB A;  2MF4 A;  1XXU A;  4TOP A;  3UVH A;  2ZCT A;  4N0Z A;  5AGY A;  2LKU A;  3LQ7 A;  2J9H A;  4RI7 A;  4PUR A;  5FWG A;  5CAX A;  10GS A;  3FY7 A;  3I56 P;  4ACS A;  3ZVJ A;  5CO3 A;  3ERF A;  5ECQ B;  5CRG A;  2FHE A;  4RI6 A;  4MZB A;  4ZL8 A;  4MJB A;  1N2A A;  2VL2 C;  4K9Z A;  2PN8 A;  1XFL A;  3AY8 A;  4IN0 A;  3QAW A;  1KC8 Q;  2ZUP A;  3EMX A;  4K7N A;  2Z44 A;  2YCD A;  1JFU A;  1TI3 A;  3ZTL A;  2CVB A;  4HQS A;  3F9U A;  3GA4 A;  3J7Y k;  1THO A;  1JHB A;  1A8O A;  2KOP A;  1VQ6 P;  4XS6 A;  1UN2 A;  3MGE A;  1V98 A;  18GS A;  4KF9 A;  2L9F A;  2L0Q A;  5EPF A;  1YDK A;  2C4J A;  5AIV A;  1SJZ A;  2MMZ A;  1R4W A;  1VQ5 P;  4WR5 A;  2HRA A;  1YJ6 A;  2R0P A;  1FVJ A;  2QSI A;  2PGT A;  4JR6 A;  1SKW B;  4GSS A;  2KG6 A;  2F8A A;  4LL1 B;  3TKS C;  4COC A;  3KGK A;  1M74 A;  4O92 A;  1OYJ A;  1K3L A;  3MAK A;  3UVT A;  3FMW A;  3D4M A;  3GX0 A;  4TXV A;  1EEJ A;  22GS A;  5ECP B;  2X2B A;  3DVX A;  3HHV A;  2JAZ A;  3EJE A;  2K8V A;  1T00 A;  5ECN B;  4ZIJ A;  2L4Q A;  2CZ2 A;  2CG5 B;  3UEM A;  2PY8 A;  4BA7 A;  3C73 A;  2FY6 A;  4PNF A;  4PH0 A;  9GSS A;  2GZF A;  3UAP A;  1UNK A;  4KSM A;  4KDX A;  4G19 A;  2C0F A;  2KOO A;  3GH6 A;  1MDJ A;  1FO5 A;  4IW9 A;  2ON7 A;  1K0N A;  3F4T A;  3I6A A;  1BYE A;  4MJE A;  3PR8 A;  1A2J A;  3CSI A;  4ZL7 A;  1J08 A;  2OE0 A;  3Q20 A;  3R2Q A;  1GXH A;  4WXT A;  1PSQ A;  1K0C A;  3I9V 2;  3IOS A;  1XWG A;  4ECJ A;  3ZFB A;  3DML A;  4ZB6 A;  1ERW A;  2IIY A;  1A24 A;  3IE3 A;  4YAP A;  2OJL A;  2A4V A;  1PX7 A;  4PXH B;  4K5S A;  5D73 A;  1XWK A;  3U43 A;  4NPB A;  1YQ1 A;  3FZ9 A;  3GYK A;  2FWH A;  1SK2 A;  2H1A A;  1M1K Q;  2CX3 A;  1RQM A;  5HR0 A;  4N11 A;  1VQO P;  1I5G A;  4KCE A;  1HNC A;  2LJA A;  2GST A;  1KNG A;  2XZ0 D;  2LST A;  13GS A;  4U0D A;  16GS A;  1BED A;  2MMA A;  2L59 A;  1GTU A;  4IBP A;  2GVP A;  2X8C A;  3GNJ A;  4ULX A;  3EJD A;  1GP1 A;  1Y25 A;  4NV5 A;  5F05 A;  2PU9 C;  4O5Q A;  1NHY A;  4ZBD A;  4TW5 A;  1O8W A;  2L5O A;  2AFD A;  3APO A;  3WYW A;  2MR8 A;  1G7O A;  5CRH A;  4PNG A;  4U0F A;  1ERU A;  2PVQ A;  3KTL A;  1MDK A;  2LOL A;  4HUA A;  3MYD A;  1XW9 A;  5JPA A;  3EC3 A;  3IXR A;  3CCV P;  1VQ8 P;  3DS1 A;  2PNG A;  2KG8 A;  1VRS D;  1FOV A;  2WJU A;  1KBN A;  1JLW A;  1WP0 A;  3W8S A;  1OR5 A;  4IJ3 A;  6GSV A;  4ZBA A;  2FCH A;  17GS A;  3M0F A;  1Q86 Q;  4K8M A;  4F03 A;  2KOR A;  1GL8 A;  2Z45 A;  5JWQ B;  3SWL A;  2FNO A;  2O89 A;  4KGI A;  1UVZ A;  2TIR A;  4MJC A;  4V1A p;  5EVO A;  1H75 A;  2IFQ B;  3I55 P;  2V6K A;  2KOS A;  2JYL A;  4U0A A;  4XS1 A;  1QMV A;  5HFI A;  2NO8 A;  1Q82 Q;  2N5A A;  5B8A A;  1KLP A;  4GQC A;  3H79 A;  3QCP A;  4OMV A;  5HGN A;  2GZE A;  3VI5 A;  1S72 P;  4BWS A;  1AAZ A;  2H0G A;  1VF4 A;  3H1N A;  1GXG A;  3G26 A;  3TJF A;  1L0I A;  2HZE B;  2B7J A;  4MAB A;  5HR3 A;  1RO2 A;  2GYK A;  3ZFL A;  2RM5 A;  2VCT A;  1ZGN A;  4PWV B;  2DKI A;  4QNB A;  3RAZ A;  4DG9 A;  3TRX A;  2YN1 A;  3TKP A;  6GST A;  1ILO A;  3RPP A;  1Q98 A;  3E0U A;  4FYB A;  3G4S P;  1FB0 A;  3A2W A;  4EDZ A;  1J9B A;  4EXJ A;  1FVK A;  1GSF A;  1R5P A;  3CYN A;  3HCZ A;  2MY5 A;  3A5W A;  4R0M A;  3DS2 A;  2N98 A;  2LRT A;  5JCU A;  2LEG A;  1M7T A;  2M5R A;  2MVV A;  1GSU A;  4WF5 A;  4YAV A;  3G7J A;  4UHP B;  2I4A A;  3DS0 A;  1ZMB A;  2E0Q A;  3FR6 A;  3LWA A;  4MH3 A;  5CRW A;  1Z6M A;  2GZZ A;  4HU7 A;  2BJX A;  4XCS A;  2YOI A;  3F3Q A;  6GSX A;  1THX A;  2ALB A;  2ES7 A;  1JZD A;  2CVK A;  1TOF A;  3KZQ A;  3NIV A;  4Z2R A;  3C71 A;  3IPZ A;  4H2Y C;  3CC4 P;  3LG6 A;  1A23 A;  5GAP D;  4PTS A;  1LJR A;  2ZNM A;  3GHA A;  2YP6 A;  4L8E A;  5E59 A;  3UIW A;  1K0A A;  8GSS A;  3DEX A;  2JL4 A;  3TKQ A;  2E2G A;  1PMT A;  3KH7 A;  5ABR A;  1AIU A;  2JU5 A;  1ZYN A;  2E1M A;  3IBH A;  1QVF O;  2LML A;  4PXO A;  4ILF A;  4RQX A;  1T4Z A;  3GL5 A;  2KOQ A;  1B8X A;  3KD0 A;  1TRV A;  4ML1 A;  1NQ4 A;  2PPT A;  3KP9 A;  3VWV A;  1TXX A;  2K6V A;  3HJO A;  4XRA A;  1N8R Q;  1EOQ A;  2HXK A;  3IK7 A;  5BS2 A;  5DQS A;  3GKL C;  4I2U A;  4NHZ A;  1MD3 A;  2LF4 A;  3U6V A;  1IMP A;  1SJI A;  3P90 A;  4CY6 A;  3CXC O;  2VM2 A;  4IGJ A;  1AW9 A;  3P8W A;  5HVC A;  5HR1 A;  1I9D A;  3VPT A;  2OTL P;  1X9S B;  4OD7 A;  2FQ2 A;  4LMW A;  1VQP P;  2L4B A;  2O87 A;  1TDI A;  1F37 A;  4HQZ A;  2K94 A;  2JZR A;  4TXO A;  5H5S A;  1ERV A;  2FAC A;  1YKA A;  3BCI A;  2B6M A;  2IMD A;  1UA5 A;  4L5O A;  4BL7 B;  2FQ0 A;  2FWF A;  5D9W A;  5IIZ A;  3UMA A;  4OFM A;  2MYG A;  5B6N A;  3HVN A;  4L0U A;  2FVE A;  5G1K A;  1F6M C;  3NOF A;  4KCA A;  1OVN A;  2HRK A;  2XV6 A;  5D9T A;  2PWJ A;  3ED3 A;  5BMU A;  2V6O A;  3Q74 A;  2YV7 A;  1K3Y A;  1N8J A;  1EV4 A;  2GQL A;  3MSZ A;  2DMM A;  5ID2 A;  4HEA 2;  4XFX A;  2L22 A;  3F4S A;  1K0O A;  2K92 A;  3Q18 A;  4NXI A;  1C72 A;  5F2O A;  3E2D A;  2L5L A;  5KP7 B;  1EMV A;  2YV9 A;  2PUK C;  1GTB A;  2WB9 A;  1NJI Q;  4NHW A;  2VCX A;  1QRJ A;  2VLT A;  3BD2 A;  3KIJ A;  4FH8 A;  1NM3 A;  4IPY A;  3G0V A;  2OBK A;  3KXO A;  4AGS A;  1G6W A;  2PEM A;  4YQM A;  4Z2U A;  3ME8 A;  3N5O A;  1SU9 A;  2CV4 A;  3B5I A;  3ERW A;  2C8U A;  4ZXG A;  4K6X A;  5HFG A;  1YKC A;  3WD6 A;  2PMT A;  4YKG A;  3D5J A;  1ZYP A;  1M6N A;  3LMO A;  1CEI A;  4MK3 A;  4MPF A;  3S9F A;  1SJ6 A;  1GLQ A;  2CVD A;  2KP1 A;  4BVX B;  5GSS A;  3EIN A;  3G21 A;  2PEQ A;  2FA8 A;  1Z5Y E;  2DJ1 A;  4WF4 A;  5IPH A;  3HKR A;  1T7P B;  1K73 Q;  1XWC A;  3VLN A;  2P31 A;  3ZIV A;  1W2B O;  1DBY A;  3CTG A;  2KR5 A;  1YI2 P;  2YWI A;  2MZC A;  4KAE A;  2DJK A;  4V1A g;  1SYR A;  1X9M B;  5ECH B;  4AF2 A;  3MIX A;  2M72 A;  1GSQ A;  4PGT A;  4TVE A;  1GSE A;  3FK8 A;  3MNG A;  2DSA A;  3CCL P;  2TRX A;  4TR1 B;  1WMJ A;  3TKS E;  5H5R A;  1DSB A;  2GS3 A;  4ZL9 A;  4Q5F A;  4N10 A;  2DIY A;  3IAS 2;  2R2J A;  3GZM A;  1WIK A;  5INY A;  1XZO A;  3G28 A;  1IUQ A;  4XS4 A;  3M1M A;  4JR4 A;  2VUP A;  1B48 A;  1DE1 A;  1FHE A;  2H6Y A;  1PFO A;  1YY7 A;  3QAV A;  2X99 A;  5J4U A;  3LEF A;  4BVY B;  2LPK A;  4V2L A;  4ML6 A;  1X3O A;  4TKY A;  2N6Y A;  5IMV A;  1YEX A;  4KX4 A;  2LQQ A;  3C8E A;  4KA0 A;  3TKS A;  2X64 A;  1HNA A;  3QFB C;  4L0W A;  4M0I A;  4GF0 A;  2AFE A;  1PA3 A;  1PRX A;  2J23 A;  1FR2 A;  2XT1 A;  1O81 A;  3A3T A;  3ISO A;  2X8H A;  1QVG O;  4E8H A;  3W8J A;  2ONT A;  5GAN D;  5AIS A;  1M9B A;  3G7Y A;  2L6D A;  1WPI A;  1V2A A;  2M8P A;  1XW6 A;  1GTA A;  1VQ4 P;  5CRE A;  3I69 A;  4NV2 A;  5JCW A;  2YWO A;  3RG6 C;  2AJQ B;  3LJR A;  4CW9 A;  1ZL9 A;  1MEK A;  2G0F A;  3H47 A;  2GLR A;  4BL7 A;  1FB6 A;  4XS4 B;  1GH2 A;  2IL3 A;  4K5R A;  2RII A;  4BPG A;  6GSY A;  1QQ2 A;  5EW5 E;  4MMM A;  2K5X A;  3P05 A;  4ECC A;  1DV5 A;  3TB2 A;  2ERH A;  2MMN A;  5F2K A;  2O8V B;  2WRT A;  5HGM A;  4EDY A;  2VCQ A;  5COH A;  1A2M A;  3GKK A;  1BJX A;  3TOT A;  5F06 A;  1H4O A;  5A4U A;  4POL A;  4JE1 A;  2VD0 A;  3H8Q A;  3CSH A;  3F6F A;  2D2Z A;  2GDW A;  5HGL A;  1M3I A;  2FA4 A;  3BOA A;  4MF7 A;  5G5E A;  5KN3 A;  2RLI A;  1FG4 A;  4AJ6 A;  3GTU A;  4ZB8 A;  3L4N A;  2JAC A;  2H30 A;  2WZ9 A;  1K30 A;  2L6C A;  1WJK A;  2FLS A;  4XRD A;  5IMZ A;  3O3T A;  3KMO A;  5ELG A;  2A2R A;  3CE7 A;  3CMI A;  5H5Q A;  1XPV A;  2GZY A;  3IRA A;  1O85 A;  1E0H A;  2C0E A;  1BAY A;  4QL9 A;  4HU9 A;  4X43 A;  3DIE A;  3TJB A;  3ZMK A;  1S3D A;  4KH7 A;  2M80 A;  2YWN A;  4JZQ A;  1XVQ A;  3GUS A;  4USS A;  5G1L A;  3M8N A;  4LMV A;  1M2B A;  2M8L A;  4MRT C;  3M9J A;  1GTI A;  5EL8 A;  4OO5 A;  3CC7 P;  4F0C A;  2BHV A;  5HQP A;  5KP8 B;  2H8L A;  4XHM A;  3IA1 A;  3KJY A;  4LA1 A;  2H72 A;  2AYT A;  1NW2 A;  2MR7 A;  4FQU A;  1B9X C;  1ML6 A;  5LCZ A;  2CAI A;  3H4K A;  2I3Y A;  2CGQ A;  3LXZ A;  5HR2 A;  1LBK A;  3HD5 A;  3EJB A;  3CD6 P;  4GQF A;  1SK1 A;  3CQF A;  1VQ7 P;  3D0Z A;  1RO0 A;  1V57 A;  3ERG A;  1R7H A;  2I1U A;  5DBQ A;  1EP8 A;  5ECK B;  2H6X A;  2DGY A;  3LW9 A;  1VF1 A;  4DSQ A;  3GJN A;  2CWO A;  4O5R A;  1OC9 A;  2IN3 A;  3VK9 A;  2LIU A;  4XFY A;  2KHP A;  2YZH A;  3QDN A;  3CME P;  3GIX A;  1G7E A;  5LD0 A;  4HZ2 A;  5G31 A;  4BIK A;  2PEJ A;  5C04 A;  11GS A;  4GTU A;  1XCC A;  1S3A A;  1XIY A;  2DJ0 A;  20GS A;  3QR6 A;  3DVW A;  2B5Y A;  4U0C A;  2VD1 A;  5KN2 A;  4PQH A;  1XG8 A;  3TJG A;  3EPT A;  3CBU A;  2CA8 A;  3WGD A;  2GGT A;  2QNW A;  2GZP A;  1TRS A;  3EU3 A;  5DCK A;  2LQO A;  2CNR A;  3D6I A;  1VQK P;  2LJK A;  4EE0 A;  3DRN A;  4OFN A;  2CAQ A;  2KW2 A;  2FWE A;  1U6T A;  3HXS A;  2ROQ A;  1VKU A;  2YAN A;  3HZ8 A;  3QD9 A;  2JU2 A;  3BJ5 A;  2HLS A;  4HZ4 A;  2KOK A;  1K9M Q;  4MLY A;  2HNL A;  1A0F A;  3HVV A;  2H19 A;  1QUW A;  5J3R A;  1EV9 A;  1TJD A;  3E3E A;  4IZ6 A;  2H74 A;  3CRT A;  1HY8 A;  2KP2 A;  3RG2 A;  1SKS B;  1ZYE A;  2XPE A;  2N5F A;  4POM A;  4LLR A;  5IM9 A;  1A8Y A;  2O85 A;  1PN9 A;  1WWJ A;  3GUR A;  1TI1 A;  1EGR A;  4MCU A;  1QGV A;  3QAG A;  1O6J A;  2HFD A;  3G29 A;  4G0I A;  4MZC A;  1F80 D;  1ZCP A;  1T8E B;  1GUL A;  1BX9 A;  1AUM A;  3WT1 A;  1YJW P;  1M6E X;  2B7K A;  3L0H A;  4GLT A;  1X9W B;  3HZQ A;  1OC3 A;  2KG9 A;  3CC2 P;  3DXB A;  3VWW A;  4F37 A;  1NHO A;  4O5U A;  1VHN A;  2K93 A;  5DJL A;  1UJZ A;  2XPD A;  3G9B A;  4CA3 A;  2AUV A;  2VL2 A;  4TXO B;  2LTK A;  2QKE A;  3WGE A;  4WBR D;  4NWY A;  3PIN A;  2XBQ A;  4IHU A;  1T3B A;  2KWL A;  3GMF A;  4KB3 A;  2JYG A;  3ZIT A;  4ICY A;  4DEJ A;  2NBS A;  4K2D A;  5DJM A;  2MMO A;  5F8B A;  5ECL B;  3VFI A;  2PEN A;  2WGR A;  3P7X A;  2AHE A;  4DSR A;  3HVX A;  4XTS A;  2NTO A;  5CP1 A;  2M46 A;  4G0L A;  3EU4 A;  4OCE A;  4POK A;  4EKZ A;  2JZT A;  4I8B A;  1RW1 A;  2VLN A;  4P3Y B;  3F0I A;  3KMN A;  4OFT A;  3QPM A;  2IFQ A;  1TRU A;  4OCF A;  2H71 A;  2AAW A;  4BVY A;  3CXG A;  1ABA A;  2DBC A;  2JQ4 A;  2FVA A;  1U87 A;  1T8K A;  2H76 A;  1OKT A;  3GSS A;  2GQK A;  3F63 A;  3CSJ A;  1PQN A;  1FW1 A;  1GRX A;  2WS2 A;  1OAZ A;  4GCI A;  1XOB A;  1VF3 A;  2AB6 A;  1SK0 A;  1QFN A;  1YJN P;  2X8G A;  1F9M A;  3GKM A;  1V40 A;  3LGC A;  3P2A A;  5DCH A;  4H2X C;  1EGO A;  2YNX A;  4TRX A;  1K0D A;  4MJA A;  3DD3 A;  2AVA A;  4EIP A;  4KDY A;  2WFC A;  4EO3 A;  1XBS A;  5HV8 A;  1GSD A;  2PVO C;  1CQH A;  1TK8 B;  4PUA A;  2C80 A;  3TJJ A;  3WGX A;  3CPW O;  3W6G A;  2OAR A;  4QQ7 A;  3EWL A;  4COP A;  3CCQ P;  2JGP A;  4Q5N A;  4GST A;  4X1U A;  4GR2 A;  2GZG A;  1M0U A;  2B1K A;  2XHF A;  3KTB A;  3E9J B;  3ZML A;  5BRT A;  5KN0 A;  2GZI A;  1S3R A;  2P5Q A;  4PQ1 A;  2BTO T;  3V1W A;  1Z7R A;  1B4P A;  2JAD A;  3CCS P;  3FZ4 A;  2K0D X;  2H66 A;  3Q6O A;  2DJJ A;  4PX1 A;  4L5L A;  1YIT P;  1XW5 A;  2CT6 A;  3UBK A;  2KGC A;  4EVM A;  2VCZ A;  5KOX A;  1ZMA A;  1SEN A;  4O7H A;  2PER A;  3RPN A;  3MWH A;  2QA4 P;  1E6J P;  2TRC P;  1A2L A;  4GSN A;  3WT2 A;  3VRL C;  2HZE A;  3ZL5 A;  4TR3 A;  1R5A A;  5ID2 B;  5CYY A;  4WR4 A;  2YJ7 A;  4ID0 A;  1SL0 B;  1ERT A;  2H75 A;  2GT5 A;  3GKX A;  3OR5 A;  3HJP A;  3L9U A;  3M9K A;  3TCO A;  4MDC A;  5DDL A;  2VLO A;  4BPH A;  1FAA A;  3R3E A;  5IMC A;  3TUE A;  1SKR B;  5KOW A;  1M2A A;  2RUF A;  3QMX A;  2KGE A;  1ZOF A;  3EVI A;  2HRN A;  1T4Y A;  2GTU A;  1GWC A;  3UBL A;  4NAX A;  4TR0 A;  2VLQ A;  2LJR A;  4OO4 A;  1M99 A;  4MH2 A;  2QC7 A;  5AIX A;  3IDV A;  1F2E A;  1PKW A;  3FR3 A;  1M3J A;  4KSO A;  3GKN A;  3PPU A;  2B5E A;  1HQO A;  2VL3 A;  2R6K A;  2DC5 A;  4HSC X;  4LL4 B;  1KEB A;  3DTJ A;  1SD9 A;  3F6D A;  5IOX A;  3L78 A;  2JU1 A;  4NMU A;  1O73 A;  1WOU A;  5FT3 A;  3DYR A;  3GL3 A;  2V32 A;  3APS A;  2VLU A;  3O6T A;  1BQ7 A;  5A4W A;  5IO2 A;  1GSY A;  6GSU A;  2HI7 A;  2PEI A;  2WCI A;  2B1L A;  2EG5 A;  3GTU B;  2V1M A;  2NDO A;  4IP6 A;  2FAD A;  1PL2 A;  5DAL A;  2E7P A;  2G2Q A;  4WEY A;  5J9B A;  2L6E A;  2C3N A;  3UL3 A;  4F0B A;  2I9H A;  4GRF A;  1X0R A;  2VAF A;  2X49 A;  1K3O A;  1PX6 A;  1Z7P A;  5LNK e;  4K7O A;  1MTC A;  3CCR P;  1V9W A;  4IQA A;  2KGD A;  5DQY A;  3C7M A;  4HKG A;  3APQ A;  1T1V A;  2UZ8 A;  2H0H A;  4AJ8 A;  3D4T A;  3CRU A;  4EC0 A;  3O76 A;  1U88 A;  2QGV A;  4A5P A;  4ECI A;  1YF0 A;  4K1F A;  2GT6 A;  2HSY A;  4YQU A;  5ECS A;  2MD9 A;  4Z2T A;  4ECB A;  3L9V A;  3G71 P;  1FOH A;  3CCU P;  2AV4 A;  3IC4 A;  4N0V A;  1MZ8 A;  3ZRD A;  1TRW A;  1K0M A;  1PN0 A;  2HT9 A;  3HY2 A;  1URM A;  3GN3 A;  2PEO A;  4FYC A;  2JZS A;  2HE3 A;  2Z46 A;  3IR4 A;  1V58 A;  4Q5R A;  3ZLP A;  1E2Y A;  5HFK A;  4ISD A;  1CQG A;  2EIQ A;  3DGQ A;  3LYP A;  1GSS A;  5B6M A;  2HSM A;  3TRQ A;  5EJD A;  2KGA A;  5IO0 A;  5G2Z A;  1VF2 A;  2H01 A;  3VPQ A;  1XOA A;  4U0B A;  1AYI A;  2BMX A;  5ECM B;  4E8E A;  2KUC A;  4ZIL A;  3HDC A;  3GX8 A;  3WBH A;  1ON4 A;  4Z7X A;  3UJ1 A;  3UOM A;  1OC8 A;  1SD8 A;  4V2N A;  5DAK A;  1YHQ P;  2K8S A;  5ECR B;  1JZR A;  4I2T A;  2IMK A;  3GH9 A;  1NSW A;  2V2G A;  2H6Z A;  3F4R A;  3Q19 A;  2LNS A;  4PUF C;  2IME A;  12GS A;  2H1D A;  2VCV A;  2H73 A;  3FYG A;  3LOR A;  5BS1 A;  5HGO A;  3RBT A;  3HZ4 A;  3DPH A;  4D73 B;  1JJ2 O;  4IP1 A;  1MDI A;  1EIA A;  4X4J A;  4J57 E;  2O7K A;  3DKS A;  2C0D A;  2H1G A;  3D21 A;  4GR6 A;  4G9H A;  1IYH A;  4X0X A;  4RUV A;  2CQ8 A;  2DJ2 A;  2NPB A;  1TK0 B;  4IQ1 A;  1GUK A;  2FHS C;  3EMP A;  3NY7 B;  2GSR A;  4RQR A;  4POB A;  2OAC A;  1Z9H A;  2EC4 A;  1BG5 A;  4HOJ A;  2CX4 A;  4I5Q A;  5IMD A;  4WET A;  2MBT A;  3RHC A;  3TGZ A;  4YKF A;  2XZ1 C;  5IPG A;  1A8L A;  2OA7 A;  1U3A A;  2DKH A;  1DUG A;  5B8B A;  2F8F A;  4O32 A;  1Q81 Q;  4IVF A;  5G30 A;  2DML A;  1EP7 A;  1RNI A;  3C1S A;  2IWT A;  3RDW A;  4PQI A;  1JLV A;  3TRP A;  3HYB A;  4TN8 A;  2IPA A;  3RHB A;  1LU4 A;  1KTE A;  2CQ9 A;  1GLP A;  1AC1 A;  5A5K A;  3VI7 A;  2PEK A;  1TTZ A;  2DJ3 A;  4J56 E;  2B5X A;  2L57 A;  1PGT A;  5DCG A;  4QL7 A;  2JB0 A;  2VSQ A;  4K2X A; 
#chains in the Genus database with same CATH homology
 1HYU A;  5F07 A;  5D96 A;  1AXD A;  5B7C A;  3DWV A;  4YQV A;  2E2M A;  1GUH A;  4EUY A;  3FW2 A;  1EZK A;  3EE2 A;  4CHS A;  1M2D A;  4DSS B;  1PKZ A;  3LSZ A;  5DAL B;  3L9S A;  4GWR A;  2A4H A;  1AQX A;  1TU8 A;  1GNW A;  4ZBB A;  5AN1 A;  2K9F A;  2FGX A;  2I81 A;  4EF0 A;  3IV4 A;  3TJK A;  1YF1 A;  3VWX A;  1WE0 A;  3TDG A;  4F82 A;  1UC7 A;  1Z3E A;  2ON5 A;  2VO4 A;  5GZZ B;  1U3I A;  1EEM A;  2YWM A;  3K8N A;  4HS1 A;  4HDE A;  4KDU A;  4CDO A;  3QOU A;  4BVX A;  2VLV A;  4F9Z A;  5CNW A;  2K18 A;  1HNB A;  4I97 A;  1PL1 A;  4YH2 A;  2RM6 A;  4KUN A;  14GS A;  4FYU A;  2OAD A;  2QA2 A;  5A4V A;  2JSY A;  3QFA C;  2R4V A;  2YZU A;  5D9V A;  2R3X A;  4V2M A;  2F3M A;  3CTF A;  2C0G A;  1S3C A;  2A2S A;  4MZW A;  3D22 A;  2GSS A;  2B3S A;  1PD2 1;  2F51 A;  3N9J A;  3G7I A;  2WUL A;  5DVB A;  4MF5 A;  19GS A;  5D8I A;  1O8X A;  5FHI A;  3NZN A;  6GSW A;  1OKD A;  3TKR A;  3FRC A;  2H70 A;  5G5F A;  2DLX A;  2HYX A;  2GDR A;  5IMA A;  2VCW A;  5CRD A;  2FUG 2;  1B9Y C;  3GRX A;  1G0T A;  7GSS A;  1EOG A;  2C3T A;  1OC9 B;  4IJI A;  5EY6 A;  4G2E A;  3KH9 A;  2VIM A;  1YEP A;  4FIW A;  3GFK A;  2N5B A;  3US3 A;  3EYT A;  2OE1 A;  2QA1 A;  2OE3 A;  1WRY A;  1DE2 A;  3HYP A;  2NVL A;  1OE7 A;  6GSS A;  1X5C A;  2LS5 A;  5JCG A;  1K0B A;  1J0F A;  2X4A A;  2Z9S A;  1B4Q A;  2VL9 A;  4MA9 A;  4IEL A;  3IAM 2;  1AUC A;  5JWO B;  1Y6E A;  3ZZX A;  2GSQ A;  1EWX A;  3LYK A;  4K0G A;  1RK4 A;  1JZW A;  2IMI A;  4ZB9 A;  5IMF A;  3J7Y b;  3H93 A;  3KM6 A;  3KEB A;  3EUR A;  1HD2 A;  2KLX A;  2JSZ A;  2HSH A;  4K0N A;  2P0G A;  2REM A;  3UAR A;  1AQW A;  4CY8 A;  2PBJ A;  4JRR A;  4HJM A;  3FR9 A;  3FHK A;  3IHG A;  1GNE A;  1ST9 A;  4MF6 A;  2MBS A;  2EIR A;  4AJ7 A;  3BCK A;  4I6X A;  3BBY A;  1W89 A;  4Q5Q A;  3KP8 A;  2IMF A;  1YZX A;  4KND A;  4JU5 A;  1QXH A;  1IYI A;  1TKD B;  1M9A A;  4FO5 A;  2DIZ A;  1SL1 B;  2C1Y A;  3F3R A;  3FZA A;  4H86 A;  5F0G A;  1VGL A;  4XIH A;  3VUR A;  4JED A;  1QK8 A;  4HI7 A;  2RUE A;  4EIQ A;  3GST A;  3IHQ A;  2LUS A;  1GUM A;  2XBI A;  2CZ3 A;  1TU7 A;  5ECO B;  4GXZ A;  3VWU A;  1TW9 A;  4K7I A;  3FKF A;  3TOU A;  3C1R A;  1Q4J A;  4DVC A;  2LRN A;  1F3B A;  2IJY A;  5J41 A;  2L4C A;  3IK9 A;  3PGT A;  5L71 A;  1G6Y A;  2FD3 A;  1EOH A;  2R5G A;  1R26 A;  4KE3 A;  2A2P A;  1ZZY A;  2EIO A;  3PH9 A;  4HJ2 A;  3A2V A;  5D9X A;  3ZIJ A;  4TR1 A;  2OKA A;  2FWG A;  1E6B A;  2WDU A;  2LV3 A;  2F9S A;  3FEU A;  2YPM A;  2H0I A;  3M1G A;  4G0K A;  2LNT A;  2H1B A;  3KCM A;  1SYX A;  3A5I A;  4KW6 A;  5ENU A;  2P5R A;  3JCM L;  3IC8 A;  2HZF A;  5KN1 A;  4WKW A;  5IOW A;  4IKH A;  4J2F A;  5ECI B;  1TK5 B;  1JZO A;  3U5R E;  1XVW A;  1XWA A;  3A2X A;  3SBC A;  4G10 A;  1ZYQ B;  4TR4 A;  1A0R P;  1Z6N A;  5GST A;  4IS0 A;  3I43 A;  5E4W A;  1X5D A;  4MNN A;  3LFL A;  2R0G A;  3GV1 A;  5C00 A;  5IQY A;  2R0C A;  1W4V A;  1TP9 A;  1MD4 A;  2XC2 A;  4BPY A;  2VM1 A;  3LXT A;  4D73 A;  3ZYW A;  4OWY A;  3MDK A;  5D93 A;  5J9C A;  3HVS A;  4MPG A;  3M3M A;  4JBB A;  1AQV A;  4N30 A;  3ZVJ D;  2LRC A;  2V41 A;  3ME7 A;  1F3A A;  5J5N A;  5KEJ A;  4MP4 A;  2VOC A;  1XWB A;  4DSS A;  3HA9 A;  5DAK B;  5ELA A;  5JWR B;  1O7U A;  2YJH A;  1OE8 A;  2GQM A;  3F8U A;  2OBI A;  4EL1 A;  1ACV A;  3FZ5 A;  2R37 A;  3ZRE A;  1SL2 B;  2HRF A;  1X5E A;  4BWQ A;  4WBJ A;  2C3Q A;  3HJM A;  4F2I A;  1USB A;  1XXU A;  4TOP A;  3UVH A;  4N0Z A;  2ZCT A;  5AGY A;  2LKU A;  3LQ7 A;  2J9H A;  4RI7 A;  4PUR A;  5FWG A;  5CAX A;  10GS A;  3FY7 A;  4ACS A;  3ZVJ A;  5CO3 A;  3ERF A;  5ECQ B;  5CRG A;  2FHE A;  4RI6 A;  4MZB A;  4ZL8 A;  4MJB A;  1N2A A;  2VL2 C;  4K9Z A;  2PN8 A;  1XFL A;  3AY8 A;  4IN0 A;  3QAW A;  2ZUP A;  3EMX A;  4K7N A;  2YCD A;  1JFU A;  1TI3 A;  3ZTL A;  2CVB A;  4HQS A;  3F9U A;  3GA4 A;  3J7Y k;  1THO A;  1JHB A;  4XS6 A;  1UN2 A;  1V98 A;  18GS A;  4KF9 A;  5EPF A;  1YDK A;  2C4J A;  5AIV A;  1SJZ A;  2MMZ A;  1R4W A;  4WR5 A;  2HRA A;  1YJ6 A;  2R0P A;  1FVJ A;  2QSI A;  2PGT A;  4JR6 A;  1SKW B;  4GSS A;  2F8A A;  4LL1 B;  3TKS C;  3KGK A;  4O92 A;  1OYJ A;  1K3L A;  3MAK A;  3UVT A;  3FMW A;  3D4M A;  3GX0 A;  4TXV A;  1EEJ A;  22GS A;  5ECP B;  3DVX A;  3HHV A;  2K8V A;  1T00 A;  5ECN B;  4ZIJ A;  2L4Q A;  2CZ2 A;  3UEM A;  4BA7 A;  3C73 A;  2FY6 A;  4PNF A;  9GSS A;  3UAP A;  4KSM A;  4KDX A;  4G19 A;  2C0F A;  3GH6 A;  1MDJ A;  1FO5 A;  4IW9 A;  2ON7 A;  1K0N A;  3F4T A;  3I6A A;  1BYE A;  4MJE A;  3PR8 A;  1A2J A;  3CSI A;  4ZL7 A;  1J08 A;  2OE0 A;  3R2Q A;  4WXT A;  1PSQ A;  1K0C A;  3I9V 2;  3IOS A;  1XWG A;  4ECJ A;  3ZFB A;  3DML A;  4ZB6 A;  1ERW A;  2IIY A;  1A24 A;  3IE3 A;  4YAP A;  2OJL A;  2A4V A;  1PX7 A;  4K5S A;  5D73 A;  1XWK A;  4NPB A;  1YQ1 A;  3FZ9 A;  3GYK A;  2FWH A;  1SK2 A;  2H1A A;  2CX3 A;  1RQM A;  5HR0 A;  4N11 A;  1I5G A;  4KCE A;  1HNC A;  2LJA A;  2GST A;  1KNG A;  2LST A;  13GS A;  16GS A;  1BED A;  2MMA A;  2L59 A;  1GTU A;  4IBP A;  2GVP A;  2X8C A;  3GNJ A;  4ULX A;  1GP1 A;  1Y25 A;  4NV5 A;  5F05 A;  2PU9 C;  4O5Q A;  1NHY A;  4ZBD A;  4TW5 A;  1O8W A;  2L5O A;  3APO A;  3WYW A;  1G7O A;  5CRH A;  4PNG A;  1ERU A;  2PVQ A;  3KTL A;  1MDK A;  4HUA A;  3MYD A;  1XW9 A;  3EC3 A;  3IXR A;  1VRS D;  1FOV A;  2WJU A;  1KBN A;  1JLW A;  1WP0 A;  3W8S A;  4IJ3 A;  6GSV A;  4ZBA A;  2FCH A;  17GS A;  3M0F A;  4K8M A;  4F03 A;  1GL8 A;  5JWQ B;  3SWL A;  2FNO A;  2O89 A;  4KGI A;  1UVZ A;  2TIR A;  4MJC A;  4V1A p;  5EVO A;  1H75 A;  2IFQ B;  2V6K A;  4XS1 A;  1QMV A;  5HFI A;  2N5A A;  5B8A A;  3QCP A;  3H79 A;  4GQC A;  4OMV A;  3VI5 A;  4BWS A;  1AAZ A;  2H0G A;  1VF4 A;  3H1N A;  3TJF A;  2HZE B;  2B7J A;  4MAB A;  5HR3 A;  3ZFL A;  2RM5 A;  2VCT A;  1ZGN A;  2DKI A;  3RAZ A;  3TRX A;  2YN1 A;  3TKP A;  6GST A;  1ILO A;  3RPP A;  1Q98 A;  3E0U A;  4FYB A;  1FB0 A;  3A2W A;  4EDZ A;  1J9B A;  4EXJ A;  1FVK A;  1GSF A;  1R5P A;  3CYN A;  3HCZ A;  3A5W A;  2LRT A;  5JCU A;  2LEG A;  1M7T A;  1GSU A;  4WF5 A;  4YAV A;  3G7J A;  2I4A A;  2E0Q A;  3FR6 A;  3LWA A;  4MH3 A;  5CRW A;  1Z6M A;  2GZZ A;  4HU7 A;  2BJX A;  4XCS A;  2YOI A;  3F3Q A;  6GSX A;  1THX A;  2ALB A;  2ES7 A;  1JZD A;  2CVK A;  1TOF A;  3KZQ A;  3NIV A;  4Z2R A;  3C71 A;  3IPZ A;  3LG6 A;  1A23 A;  5GAP D;  4PTS A;  1LJR A;  2ZNM A;  3GHA A;  2YP6 A;  4L8E A;  5E59 A;  3UIW A;  1K0A A;  8GSS A;  3DEX A;  2JL4 A;  3TKQ A;  2E2G A;  1PMT A;  3KH7 A;  5ABR A;  1AIU A;  2JU5 A;  1ZYN A;  3IBH A;  4PXO A;  4ILF A;  4RQX A;  1T4Z A;  3GL5 A;  1B8X A;  3KD0 A;  1TRV A;  4ML1 A;  2PPT A;  3KP9 A;  3VWV A;  1TXX A;  2K6V A;  3HJO A;  4XRA A;  2HXK A;  3IK7 A;  5DQS A;  4I2U A;  4NHZ A;  1MD3 A;  3U6V A;  1SJI A;  3P90 A;  4CY6 A;  2VM2 A;  4IGJ A;  1AW9 A;  3P8W A;  5HR1 A;  1I9D A;  3VPT A;  1X9S B;  4OD7 A;  4LMW A;  2O87 A;  1TDI A;  1F37 A;  4HQZ A;  2JZR A;  4TXO A;  5H5S A;  1ERV A;  1YKA A;  3BCI A;  2B6M A;  2IMD A;  1UA5 A;  4L5O A;  4BL7 B;  2FWF A;  5D9W A;  5IIZ A;  3UMA A;  4OFM A;  2MYG A;  5B6N A;  4L0U A;  5G1K A;  1F6M C;  3NOF A;  4KCA A;  1OVN A;  2HRK A;  5D9T A;  2PWJ A;  3ED3 A;  5BMU A;  2V6O A;  3Q74 A;  2YV7 A;  1K3Y A;  1N8J A;  1EV4 A;  2GQL A;  3MSZ A;  2DMM A;  5ID2 A;  4HEA 2;  3F4S A;  1K0O A;  3Q18 A;  4NXI A;  1C72 A;  2L5L A;  2YV9 A;  2PUK C;  1GTB A;  2WB9 A;  4NHW A;  2VCX A;  2VLT A;  3BD2 A;  3KIJ A;  4FH8 A;  1NM3 A;  2OBK A;  3KXO A;  4AGS A;  1G6W A;  4YQM A;  4Z2U A;  3ME8 A;  3N5O A;  1SU9 A;  2CV4 A;  3ERW A;  2C8U A;  4ZXG A;  5HFG A;  4K6X A;  1YKC A;  3WD6 A;  2PMT A;  4YKG A;  3D5J A;  1ZYP A;  4MK3 A;  4MPF A;  3S9F A;  1SJ6 A;  1GLQ A;  2CVD A;  2KP1 A;  4BVX B;  5GSS A;  3EIN A;  2FA8 A;  4WF4 A;  1Z5Y E;  2DJ1 A;  5IPH A;  3HKR A;  1T7P B;  1XWC A;  3VLN A;  2P31 A;  3ZIV A;  1DBY A;  3CTG A;  2YWI A;  2MZC A;  4KAE A;  2DJK A;  4V1A g;  1SYR A;  1X9M B;  5ECH B;  4AF2 A;  3MIX A;  2M72 A;  1GSQ A;  4PGT A;  4TVE A;  1GSE A;  3FK8 A;  3MNG A;  2DSA A;  2TRX A;  4TR1 B;  1WMJ A;  3TKS E;  5H5R A;  1DSB A;  2GS3 A;  4ZL9 A;  4Q5F A;  4N10 A;  2DIY A;  3IAS 2;  2R2J A;  1WIK A;  5INY A;  1XZO A;  4XS4 A;  4JR4 A;  2VUP A;  1B48 A;  1DE1 A;  1FHE A;  2H6Y A;  1YY7 A;  3QAV A;  2X99 A;  5J4U A;  3LEF A;  4BVY B;  4V2L A;  4ML6 A;  4TKY A;  5IMV A;  1YEX A;  4KX4 A;  2LQQ A;  3C8E A;  4KA0 A;  3TKS A;  2X64 A;  1HNA A;  3QFB C;  4L0W A;  4GF0 A;  1PA3 A;  1PRX A;  2J23 A;  1O81 A;  3A3T A;  3ISO A;  2X8H A;  4E8H A;  3W8J A;  5GAN D;  5AIS A;  1M9B A;  3G7Y A;  2L6D A;  1WPI A;  1V2A A;  1XW6 A;  1GTA A;  5CRE A;  3I69 A;  4NV2 A;  5JCW A;  2YWO A;  2AJQ B;  3LJR A;  4CW9 A;  1ZL9 A;  1MEK A;  2G0F A;  2GLR A;  4BL7 A;  1FB6 A;  4XS4 B;  1GH2 A;  2IL3 A;  4K5R A;  2RII A;  6GSY A;  1QQ2 A;  4MMM A;  4ECC A;  3TB2 A;  2MMN A;  2O8V B;  2WRT A;  4EDY A;  2VCQ A;  5COH A;  1A2M A;  3GKK A;  1BJX A;  3TOT A;  5F06 A;  1H4O A;  5A4U A;  4POL A;  4JE1 A;  2VD0 A;  3H8Q A;  3CSH A;  3F6F A;  2D2Z A;  2FA4 A;  3BOA A;  5G5E A;  4MF7 A;  5KN3 A;  2RLI A;  1FG4 A;  4AJ6 A;  3GTU A;  4ZB8 A;  3L4N A;  2JAC A;  2H30 A;  2WZ9 A;  2L6C A;  1WJK A;  2FLS A;  4XRD A;  5IMZ A;  3O3T A;  3KMO A;  5ELG A;  2A2R A;  3CMI A;  5H5Q A;  1XPV A;  2GZY A;  3IRA A;  1O85 A;  2C0E A;  1BAY A;  4QL9 A;  4HU9 A;  4X43 A;  3DIE A;  3TJB A;  3ZMK A;  1S3D A;  4KH7 A;  2M80 A;  2YWN A;  4JZQ A;  1XVQ A;  3GUS A;  4USS A;  5G1L A;  3M8N A;  4LMV A;  1M2B A;  3M9J A;  1GTI A;  5EL8 A;  4OO5 A;  4F0C A;  5HQP A;  2H8L A;  4XHM A;  3IA1 A;  3KJY A;  4LA1 A;  2H72 A;  2AYT A;  1NW2 A;  4FQU A;  1B9X C;  1ML6 A;  5LCZ A;  2CAI A;  3H4K A;  2I3Y A;  3LXZ A;  5HR2 A;  1LBK A;  3HD5 A;  4GQF A;  1SK1 A;  3D0Z A;  1V57 A;  3ERG A;  1R7H A;  2I1U A;  5DBQ A;  1EP8 A;  5ECK B;  2H6X A;  3LW9 A;  1VF1 A;  4DSQ A;  4O5R A;  1OC9 A;  2IN3 A;  3VK9 A;  2KHP A;  2YZH A;  3QDN A;  3GIX A;  1G7E A;  5LD0 A;  4HZ2 A;  5G31 A;  5C04 A;  11GS A;  4GTU A;  1XCC A;  1S3A A;  1XIY A;  2DJ0 A;  20GS A;  3QR6 A;  3DVW A;  2B5Y A;  2VD1 A;  5KN2 A;  4PQH A;  3TJG A;  3EPT A;  3CBU A;  2CA8 A;  3WGD A;  2GGT A;  2GZP A;  1TRS A;  3EU3 A;  2LQO A;  3D6I A;  2LJK A;  4EE0 A;  3DRN A;  4OFN A;  2CAQ A;  2FWE A;  1U6T A;  3HXS A;  3HZ8 A;  2YAN A;  3QD9 A;  3BJ5 A;  2HLS A;  4HZ4 A;  2KOK A;  4MLY A;  2HNL A;  1A0F A;  3HVV A;  2H19 A;  1QUW A;  5J3R A;  1EV9 A;  1TJD A;  3E3E A;  2H74 A;  3CRT A;  2KP2 A;  1SKS B;  1ZYE A;  2XPE A;  2N5F A;  4POM A;  4LLR A;  5IM9 A;  1A8Y A;  2O85 A;  1PN9 A;  1WWJ A;  3GUR A;  1TI1 A;  1EGR A;  4MCU A;  1QGV A;  3QAG A;  1O6J A;  2HFD A;  4G0I A;  4MZC A;  1ZCP A;  1T8E B;  1GUL A;  1BX9 A;  3WT1 A;  2B7K A;  3L0H A;  4GLT A;  1X9W B;  1OC3 A;  3DXB A;  3VWW A;  1NHO A;  4O5U A;  5DJL A;  2XPD A;  3G9B A;  2VL2 A;  2AUV A;  4TXO B;  2LTK A;  2QKE A;  3WGE A;  4WBR D;  4NWY A;  3PIN A;  2XBQ A;  4IHU A;  1T3B A;  3GMF A;  4KB3 A;  3ZIT A;  4ICY A;  4DEJ A;  2NBS A;  4K2D A;  5DJM A;  2MMO A;  5F8B A;  5ECL B;  3VFI A;  2WGR A;  3P7X A;  2AHE A;  4DSR A;  3HVX A;  5CP1 A;  2NTO A;  4XTS A;  2M46 A;  4G0L A;  3EU4 A;  4OCE A;  4POK A;  4EKZ A;  2JZT A;  4I8B A;  1RW1 A;  4P3Y B;  3F0I A;  3KMN A;  4OFT A;  3QPM A;  2IFQ A;  1TRU A;  4OCF A;  2H71 A;  2AAW A;  4BVY A;  3CXG A;  1ABA A;  2DBC A;  1U87 A;  2H76 A;  1OKT A;  3GSS A;  2GQK A;  3F63 A;  3CSJ A;  1PQN A;  1FW1 A;  1GRX A;  2WS2 A;  1OAZ A;  4GCI A;  1XOB A;  1VF3 A;  2AB6 A;  1SK0 A;  1QFN A;  2X8G A;  1F9M A;  3GKM A;  1V40 A;  3LGC A;  3P2A A;  5DCH A;  1EGO A;  2YNX A;  4TRX A;  1K0D A;  4MJA A;  3DD3 A;  4EIP A;  4KDY A;  2WFC A;  4EO3 A;  1XBS A;  1GSD A;  2PVO C;  1CQH A;  1TK8 B;  4PUA A;  2C80 A;  3TJJ A;  3WGX A;  3W6G A;  4QQ7 A;  3EWL A;  4Q5N A;  4GST A;  4X1U A;  2B1K A;  1M0U A;  2XHF A;  3KTB A;  3E9J B;  3ZML A;  5BRT A;  5KN0 A;  2P5Q A;  4PQ1 A;  2BTO T;  3V1W A;  1Z7R A;  1B4P A;  2JAD A;  3FZ4 A;  2H66 A;  3Q6O A;  2DJJ A;  4PX1 A;  4L5L A;  1XW5 A;  2CT6 A;  3UBK A;  4EVM A;  2VCZ A;  5KOX A;  1ZMA A;  1SEN A;  4O7H A;  2PER A;  3RPN A;  3MWH A;  2TRC P;  1A2L A;  4GSN A;  3WT2 A;  2HZE A;  3ZL5 A;  4TR3 A;  1R5A A;  5ID2 B;  5CYY A;  4WR4 A;  2YJ7 A;  4ID0 A;  1SL0 B;  1ERT A;  2H75 A;  2GT5 A;  3GKX A;  3OR5 A;  3HJP A;  3L9U A;  3M9K A;  3TCO A;  4MDC A;  5DDL A;  1FAA A;  3R3E A;  5IMC A;  3TUE A;  1SKR B;  5KOW A;  1M2A A;  2RUF A;  3QMX A;  1ZOF A;  3EVI A;  2HRN A;  1T4Y A;  2GTU A;  1GWC A;  3UBL A;  4NAX A;  4TR0 A;  2LJR A;  4OO4 A;  1M99 A;  4MH2 A;  2QC7 A;  5AIX A;  3IDV A;  1F2E A;  1PKW A;  3FR3 A;  4KSO A;  3GKN A;  3PPU A;  2B5E A;  1HQO A;  2VL3 A;  2R6K A;  2DC5 A;  4LL4 B;  1KEB A;  1SD9 A;  3F6D A;  5IOX A;  3L78 A;  4NMU A;  1O73 A;  1WOU A;  5FT3 A;  3DYR A;  3GL3 A;  2V32 A;  3APS A;  2VLU A;  3O6T A;  1BQ7 A;  5A4W A;  5IO2 A;  1GSY A;  6GSU A;  2HI7 A;  2WCI A;  2B1L A;  3GTU B;  2V1M A;  2NDO A;  4IP6 A;  1PL2 A;  5DAL A;  2E7P A;  2G2Q A;  4WEY A;  5J9B A;  2C3N A;  3UL3 A;  4F0B A;  2I9H A;  4GRF A;  1X0R A;  2VAF A;  2X49 A;  1K3O A;  1PX6 A;  1Z7P A;  5LNK e;  4K7O A;  1MTC A;  1V9W A;  4IQA A;  5DQY A;  3C7M A;  3APQ A;  1T1V A;  2UZ8 A;  2H0H A;  4AJ8 A;  3D4T A;  3CRU A;  4EC0 A;  3O76 A;  1U88 A;  2QGV A;  4A5P A;  4ECI A;  1YF0 A;  4K1F A;  2GT6 A;  2HSY A;  4YQU A;  5ECS A;  4Z2T A;  4ECB A;  3L9V A;  1FOH A;  2AV4 A;  3IC4 A;  4N0V A;  3ZRD A;  1TRW A;  1K0M A;  1PN0 A;  2HT9 A;  3HY2 A;  1URM A;  3GN3 A;  4FYC A;  2JZS A;  2HE3 A;  3IR4 A;  1V58 A;  4Q5R A;  3ZLP A;  1E2Y A;  5HFK A;  4ISD A;  1CQG A;  2EIQ A;  3DGQ A;  3LYP A;  1GSS A;  5B6M A;  2HSM A;  3TRQ A;  5IO0 A;  5G2Z A;  1VF2 A;  2H01 A;  3VPQ A;  1XOA A;  5ECM B;  2BMX A;  4E8E A;  2KUC A;  4ZIL A;  3HDC A;  3GX8 A;  1ON4 A;  3UJ1 A;  3UOM A;  4Z7X A;  1OC8 A;  1SD8 A;  4V2N A;  5DAK A;  2K8S A;  5ECR B;  1JZR A;  4I2T A;  2IMK A;  3GH9 A;  1NSW A;  2V2G A;  2H6Z A;  3F4R A;  3Q19 A;  2LNS A;  4PUF C;  2IME A;  12GS A;  2H1D A;  2VCV A;  2H73 A;  3FYG A;  3LOR A;  3RBT A;  3HZ4 A;  4D73 B;  4IP1 A;  1MDI A;  4X4J A;  4J57 E;  2O7K A;  3DKS A;  2C0D A;  2H1G A;  3D21 A;  4G9H A;  1IYH A;  4X0X A;  4RUV A;  2DJ2 A;  2NPB A;  1TK0 B;  4IQ1 A;  1GUK A;  3EMP A;  2GSR A;  4RQR A;  4POB A;  2OAC A;  1Z9H A;  2EC4 A;  1BG5 A;  4HOJ A;  2CX4 A;  4I5Q A;  5IMD A;  4WET A;  2MBT A;  3RHC A;  3TGZ A;  4YKF A;  5IPG A;  1A8L A;  2OA7 A;  1U3A A;  2DKH A;  1DUG A;  5B8B A;  2F8F A;  4O32 A;  4IVF A;  5G30 A;  2DML A;  1EP7 A;  3C1S A;  2IWT A;  3RDW A;  4PQI A;  1JLV A;  3TRP A;  4TN8 A;  2IPA A;  3RHB A;  1LU4 A;  1KTE A;  2CQ9 A;  1GLP A;  1AC1 A;  5A5K A;  3VI7 A;  1TTZ A;  2DJ3 A;  4J56 E;  2B5X A;  2L57 A;  1PGT A;  5DCG A;  4QL7 A;  4K2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...