1Z6MA

Structure of conserved protein of unknown function from enterococcus faecalis v583
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
175
structure length
175
Chain Sequence
SNAMDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELLAQSVKSGKVERIIKLFDKEKESLQRGNVMHHYIDYSAPEQALSALHKMFATQDEWGNLTLEEVATYAEKNLGLKEQKDATLVSAVIAEANAAHIQFVPTIIIGEYIFDESVTEEELRGYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Structure of a conserved hypothetical protein from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 57
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.90 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A DsbA-like domain 1z6mA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1z6mA01
4YH2A 3WD6A 3L78A 4MJBA 2WFCA 3FW2A 5G30A 5F07A 4F9ZA 5DQSA 3IXRA 3CSIA 4L8EA 4MP4A 4MZBA 3EU4A 1HQOA 2LJKA 2HZEB 5IPHA 3A3TA 1YF1A 4KCEA 2LEGA 4K6XA 1AQVA 1AQXA 2B3SA 2N5FA 2ES7A 3HY2A 5HR0A 3LYKA 2O7KA 2F51A 1GTUA 5JWRB 2DJ1A 1JZDA 2C0FA 3ZYWA 3IE3A 3QCPA 2VCVA 1Y6EA 1BJXA 4F82A 5EY6A 4ACSA 3GTUB 2X99A 6GSSA 2JZRA 4L0UA 2REMA 2M46A 5KN0A 3TGZA 1EZKA 3GRXA 3DIEA 5B8AA 2WJUA 4ZIJA 2R4VA 4K7IA 3GL3A 1LU4A 5DJLA 2JU5A 1G7EA 2H66A 4I97A 3R2QA 2J9HA 3L0HA 4BA7A 1J9BA 1GP1A 3A2WA 4N11A 4EO3A 1VF1A 1ST9A 1K0MA 3E0UA 1B4PA 2MMOA 1SK0A 3ME8A 1OVNA 4JU5A 2H0HA 4N0VA 2YWMA 1VF3A 3KMNA 1GTAA 3A5WA 3HA9A 4HS1A 1A8YA 5ECQB 1VF2A 1VRSD 1TRSA 4OFMA 3FZ9A 1TOFA 2FWEA 1PL1A 4BVXA 3HHVA 2O89A 4XHMA 1SD9A 1EP7A 1TK0B 4Q5NA 3TJKA 1JLWA 5E4WA 1OAZA 4JR6A 2L4QA 5IMFA 3EU3A 3FY7A 4PUFC 4F0CA 2MMNA 2YNXA 5IIZA 1GLQA 2H30A 5D9XA 2LRNA 1RW1A 2DLXA 3TKSC 2TRCP 4ISDA 3W8SA 3O6TA 2IMDA 3IK7A 3DEXA 1BAYA 1K3OA 3KGKA 1WWJA 4FH8A 3FZ5A 1OKTA 4DEJA 5CNWA 3VI5A 5D8IA 3GKMA 2IMKA 3QPMA 3A2XA 5G1KA 2PUKC 3LWAA 4EVMA 3ERFA 1T3BA 2L5LA 2C3QA 4WR5A 1GH2A 2VUPA 2B1LA 2DJ0A 3IR4A 3Q6OA 1DUGA 3BBYA 1MD4A 2B5YA 4CDOA 1A0FA 1QK8A 4K0NA 1YEPA 1F3BA 8GSSA 2YWNA 1WPIA 5G2ZA 3TKPA 2KOKA 1UC7A 4NXIA 2BJXA 3L4NA 1O8XA 1R26A 2IPAA 2JL4A 3S9FA 2LV3A 3TKSE 5B8BA 20GSA 3NIVA 2GT5A 4JR4A 1NSWA 3ZVJA 1SL2B 3TKRA 1X9SB 3LJRA 5LD0A 1S3DA 2FY6A 3HJMA 2H76A 6GSUA 1WP0A 1U3IA 5J4UA 1S3CA 2MYGA 3C7MA 5DVBA 4ECJA 1Z6MA 3UARA 3GA4A 3ZMKA 2H8LA 4IP1A 1GWCA 1K0BA 3CSJA 4IW9A 1DE2A 5ECHB 4MPFA 2KLXA 1PD21 4NAXA 1W4VA 2CX4A 4HZ4A 4IP6A 5C04A 5CAXA 2V1MA 3FZ4A 1XPVA 2E7PA 2B5EA 1SKWB 4EE0A 2N5BA 4IELA 5COHA 2A2SA 3DGQA 5FHIA 4KNDA 1TK5B 1TXXA 3H93A 4I2UA 3GIXA 1WMJA 2GQLA 2P31A 4K0GA 4JRRA 3A2VA 4HDEA 4ZILA 5LCZA 5DALB 3QFAC 4FYBA 4KDXA 4I2TA 5J9CA 3ZMLA 3D6IA 4XCSA 2VM2A 3ERWA 3OR5A 5B6NA 2K6VA 1BEDA 4F03A 2R2JA 2H72A 2VL2C 2XPDA 1U87A 5IQYA 3M0FA 4MMMA 2K9FA 4KAEA 3KXOA 1Z5YE 2M72A 5G1LA 5CYYA 2QSIA 1JZRA 3ZTLA 3K8NA 4TXVA 14GSA 1B9YC 2YJ7A 1AUCA 1GUHA 4ZBBA 4G2EA 3IA1A 2RUFA 1Z7PA 4P3YB 1XW9A 1XOAA 3J7Yk 1YZXA 4POLA 2P0GA 1K3LA 1PKZA 2JSYA 1MDKA 4JZQA 1VGLA 2IMFA 2YN1A 5AIVA 1EEJA 1FHEA 5HR3A 3QAWA 1Z3EA 2H6ZA 4AJ8A 3HVSA 5DJMA 5DCHA 2H0GA 2MMAA 2H0IA 1AQWA 2GLRA 4WETA 13GSA 4HOJA 3GH9A 2A4VA 4OCEA 1GSEA 3KP8A 5ECSA 1HD2A 5AIXA 3D4MA 4ZB8A 4MH2A 5D73A 1FG4A 1ZOFA 3QD9A 3FYGA 1X5EA 4POBA 2HSHA 3VWUA 5DAKB 1SYRA 3P90A 4ZL8A 1V40A 3ISOA 1BQ7A 4MLYA 4KSMA 4ML1A 5DCGA 3MSZA 2VCWA 2YOIA 5ECNB 1ERVA 2PWJA 3KZQA 2Z9SA 4GQCA 1F37A 3V1WA 1GULA 1SENA 4IHUA 4IQAA 5ECLB 2HI7A 1EV9A 3WT1A 4MF5A 5CRWA 4TR1A 2LNSA 5ENUA 3W6GA 1X5CA 2H73A 5C00A 3IRAA 4MH3A 1PKWA 4XRDA 3GV1A 3RAZA 1FVKA 1OE8A 2DIZA 2VD1A 2VLUA 1XWKA 3C1RA 11GSA 2CVBA 1SD8A 1QMVA 1NHYA 4HQSA 1GRXA 2D2ZA 5HFIA 3ZITA 1CQGA 1HNBA 3TB2A 2AUVA 4HUAA 4F0BA 3TJGA 4ECIA 4EDZA 2LS5A 4GF0A 3TUEA 3RPNA 1F3AA 2QGVA 2HFDA 3KH9A 4EF0A 4AF2A 2O8VB 2P5RA 1EWXA 2YWIA 2VLTA 3ZREA 2OADA 2I1UA 1TDIA 2HLSA 4LLRA 2GDRA 4MK3A 4QL7A 5CRGA 5DQYA 2V32A 1GSSA 1XW6A 5JCWA 3PR8A 3ZLPA 4KDYA 2H75A 1O7UA 2RUEA 3NZNA 1ZYEA 2CZ2A 1Z9HA 2KP2A 3UVTA 3ZL5A 1OC9A 3M3MA 1GTIA 3KP9A 1TTZA 2L6CA 4KCAA 3D22A 2CA8A 5EL8A 4OFNA 2QC7A 4OO5A 3VFIA 2V6KA 4QL9A 3DKSA 2PU9C 3UAPA 3TJJA 4J57E 2MBSA 4PQ1A 1LBKA 3DXBA 4K7OA 3FR9A 1DBYA 1K0DA 4HI7A 2RM6A 2PVQA 2HSYA 1Q4JA 1HNCA 5A4VA 5GAPD 4EXJA 3TJBA 3FKFA 3MDKA 1K0AA 3VWWA 1TU8A 4KH7A 2HYXA 2RLIA 3APSA 1EOHA 1TU7A 1N8JA 1T1VA 2YV9A 1GNWA 3GX8A 2DSAA 3DVXA 2PN8A 1DE1A 3QFBC 3APOA 2MZCA 1XZOA 4K2DA 1H75A 1V58A 2LSTA 4LMVA 2FWHA 1B48A 3C8EA 3BD2A 4MPGA 2GTUA 4Q5FA 4BL7A 1G6YA 4XS4A 2B7KA 1M9BA 1FB0A 2WCIA 4HJMA 4X0XA 1FB6A 5CREA 2F8FA 1XWBA 5B7CA 3CYNA 2X64A 2VL3A 4MF6A 5IM9A 4G10A 3LXZA 2OA7A 4I8BA 1ABAA 4ZL9A 2IMEA 4V1Ag 1FAAA 3FR6A 4OD7A 4IKHA 4TVEA 5E59A 4TR0A 3N9JA 3UVHA 1Z6NA 4AJ6A 3Q19A 1LJRA 2H1GA 1TKDB 3IPZA 3P8WA 5ELGA 3GTUA 5CRHA 2C0EA 1F2EA 2PGTA 1UN2A 4KB3A 1PQNA 1S3AA 1AC1A 3GN3A 3I43A 3EMXA 2R3XA 4PX1A 2G2QA 5D96A 5INYA 2YZHA 3M8NA 2JZSA 3HD5A 1OYJA 2HXKA 2VL9A 4ECBA 2DC5A 2LJAA 3CXGA 3G7YA 4HU7A 5L71A 3VWXA 3KTLA 2LRTA 3TJFA 4JE1A 1EOGA 4HU9A 18GSA 3ERGA 3CMIA 2L5OA 3GFKA 4GLTA 6GSVA 1G7OA 1NW2A 2NBSA 3DMLA 3TRPA 1BG5A 1SJZA 6GSTA 4WR4A 4JBBA 4J56E 2DMMA 4WF5A 1Q98A 1R5AA 2IFQA 1XIYA 2EIQA 4PURA 2C80A 5A5KA 3WT2A 1SU9A 1QXHA 3PINA 1UVZA 4N30A 1IYHA 1OC8A 4Q5RA 5IO2A 2BMXA 1V2AA 2L4CA 2V41A 3H79A 4NWYA 2TIRA 1M9AA 5HFKA 3GNJA 2GQMA 4KSOA 4FIWA 1RK4A 1XFLA 1ACVA 4OFTA 4EC0A 4OO4A 1HYUA 3JCML 3FRCA 2EIRA 5DDLA 1A2MA 5G5EA 1O8WA 2FA4A 4IJ3A 1GSDA 2ZNMA 2H6YA 4H86A 2R5GA 2RIIA 3EC3A 2VIMA 3ZIJA 5IO0A 1B4QA 1SYXA 2H70A 2FNOA 4TXOA 2GSQA 2GSSA 2YPMA 3UMAA 5ELAA 1ERUA 4X43A 2GSRA 5ECKB 3SBCA 4EUYA 1J0FA 5CO3A 3ZZXA 3ZIVA 2K18A 3ZFLA 2C0DA 3TOTA 1EEMA 5D9TA 2B5XA 1RQMA 5JCUA 5KN2A 1FW1A 4GCIA 4ID0A 4ZBDA 2ON5A 2IIYA 4G9HA 5ID2A 3LEFA 5CRDA 2FUG2 1H4OA 3DYRA 2CZ3A 3HXSA 3VURA 1N2AA 1AIUA 4MZWA 1M2DA 2GQKA 2NVLA 2NDOA 1URMA 16GSA 3TDGA 2A2RA 2IMIA 3N5OA 4KDUA 4DSRA 4MF7A 5ECIB 3IDVA 3GSSA 4RUVA 2VOCA 4WF4A 4POKA 2QKEA 2OACA 2YWOA 19GSA 2FD3A 3ZVJD 3WGEA 2FCHA 5CP1A 5J3RA 4RI7A 4KX4A 3HJPA 3GKNA 5JWQB 1JLVA 5G31A 3FR3A 2C1YA 4KA0A 3TCOA 9GSSA 10GSA 2H74A 3HZ4A 5H5QA 4ULXA 3KIJA 2X8HA 3BJ5A 2K8VA 3GH6A 1GSFA 3GKXA 5JWOB 3HVXA 2B1KA 12GSA 2C3NA 4WBJA 1O73A 3LFLA 3TKSA 4GQFA 4D73A 4GSTA 3NOFA 3RPPA 1O81A 2ALBA 5J41A 3H8QA 1EV4A 1PA3A 4EKZA 2H71A 1A23A 4AJ7A 4NV2A 2FWFA 3C73A 5J9BA 4FYCA 2CAQA 1BYEA 2OJLA 1ZMAA 1A8LA 1T8EB 5HQPA 5AN1A 2LQOA 1X0RA 2X8GA 1FVJA 2ZUPA 4TR1B 3VPQA 2PERA 2LKUA 3D5JA 1WJKA 4HJ2A 2GZYA 3KM6A 3GKKA 3M1GA 3US3A 4PXOA 3D21A 1U3AA 4Z7XA 1UA5A 3QDNA 2HRNA 4OWYA 2ON7A 4G19A 4ILFA 1M7TA 22GSA 4NHWA 1YDKA 4K8MA 1FOVA 1ON4A 1WRYA 4GTUA 4I5QA 2PPTA 3AY8A 2L59A 4MJCA 3KMOA 2VO4A 2XPEA 1VF4A 1EGRA 4MJAA 5IPGA 4POMA 2GT6A 6GSXA 5DAKA 1XXUA 17GSA 7GSSA 4YAVA 1SJIA 4ZXGA 2N5AA 5HFGA 1AXDA 4HZ2A 4PUAA 4DSSB 2TRXA 1ILOA 3M9KA 3ED3A 1MEKA 3CBUA 2OE1A 2K8SA 3VI7A 1SKSB 4DSQA 2YCDA 2CAIA 1OC9B 4XTSA 1GSYA 4Q5QA 1JFUA 2JADA 3D0ZA 3EYTA 1YKCA 3C1SA 2JACA 3EMPA 2IN3A 3PGTA 2E2GA 1PX6A 2KHPA 1XWGA 2IL3A 4ZL7A 3ZFBA 1I9DA 5H5RA 3HKRA 3F0IA 1GSUA 5B6MA 2OE3A 3GMFA 2GSTA 1THXA 4PQHA 1SL1B 4BVYA 1SK2A 2ZCTA 3FEUA 3LORA 1Y25A 2WRTA 4L5LA 4TN8A 3EURA 1ZYQB 1XVWA 1E2YA 4MZCA 5GSTA 1XOBA 1A2LA 2AAWA 2MBTA 2G0FA 4TR4A 3F6DA 3IBHA 2FWGA 2VL2A 3WYWA 2GZZA 1AAZA 4MA9A 5ABRA 3KH7A 4XS4B 2OBKA 1K3YA 3WGXA 3WGDA 3LSZA 2IWTA 4V2MA 4XS6A 3F9UA 3IV4A 1XW5A 2PVOC 5D93A 2P5QA 2PBJA 3UBKA 1PGTA 3F6FA 4FO5A 3J7Yb 1K0OA 3FK8A 1IYIA 5ECRB 3HJOA 3F8UA 2GVPA 2AHEA 5F06A 2JSZA 2DMLA 1M0UA 5HR1A 2YP6A 2H1DA 4ML6A 2E2MA 3TOUA 1TI3A 2HZEA 2FGXA 2EC4A 1KBNA 1A0RP 3SWLA 3MNGA 1G6WA 2LRCA 1BX9A 4LL1B 2DBCA 4E8HA 2VCQA 4CW9A 2CT6A 1GL8A 2H1AA 4YQVA 2XBQA 1F9MA 4IS0A 1ML6A 5J5NA 4XS1A 1K0CA 2DJJA 3KD0A 5AGYA 2C3TA 4ECCA 1TRVA 3HCZA 4TR3A 6GSYA 3BCIA 1Z7RA 4JEDA 3E3EA 1TK8B 3H4KA 4CHSA 2YANA 3HZ8A 3RHCA 5G5FA 1JZOA 3IAM2 1HNAA 1DSBA 2WGRA 1O6JA 4GSSA 3EVIA 2MMZA 5D9WA 3ME7A 3IHQA 4LA1A 3Q18A 3KJYA 1R7HA 4XRAA 4O7HA 2L57A 4IQ1A 2IFQB 3F3RA 1GSQA 4F2IA 1GTBA 3D4TA 2I4AA 4IN0A 4MABA 1QFNA 3RBTA 3IC4A 1YKAA 2VCZA 4RI6A 3FHKA 3GL5A 2GZPA 1OKDA 3GX0A 3F4RA 4V1Ap 4KUNA 2F9SA 2HZFA 4MJEA 2JZTA 1GNEA 3DRNA 2AV4A 3QAVA 1MTCA 2HRFA 3KCMA 4PNGA 3C71A 2F8AA 1QGVA 4J2FA 2DJ3A 4GSNA 4L0WA 2DIYA 1V57A 4IVFA 1A24A 3O76A 2KUCA 5GAND 2C4JA 1GLPA 3QMXA 4TXOB 2I81A 4WXTA 1KEBA 2H01A 4K7NA 1PN9A 1R5PA 2OKAA 1WIKA 1OC3A 4GWRA 1JHBA 1MD3A 4I6XA 1X9MB 4EL1A 3F4TA 5EPFA 2VCXA 3E9JB 4BWSA 5A4UA 3CRTA 1PSQA 5ID2B 3VLNA 2VLVA 5AISA 2CQ9A 4L5OA 4ZB9A 3BOAA 2CV4A 4O5RA 3IAS2 5IOWA 4K9ZA 3DD3A 1QQ2A 2YJHA 1TJDA 2H19A 1KTEA 4GRFA 4HQZA 3UEMA 2LUSA 3IK9A 4E8EA 1YY7A 1K0NA 1NHOA 2C8UA 2J23A 2L6DA 4KE3A 4TW5A 1F6MC 3TRQA 4V2NA 2XC2A 1XBSA 1EP8A 1V9WA 1T7PB 4KGIA 2I9HA 4X1UA 5ECMB 3GHAA 2XHFA 2LJRA 1ERWA 3BCKA 3L9VA 3F63A 5JCGA 1B8XA 3I69A 2I3YA 2R37A 4NHZA 4OMVA 2DJKA 2NPBA 3CTFA 4MCUA 1T4ZA 4AGSA 4WKWA 1U6TA 5FWGA 2H1BA 4ZB6A 1R4WA 2XBIA 1YF0A 3MAKA 3DWVA 2R6KA 4BPYA 2CVKA 2CX3A 2X8CA 3I9V2 1MDIA 3MWHA 4XIHA 2M80A 3HDCA 3APQA 3VPTA 1C72A 1GUKA 4O92A 3LQ7A 1T4YA 2V6OA 3EWLA 5KEJA 4IJIA 5ECOB 3VK9A 4EDYA 2AB6A 4K1FA 4PGTA 3KEBA 1M99A 4O32A 1AW9A 3HVVA 4D73B 5DALA 2HT9A 4QQ7A 4FYUA 1U88A 1XVQA 4YQUA 1TRWA 3P7XA 4MDCA 1OE7A 4WEYA 4TRXA 5F0GA 3L9SA 1KNGA 5IOXA 2F3MA 5EVOA 5GSSA 4OCFA 1GUMA 1SJ6A 2FA8A 3EE2A 3UOMA 1ZZYA 3U5RE 1V98A 4ZBAA 4HEA2 2BTOT 3G7IA 5F05A 1YQ1A 4V2LA 5D9VA 3DVWA 2VCTA 1M2BA 4WBRD 1XCCA 5H5SA 5FT3A 1WOUA 3UIWA 1B9XC 3QAGA 3L9UA 2GGTA 4RQRA 1J08A 1USBA 2V2GA 1WE0A 3CRUA 1TI1A 3M9JA 1A2JA 3VWVA 5KN3A 5DBQA 1MDJA 4IBPA 1XWCA 1SK1A 3LGCA 3ZRDA 2FHEA 2OE0A 1XWAA 2B6MA 1I5GA 1T00A 3PH9A 3TRXA 1JZWA 1PRXA 1X9WB 2RM5A 5IMAA 1CQHA 2LTKA 2WB9A 2FLSA 1EGOA 3F4SA 4YQMA 2B7JA 3UL3A 4PNFA 2HNLA 5LNKe 3F3QA 4KW6A 2O85A 3W8JA 3P2AA 1YEXA 2WZ9A 1ZGNA 1ZCPA 2AJQB 1O85A 1PMTA 2VAFA 4IGJA 3UJ1A 4TOPA 5A4WA 1M2AA 6GSWA 3CTGA 3FZAA 1FO5A 1QUWA 2PMTA 2WULA 5HR2A 2VD0A 3TKQA 3GSTA 4GXZA 3LYPA 4NMUA 2GS3A 3LG6A 4RQXA 2CVDA 5F8BA 2WDUA 4DVCA 2WS2A 4N10A 2IJYA 1TP9A 1THOA 5IMCA 4NV5A 4PQIA 4YAPA 3HYPA 1X5DA 2C0GA 2LNTA 1TRUA 4LMWA 1PX7A 1PL2A 2OBIA 2VM1A 5ECPB 2YZUA 3O3TA 3U6VA 2E0QA 1G0TA 3GUSA 2HE3A 1ERTA 3GURA 3GYKA 4LL4B 2YV7A 3LXTA 1E6BA 1SKRB 5GZZB 2LQQA 1W89A 4DSSA 5IMZA 3CSHA 3RDWA 4BWQA 3EINA 1TW9A 3QR6A 5IMVA 3I6AA 3KTBA 1NM3A 1YJ6A 3RHBA 5IMDA 3UBLA 5KN1A 3H1NA 1ZL9A 3Q74A 2DJ2A 4NPBA 2NTOA 4N0ZA 3G9BA 3IOSA 3QOUA 4TKYA 2H6XA 1SL0B 2EIOA 2KP1A 2O87A 3G7JA 2AYTA
chains in the Genus database with same CATH superfamily
2EHSA 4YH2A 3WD6A 4F37A 3L78A 4MJBA 2JBGA 2WFCA 3FW2A 5G30A 5F07A 4F9ZA 2QA1A 5DQSA 3IXRA 3CSIA 4CY8A 4L8EA 4MP4A 4MZBA 1IUQA 3EU4A 1HQOA 2LJKA 2HZEB 5IPHA 3A3TA 1YF1A 1M74A 4KCEA 2LEGA 4K6XA 1AQVA 5BRTA 1AQXA 2JB0A 2B3SA 2GYKA 2N5FA 3G4SP 2ES7A 3HY2A 2K2QA 2PEIA 5HR0A 3LYKA 2O7KA 2F51A 1GTUA 5JWRB 2DJ1A 1JZDA 2C0FA 3ZYWA 3IE3A 3QCPA 2VCVA 1Y6EA 1BJXA 2CWOA 4F82A 5EY6A 4ACSA 3GTUB 2X99A 1AYIA 6GSSA 2FQ0A 2JZRA 4L0UA 2REMA 2M46A 5KN0A 5BS2A 3TGZA 1EZKA 3GRXA 3MYDA 3DIEA 5B8AA 2WJUA 4ZIJA 2R4VA 4K7IA 2EFJA 3GL3A 1LU4A 5DJLA 3CCEP 2JU5A 1G7EA 2H66A 4I97A 3R2QA 2J9HA 3L0HA 4BA7A 1J9BA 1GP1A 3A2WA 4N11A 5HGLA 4EO3A 1VF1A 1ST9A 1K0MA 3E0UA 1B4PA 2MMOA 1SK0A 3ME8A 1OVNA 4JU5A 2H0HA 4N0VA 2YWMA 1VF3A 3KMNA 1GTAA 3G1IA 3A5WA 3HA9A 4HS1A 1A8YA 5ECQB 1VF2A 2GZGA 1VRSD 1TRSA 4OFMA 3FZ9A 4YKFA 1TOFA 2FWEA 1PL1A 4BVXA 3HHVA 2O89A 4XHMA 1SD9A 1EP7A 1DV5A 4Q5NA 3TJKA 1JLWA 1TK0B 5E4WA 1OAZA 4JR6A 2L4QA 5IMFA 3EU3A 3FY7A 4PUFC 1N8RQ 4F0CA 2MMNA 2MD9A 2YNXA 5IIZA 1GLQA 2H30A 2FHSC 5D9XA 4ICYA 2LRNA 1RW1A 5KP8B 4YKGA 2DLXA 3TKSC 2TRCP 3CMEP 4ISDA 3W8SA 1YIJP 3O6TA 2JO0A 2IMDA 3IK7A 3DEXA 1BAYA 1X3OA 1K3OA 3KGKA 1WWJA 1Q7YQ 4FH8A 3FZ5A 2FVAA 1OKTA 4DEJA 1KQSO 1GXHA 5HGMA 5CNWA 3VI5A 5D8IA 3GKMA 2GDYA 2IMKA 3QPMA 1HQBA 3A2XA 5G1KA 2PUKC 4CA3A 2HRKA 3LWAA 4EVMA 3ERFA 2HSMA 1T3BA 2L5LA 2R0PA 2C3QA 4WR5A 4Z2TA 1GH2A 2VUPA 2B1LA 2DJ0A 3IR4A 3Q6OA 1DUGA 3BBYA 1MD4A 2B5YA 4CDOA 1A0FA 1RO0A 2LOLA 1QK8A 4K0NA 1YEPA 1F3BA 1KC8Q 1KD1Q 2YWNA 8GSSA 1WPIA 5G2ZA 3TKPA 2KOKA 1UC7A 4QNBA 4NXIA 4CY6A 3MIXA 2BJXA 3L4NA 1VKUA 1O8XA 1R26A 2IPAA 2JU1A 2JL4A 3S9FA 2KGDA 2LV3A 3TKSE 5B8BA 20GSA 3NIVA 2GT5A 4JR4A 2N5IA 1NSWA 3ZVJA 1SL2B 1S72P 3TKRA 1L0IA 1X9SB 3LJRA 5LD0A 3G0VA 2GZIA 3MGEA 1VQ6P 1S3DA 2FY6A 2H76A 3HJMA 6GSUA 1WP0A 4PTSA 1U3IA 5J4UA 1S3CA 2MYGA 3C7MA 5DVBA 2KORA 4ECJA 5BMUA 1Z6MA 3UARA 3GA4A 3ZMKA 2H8LA 4IP1A 1GWCA 1T8KA 1K0BA 3CSJA 4IW9A 1DE2A 2E1MA 5ECHB 4MPFA 2KLXA 1PD21 1M1KQ 4NAXA 1W4VA 2CX4A 4FQUA 4HZ4A 4IP6A 5C04A 2QA2A 5CAXA 2V1MA 3FZ4A 1XPVA 2E7PA 2B5EA 4R0MA 1SKWB 4EE0A 2N5BA 4PH1A 4IELA 5COHA 3CC4P 2A2SA 3DGQA 5FHIA 4KNDA 4USSA 1TK5B 3IC8A 1TXXA 3H93A 4I2UA 3GIXA 1WMJA 2GQLA 1S3RA 2P31A 4K0GA 4Z2UA 4JRRA 3A2VA 4HDEA 4ZILA 4WYMA 5LCZA 2LTEA 5DALB 3QFAC 4FYBA 4KDXA 1VHNA 2L0QA 4I2TA 2FQ2A 5J9CA 1ZMBA 3ZMLA 3D6IA 4H2YC 4XCSA 2VM2A 3ERWA 3OR5A 5B6NA 2K6VA 2DNWA 2FADA 1BEDA 4F03A 2LIWA 2R2JA 3CCQP 3G26A 2H72A 2VL2C 2XPDA 2JQ4A 1U87A 5IQYA 3M0FA 4MMMA 2K9FA 4KAEA 3KXOA 1Z5YE 2M72A 5G1LA 5CYYA 2PEOA 2QSIA 1JZRA 3ZTLA 4HKGA 2GZJA 3K8NA 4TXVA 14GSA 1B9YC 2BUOA 1ZYNA 2YJ7A 1AUCA 1GUHA 4ZBBA 4G2EA 3IA1A 2RUFA 1Z7PA 2N6YA 4P3YB 1XW9A 1XOAA 3J7Yk 4NEOA 1YZXA 4POLA 2P0GA 3CCVP 1K3LA 2ROQA 1PKZA 2JSYA 1MDKA 4JZQA 2P9XA 1VGLA 2IMFA 4X4JA 2YN1A 2ERHA 5AIVA 1EEJA 1FHEA 5HR3A 3QAWA 1Z3EA 3CCMP 2H6ZA 4AJ8A 2M5RA 3HVSA 5DJMA 5DCHA 2H0GA 2MMAA 1ZYPA 1L0HA 1ZNVA 1GXGA 2H0IA 3DTJA 2A2PA 1AQWA 2GLRA 4WETA 13GSA 4HOJA 3GH9A 2PENA 2A4VA 4OCEA 1GSEA 3KP8A 5ECSA 1HD2A 5AIXA 3D4MA 1VQ7P 4ZB8A 4MH2A 5D73A 1FG4A 2CGQA 1ZOFA 3QD9A 3FYGA 3B4QA 1X5EA 4G0KA 4POBA 2HSHA 3VWUA 5DAKB 1SYRA 2FACA 3P90A 4ZL8A 1EOQA 3DS1A 1V40A 3ISOA 1BQ7A 4MLYA 4KSMA 4ML1A 4U0DA 5DCGA 2MF4A 3MSZA 2VCWA 2YOIA 5ECNB 1ERVA 2PWJA 3KZQA 2Z9SA 4GQCA 4U0EA 2MY5A 1F37A 1VQMP 3V1WA 3Q20A 1GULA 1SENA 4IHUA 4IQAA 5ECLB 2HI7A 1M6EX 1EV9A 3WT1A 4MF5A 5CRWA 4TR1A 3I56P 2LNSA 5ENUA 3W6GA 1X5CA 2H73A 1PN0A 5C00A 1UNKA 3IRAA 4MH3A 5EJDA 1PKWA 1CEIA 4XRDA 3GV1A 3RAZA 1FVKA 5HGOA 1OE8A 2DIZA 1M6NA 3I55P 2VD1A 2VLUA 1XWKA 3C1RA 11GSA 2CVBA 1F80D 2L9FA 1SD8A 1QMVA 1NHYA 4HQSA 1GRXA 3A5IA 1VQKP 2D2ZA 5HFIA 3ZITA 1CQGA 1HNBA 3TB2A 2AUVA 3HYBA 4HUAA 4F0BA 1VQPP 3TJGA 4ECIA 2KOQA 3CCRP 4EDZA 2LS5A 4GF0A 3TUEA 3RPNA 1F3AA 2QGVA 3H0DA 2HFDA 3KH9A 3DPHA 4EF0A 4AF2A 2O8VB 2P5RA 3NTEA 1EWXA 2YWIA 2VLTA 3ZREA 2OADA 4GR6A 2I1UA 1TDIA 2HLSA 2JAZA 4LLRA 2GDRA 2KWLA 2QA4P 4MK3A 4QL7A 5CRGA 5DQYA 2V32A 1GSSA 1XW6A 5JCWA 3PR8A 3ZLPA 2K93A 4KDYA 2H75A 1O7UA 2RUEA 3NZNA 1ZYEA 2CZ2A 1Z9HA 2KP2A 3UVTA 3ZL5A 1OC9A 3M3MA 1GTIA 3KP9A 1TTZA 2L6CA 4KCAA 3D22A 2CA8A 5EL8A 2XXMA 4OFNA 2QC7A 4OO5A 4XFXA 3VFIA 2V6KA 3CC2P 3CCJP 4G0IA 4UHPB 4QL9A 3DKSA 5I4TG 4U0CA 2LIUA 2PU9C 3UAPA 3TJJA 4J57E 2MBSA 2AVAA 4PQ1A 1LBKA 2K0DX 3DXBA 4K7OA 4HSCX 3FR9A 1DBYA 1K0DA 4HI7A 2RM6A 2PVQA 2HSYA 2A4HA 1Q4JA 1HNCA 3DS0A 5A4VA 1EIAA 4U0BA 5GAPD 4EXJA 3TJBA 3FKFA 3MDKA 1K0AA 3VWWA 1TU8A 4KH7A 2HYXA 2RLIA 3APSA 1EOHA 1TU7A 1N8JA 1T1VA 3OW2O 2R0GA 2YV9A 1GNWA 3GX8A 2DSAA 3DVXA 2PN8A 1DE1A 4BPGA 3QFBC 3APOA 2MZCA 1XZOA 4K2DA 1H75A 1V58A 2LSTA 4LMVA 2FWHA 1B48A 3C8EA 3BD2A 4MPGA 2KG8A 2GTUA 2UZ8A 4Q5FA 4BL7A 3B5IA 1G6YA 4XS4A 2B7KA 1M9BA 1FB0A 2OTLP 2WCIA 4HJMA 4X0XA 1FB6A 3G71P 5CREA 2F8FA 1K30A 4PH0A 1XWBA 5B7CA 1PFOA 2Z46A 3CYNA 2X64A 4GR2A 2VL3A 4MF6A 2R0CA 5IM9A 4BVXB 4G10A 1K73Q 3LXZA 2K0XA 2OA7A 4I8BA 1ABAA 4K5RA 4ZL9A 2IMEA 1FAAA 3FR6A 4V1Ag 4OD7A 4IKHA 4TVEA 5E59A 4TR0A 2FVFA 3N9JA 3UVHA 1Z6NA 4AJ6A 3Q19A 1LJRA 2H1GA 1TKDB 3IPZA 4O5QA 3P8WA 5ELGA 3GTUA 5CRHA 2C0EA 1F2EA 4KF9A 2FQ1A 2PGTA 3DS4A 1UN2A 2N98A 4KB3A 1M90Q 1PQNA 1S3AA 1AC1A 3GN3A 3I43A 3RG6C 3EMXA 2JYGA 2R3XA 1OR5A 4PX1A 2G2QA 5D96A 5INYA 2YZHA 3M8NA 2JZSA 3HD5A 1OYJA 2HXKA 1HY8A 2VL9A 4ECBA 2DC5A 2LJAA 3CXGA 3G7YA 4HU7A 4MNNA 2MVUA 5L71A 3VWXA 3KTLA 2LRTA 2DGYA 3TJFA 1UJZA 4JE1A 2AFDA 4MRTC 1EOGA 4HU9A 18GSA 3ERGA 3CMIA 2L5OA 3CPWO 2DKIA 3GFKA 2MR7A 4GLTA 6GSVA 1G7OA 1NW2A 2NBSA 3DMLA 3TRPA 1BG5A 1SJZA 6GSTA 4WR4A 5KOWA 4JBBA 3G6EP 4J56E 3G28A 2DMMA 4WF5A 5KOXA 1Q98A 1R5AA 3G21A 2IFQA 1XIYA 2EIQA 4PURA 2C80A 5A5KA 3WT2A 1SU9A 1QXHA 3PINA 1UVZA 4N30A 1IYHA 1OC8A 4Q5RA 5IO2A 2BMXA 1V2AA 2L4CA 2V41A 3H79A 4NWYA 2TIRA 4BPFA 1M9AA 5HFKA 3GNJA 2GQMA 4KSOA 1VQLP 4FIWA 1RK4A 1XFLA 1ACVA 3DS3A 4OFTA 4EC0A 4OO4A 1HYUA 3CD6P 3JCML 3FRCA 2EIRA 5DDLA 1A2MA 2VSQA 5G5EA 1O8WA 2FA4A 2LF4A 4IJ3A 1DNYA 1GSDA 2KODA 2ZNMA 2H6YA 4H86A 2R5GA 2RIIA 3EC3A 1QVGO 2PNGA 2GZEA 2VIMA 3ZIJA 5IO0A 1B4QA 1SYXA 2H70A 2FNOA 4TXOA 2GSSA 1JJ2O 2GSQA 2AF8A 2YPMA 3UMAA 5ELAA 1ERUA 4X43A 2GSRA 5ECKB 3SBCA 4EUYA 2MR8A 1J0FA 5CO3A 3ZZXA 2XT1A 1FR2A 3ZIVA 2K18A 3ZFLA 2M8LA 2C0DA 3TOTA 1EEMA 2B5XA 5D9TA 1RQMA 4H2XC 5JCUA 5KN2A 1FW1A 4GCIA 4ID0A 4ZBDA 2ON5A 2IIYA 4G9HA 5ID2A 3LEFA 5CRDA 2FUG2 1H4OA 3DYRA 2CZ3A 3HXSA 3VURA 4H2WC 1N2AA 1AIUA 4MZWA 3FMWA 1M2DA 3EPTA 3DS5A 2GQKA 2NVLA 2NDOA 1URMA 16GSA 3TDGA 2A2RA 2IMIA 2KW2A 3N5OA 4KDUA 4DSRA 4MF7A 5ECIB 3IDVA 3GSSA 4RUVA 2VOCA 4WF4A 2KGCA 4POKA 1EMVA 2QKEA 2OACA 2YWOA 19GSA 2FD3A 5BS1A 3ZVJD 2M8NA 3WGEA 4BPHA 2FCHA 5CP1A 5J3RA 4RI7A 4KX4A 3HJPA 2CQ8A 3GKNA 5JWQB 1JLVA 5G31A 3FR3A 2C1YA 1XG8A 4KA0A 3TCOA 1YJNP 1VQ8P 9GSSA 10GSA 2H74A 3HZ4A 5H5QA 4ULXA 5HVCA 3KIJA 2X8HA 3BJ5A 2K8VA 3GH6A 1GSFA 3GKXA 5JWOB 3HVXA 4EIQA 2N50A 2B1KA 12GSA 2C3NA 4WBJA 1O73A 3LFLA 3TKSA 4GQFA 4D73A 4GSTA 3NOFA 3RPPA 1O81A 2ALBA 5J41A 3H8QA 1EV4A 1PA3A 4EKZA 2H71A 1A23A 4AJ7A 4NV2A 3CXCO 1A8OA 2FWFA 3C73A 2PEMA 5J9BA 4FYCA 2CAQA 1BYEA 2OJLA 1ZMAA 1A8LA 1T8EB 5HQPA 2WPTA 5AN1A 3GJNA 2LQOA 1X0RA 2X8GA 1FVJA 2ZUPA 4TR1B 2QNWA 3VPQA 2PERA 2LKUA 2X4AA 3D5JA 1WJKA 4HJ2A 2GZYA 3KM6A 3GKKA 3WBHA 2KG9A 3M1GA 1YHQP 3US3A 2KG6A 4PXOA 3D21A 4PXHB 1U3AA 4Z7XA 5DCKA 1YJ9P 1UA5A 3QDNA 2HRNA 4OWYA 2ON7A 3IHGA 4G19A 4ILFA 2X49A 1M7TA 22GSA 4NHWA 1YDKA 4K8MA 1FOVA 1ON4A 1BAJA 1WRYA 4GTUA 5JPAA 4I5QA 3RG2A 2PPTA 4XFYA 2XV6A 3AY8A 2CG5B 2L59A 2M8PA 4MJCA 3KMOA 2VO4A 2XPEA 1VF4A 1EGRA 4MJAA 5IPGA 4POMA 2GT6A 6GSXA 5DAKA 1XXUA 17GSA 7GSSA 4YAVA 1SJIA 4ZXGA 2N5AA 5HFGA 1AXDA 4HZ2A 4PUAA 4DSSB 3EJEA 2TRXA 1ILOA 3M9KA 2JYLA 3ED3A 1MEKA 3CBUA 2OE1A 2K8SA 3VI7A 1SKSB 4DSQA 2YCDA 2CAIA 1FOHA 1OC9B 1AUMA 4XTSA 2HRAA 1GSYA 4Q5QA 1JFUA 2JADA 3D0ZA 3EYTA 1YKCA 3C1SA 1YI2P 4XFZA 2JACA 3EMPA 2IN3A 3PGTA 2E2GA 1PX6A 2KHPA 1XWGA 5KP7B 2IL3A 4ZL7A 3ZFBA 1I9DA 5H5RA 3HKRA 3F0IA 1GSUA 5B6MA 2OE3A 2OTJP 3GMFA 2LKIA 2GSTA 2K92A 1THXA 4PQHA 1SL1B 4BVYA 1SK2A 2ZCTA 3FEUA 3LORA 1Y25A 3GZMA 2XZ1C 2WRTA 4L5LA 2DKHA 4TN8A 3EURA 1ZYQB 1XVWA 1E2YA 2FAEA 4MZCA 5GSTA 1XOBA 2NO8A 1A2LA 2AAWA 2MBTA 2KOOA 2G0FA 4TR4A 3F6DA 1D1DA 3IBHA 3CCSP 2FWGA 2VL2A 3WYWA 2GZZA 1AAZA 4MA9A 4BL7B 3P05A 5ABRA 2PEJA 3KH7A 4XS4B 2OBKA 1K3YA 3WGXA 3WGDA 3LSZA 2IWTA 4V2MA 3EJDA 4XS6A 3F9UA 3R3EA 3IV4A 1XW5A 2PVOC 5D93A 2P5QA 2XZ0D 2PBJA 3UBKA 1PGTA 3F6FA 2PY8A 4FO5A 3J7Yb 1K0OA 3FK8A 2GDXA 1IYIA 5ECRB 2KGAA 2N6ZA 1YJWP 4COCA 3HJOA 3F8UA 2MVVA 2GVPA 2AHEA 5F06A 2JSZA 2DMLA 1M0UA 5HR1A 5F2NA 2YP6A 2H1DA 5F2OA 4ML6A 2E2MA 3TOUA 1TI3A 2LL8A 2HZEA 2FGXA 2EC4A 1KBNA 3G29A 1A0RP 2ONTA 5F2KA 3SWLA 3MNGA 1G6WA 3LRYA 2LRCA 1BX9A 4LL1B 2EIAA 2DBCA 4E8HA 4U0AA 2VCQA 4CW9A 2CT6A 1GL8A 2H1AA 4YQVA 2VLNA 1Q86Q 2XBQA 1F9MA 4IS0A 1ML6A 5J5NA 4U0FA 4XS1A 1K0CA 2DJJA 3KD0A 5AGYA 2C3TA 4ECCA 1TRVA 5CZDB 2VLPA 3HCZA 4TR3A 1M3IA 6GSYA 3BCIA 1Z7RA 2GZFA 5HV8A 4JEDA 3E3EA 1TK8B 3H4KA 4CHSA 4COPA 2YANA 3HZ8A 3RHCA 5G5FA 1JZOA 3IAM2 1HNAA 1DSBA 2WGRA 1O6JA 4GSSA 1M3JA 3LW9A 3EVIA 3CQFA 2MMZA 5D9WA 3ME7A 3IHQA 4LA1A 3Q18A 3KJYA 1R7HA 4XRAA 4O7HA 2L57A 4IQ1A 2IFQB 4BIKA 2N5HA 3F3RA 1GSQA 4F2IA 2GDWA 1GTBA 3D4TA 2I4AA 1A43A 2KGEA 3EJBA 4IN0A 4MABA 1QFNA 3RBTA 1Q82Q 3IC4A 3PPUA 3E2DA 1VQNP 2FVEA 2PEQA 1YKAA 2VCZA 4RI6A 3FHKA 3GL5A 4A5PA 2GZPA 2Z44A 1OKDA 3GX0A 3VRLC 3F4RA 4V1Ap 3NY7B 4KUNA 4IZ6A 1VQOP 2F9SA 2HZFA 4MJEA 2JZTA 2LPKA 1GNEA 3DRNA 2AV4A 3QAVA 1MTCA 2HRFA 3KCMA 4PNGA 3C71A 2F8AA 1QGVA 2EG5A 4J2FA 2DJ3A 4GSNA 4L0WA 2DIYA 1V57A 4IVFA 1A24A 3O76A 2KUCA 5GAND 2C4JA 1GLPA 3QMXA 4TXOB 2I81A 4WXTA 1KEBA 2H01A 4K7NA 1PN9A 1R5PA 2OKAA 4O5UA 1RNIA 1WIKA 1OC3A 4GWRA 2BHVA 1JHBA 3H4EA 3CE7A 1MD3A 1MZ8A 3G1GA 4I6XA 4DG9A 1X9MB 4EL1A 3F4TA 5EPFA 2VCXA 3E9JB 4BWSA 1QRJA 3CRTA 5A4UA 1PSQA 5ID2B 3VLNA 2VLVA 5AISA 2CQ9A 4L5OA 4ZB9A 3BOAA 5KP6B 2CV4A 4O5RA 3IAS2 5IOWA 4K9ZA 3DD3A 1QQ2A 2YJHA 4IPYA 1TJDA 2H19A 1KTEA 4GRFA 2L6EA 1BXIA 4HQZA 3UEMA 2LUSA 3IK9A 4E8EA 1YY7A 1K0NA 1NHOA 2C8UA 2J23A 3LMOA 2L6DA 2KOPA 4KE3A 4TW5A 1F6MC 3TRQA 4V2NA 2XC2A 1XBSA 1EP8A 1V9WA 1T7PB 4KGIA 1KLPA 2I9HA 4X1UA 5ECMB 3GHAA 2XHFA 2LJRA 2VLOA 3HVNA 1E0HA 1ERWA 3BCKA 3L9VA 3F63A 2EHTA 5JCGA 1B8XA 3I69A 1ACPA 1NQ4A 3GKLC 2I3YA 2R37A 4NHZA 4OMVA 2DJKA 2NPBA 3CTFA 4MCUA 1T4ZA 4AGSA 4WKWA 1U6TA 5FWGA 2H1BA 4ZB6A 1R4WA 2XBIA 1YF0A 3MAKA 1IMQA 3DWVA 2AFEA 2R6KA 2VLQA 2KOSA 4BPYA 2CVKA 2CX3A 2X8CA 3I9V2 1MDIA 3MWHA 3CCUP 4XIHA 2M80A 3HDCA 3APQA 3VPTA 1C72A 1GUKA 4O92A 3LQ7A 1T4YA 2V6OA 3EWLA 5KEJA 4IJIA 5ECOB 2QEXP 3VK9A 2Z45A 1VQ4P 4EDYA 2CNRA 2AB6A 3HZQA 4K1FA 4PGTA 3KEBA 1M99A 4O32A 1AW9A 3HVVA 4D73B 5DALA 2HT9A 4XROA 4QQ7A 4FYUA 1U88A 1XVQA 4YQUA 1TRWA 3P7XA 4MDCA 3H47A 2L4BA 1OE7A 4WEYA 4TRXA 5F0GA 3L9SA 1KNGA 2K0YA 4K2XA 5IOXA 2LMLA 2F3MA 5EVOA 5GSSA 4OCFA 1W2BO 1GUMA 1SJ6A 2FA8A 1QVFO 2JGPA 3EE2A 3UOMA 1ZZYA 3U5RE 1V98A 1AF8A 4ZBAA 4HEA2 2BTOT 2L22A 3G7IA 5F05A 1YQ1A 4V2LA 5D9VA 3DVWA 1K8AQ 2VCTA 1M2BA 4WBRD 1XCCA 5H5SA 5FT3A 1WOUA 3UIWA 1B9XC 3QAGA 3L9UA 2X2BA 2GGTA 4RQRA 1J08A 1USBA 2V2GA 1WE0A 3CRUA 1TI1A 3M9JA 1A2JA 3VWVA 5KN3A 5DBQA 1MDJA 4IBPA 1XWCA 1SK1A 3LGCA 3ZRDA 2FHEA 2OE0A 1XWAA 2B6MA 1I5GA 3M1MA 1T00A 4EIPA 3PH9A 3TRXA 1JZWA 2K5XA 7CEIA 1PRXA 1X9WB 1GPJA 2RM5A 5IMAA 1CQHA 3DS2A 2LTKA 2WB9A 2FLSA 1EGOA 3F4SA 4YQMA 5EW5E 2B7JA 3UL3A 4PNFA 2HNLA 5LNKe 3F3QA 4KW6A 2O85A 3W8JA 3P2AA 1YEXA 2WZ9A 4XRQA 1ZGNA 1ZCPA 2AJQB 1O85A 4PWVB 1PMTA 2VAFA 1IMPA 4IGJA 3UJ1A 4TOPA 5A4WA 1M2AA 6GSWA 3CTGA 3FZAA 1FO5A 3CMAP 1QUWA 2PMTA 2WULA 5HR2A 2VD0A 3TKQA 1NJIQ 3GSTA 4GXZA 3LYPA 4NMUA 2GS3A 3LG6A 4RQXA 2CVDA 5F8BA 2WDUA 4DVCA 2WS2A 4Z2RA 4N10A 2IJYA 1TP9A 1THOA 5IMCA 4NV5A 4PQIA 4YAPA 3HYPA 4M0IA 4BVYB 1X5DA 2C0GA 2LNTA 1TRUA 4LMWA 1PX7A 1PL2A 2OBIA 2VM1A 1VQ9P 5ECPB 2YZUA 3O3TA 3U6VA 2E0QA 1G0TA 3GUSA 4K5SA 2HE3A 1ERTA 4G0LA 3CC7P 1E6JP 3GURA 3GYKA 4LL4B 2OARA 2PEKA 2YV7A 3LXTA 1E6BA 1SKRB 5GZZB 1YITP 2LQQA 4QKOA 3GZLA 1W89A 1RO2A 4DSSA 5IMZA 3CSHA 3RDWA 4BWQA 3EINA 1Q81Q 1TW9A 3QR6A 5IMVA 3I6AA 1VQ5P 3KTBA 1NM3A 1YJ6A 3RHBA 5IMDA 3UBLA 3U43A 3CCLP 5KN1A 3H1NA 1ZL9A 3Q74A 2DJ2A 2K94A 4NPBA 2NTOA 4N0ZA 2JU2A 3G9BA 3IOSA 2KR5A 5HGNA 1K9MQ 3QOUA 4TKYA 2H6XA 1SL0B 2EIOA 2KP1A 2O87A 3G7JA 2AYTA
chains in the Genus database with same CATH topology
4YH2A 3WD6A 3L78A 4MJBA 2WFCA 3FW2A 5G30A 5F07A 4F9ZA 2QA1A 5DQSA 3IXRA 3CSIA 4CY8A 4L8EA 4MP4A 4MZBA 3EU4A 1HQOA 2LJKA 2HZEB 5IPHA 3A3TA 1YF1A 4KCEA 2LEGA 4K6XA 1AQVA 5BRTA 1AQXA 2B3SA 2N5FA 2ES7A 3HY2A 5HR0A 3LYKA 2O7KA 2F51A 1GTUA 5JWRB 2DJ1A 1JZDA 2C0FA 3ZYWA 3IE3A 3QCPA 2VCVA 1Y6EA 1BJXA 4F82A 5EY6A 4ACSA 3GTUB 2X99A 6GSSA 2JZRA 4L0UA 2REMA 2M46A 5KN0A 3TGZA 1EZKA 3GRXA 3MYDA 3DIEA 5B8AA 2WJUA 4ZIJA 2R4VA 4K7IA 3GL3A 1LU4A 5DJLA 2JU5A 1G7EA 2H66A 4I97A 3R2QA 2J9HA 3L0HA 4BA7A 1J9BA 1GP1A 3A2WA 4N11A 4EO3A 1VF1A 1ST9A 1K0MA 3E0UA 1B4PA 2MMOA 1SK0A 3ME8A 1OVNA 4JU5A 2H0HA 4N0VA 2YWMA 1VF3A 3KMNA 1GTAA 3A5WA 3HA9A 4HS1A 1A8YA 5ECQB 1VF2A 1VRSD 1TRSA 4OFMA 3FZ9A 4YKFA 1TOFA 2FWEA 1PL1A 4BVXA 3HHVA 2O89A 4XHMA 1SD9A 1EP7A 1TK0B 4Q5NA 3TJKA 1JLWA 5E4WA 1OAZA 4JR6A 2L4QA 5IMFA 3EU3A 3FY7A 4PUFC 4F0CA 2MMNA 2YNXA 5IIZA 1GLQA 2H30A 5D9XA 4ICYA 2LRNA 1RW1A 4YKGA 2DLXA 3TKSC 2TRCP 4ISDA 3W8SA 3O6TA 2IMDA 3IK7A 3DEXA 1BAYA 1K3OA 3KGKA 1WWJA 4FH8A 3FZ5A 1OKTA 4DEJA 5CNWA 3VI5A 5D8IA 3GKMA 2IMKA 3QPMA 3A2XA 5G1KA 2PUKC 2HRKA 3LWAA 4EVMA 3ERFA 2HSMA 1T3BA 2L5LA 2R0PA 2C3QA 4WR5A 4Z2TA 1GH2A 2VUPA 2B1LA 2DJ0A 3IR4A 3Q6OA 1DUGA 3BBYA 1MD4A 2B5YA 4CDOA 1A0FA 1QK8A 4K0NA 1YEPA 1F3BA 8GSSA 2YWNA 1WPIA 5G2ZA 3TKPA 2KOKA 1UC7A 4NXIA 4CY6A 3MIXA 2BJXA 3L4NA 1O8XA 1R26A 2IPAA 2JL4A 3S9FA 2LV3A 3TKSE 5B8BA 20GSA 3NIVA 2GT5A 4JR4A 1NSWA 3ZVJA 1SL2B 3TKRA 1X9SB 3LJRA 5LD0A 1S3DA 2FY6A 3HJMA 2H76A 6GSUA 1WP0A 4PTSA 1U3IA 5J4UA 1S3CA 2MYGA 3C7MA 5DVBA 4ECJA 5BMUA 1Z6MA 3UARA 3GA4A 3ZMKA 2H8LA 4IP1A 1GWCA 1K0BA 3CSJA 4IW9A 1DE2A 5ECHB 4MPFA 2KLXA 1PD21 4NAXA 1W4VA 2CX4A 4FQUA 4HZ4A 4IP6A 5C04A 2QA2A 5CAXA 2V1MA 3FZ4A 1XPVA 2E7PA 2B5EA 1SKWB 4EE0A 2N5BA 4IELA 5COHA 2A2SA 3DGQA 5FHIA 4KNDA 4USSA 1TK5B 3IC8A 1TXXA 3H93A 4I2UA 3GIXA 1WMJA 2GQLA 2P31A 4K0GA 4Z2UA 4JRRA 3A2VA 4HDEA 4ZILA 5LCZA 5DALB 3QFAC 4FYBA 4KDXA 4I2TA 5J9CA 3ZMLA 3D6IA 4XCSA 2VM2A 3ERWA 3OR5A 5B6NA 2K6VA 1BEDA 4F03A 2R2JA 2H72A 2VL2C 2XPDA 1U87A 5IQYA 3M0FA 4MMMA 2K9FA 4KAEA 3KXOA 1Z5YE 2M72A 5G1LA 5CYYA 2QSIA 1JZRA 3ZTLA 3K8NA 4TXVA 14GSA 1B9YC 1ZYNA 2YJ7A 1AUCA 1GUHA 4ZBBA 4G2EA 3IA1A 2RUFA 1Z7PA 4P3YB 1XW9A 1XOAA 3J7Yk 1YZXA 4POLA 2P0GA 1K3LA 1PKZA 2JSYA 1MDKA 4JZQA 1VGLA 2IMFA 4X4JA 2YN1A 5AIVA 1EEJA 1FHEA 5HR3A 3QAWA 1Z3EA 2H6ZA 4AJ8A 3HVSA 5DJMA 5DCHA 2H0GA 2MMAA 1ZYPA 2H0IA 2A2PA 1AQWA 2GLRA 4WETA 13GSA 4HOJA 3GH9A 2A4VA 4OCEA 1GSEA 3KP8A 5ECSA 1HD2A 5AIXA 3D4MA 4ZB8A 4MH2A 5D73A 1FG4A 1ZOFA 3QD9A 3FYGA 1X5EA 4G0KA 4POBA 2HSHA 3VWUA 5DAKB 1SYRA 3P90A 4ZL8A 1V40A 3ISOA 1BQ7A 4MLYA 4KSMA 4ML1A 5DCGA 3MSZA 2VCWA 2YOIA 5ECNB 1ERVA 2PWJA 3KZQA 2Z9SA 4GQCA 1F37A 3V1WA 1GULA 1SENA 4IHUA 4IQAA 5ECLB 2HI7A 1EV9A 3WT1A 4MF5A 5CRWA 4TR1A 2LNSA 5ENUA 3W6GA 1X5CA 2H73A 1PN0A 5C00A 3IRAA 4MH3A 1PKWA 4XRDA 3GV1A 3RAZA 1FVKA 1OE8A 2DIZA 2VD1A 2VLUA 1XWKA 3C1RA 11GSA 2CVBA 1SD8A 1QMVA 1NHYA 4HQSA 1GRXA 3A5IA 2D2ZA 5HFIA 3ZITA 1CQGA 1HNBA 3TB2A 2AUVA 4HUAA 4F0BA 3TJGA 4ECIA 4EDZA 2LS5A 4GF0A 3TUEA 3RPNA 1F3AA 2QGVA 2HFDA 3KH9A 4EF0A 4AF2A 2O8VB 2P5RA 1EWXA 2YWIA 2VLTA 3ZREA 2OADA 2I1UA 1TDIA 2HLSA 4LLRA 2GDRA 4MK3A 4QL7A 5CRGA 5DQYA 2V32A 1GSSA 1XW6A 5JCWA 3PR8A 3ZLPA 4KDYA 2H75A 1O7UA 2RUEA 3NZNA 1ZYEA 2CZ2A 1Z9HA 2KP2A 3UVTA 3ZL5A 1OC9A 3M3MA 1GTIA 3KP9A 1TTZA 2L6CA 4KCAA 3D22A 2CA8A 5EL8A 4OFNA 2QC7A 4OO5A 3VFIA 2V6KA 4G0IA 4QL9A 3DKSA 2PU9C 3UAPA 3TJJA 4J57E 2MBSA 4PQ1A 1LBKA 3DXBA 4K7OA 3FR9A 1DBYA 1K0DA 4HI7A 2RM6A 2PVQA 2HSYA 2A4HA 1Q4JA 1HNCA 5A4VA 5GAPD 4EXJA 3TJBA 3FKFA 3MDKA 1K0AA 3VWWA 1TU8A 4KH7A 2HYXA 2RLIA 3APSA 1EOHA 1TU7A 1N8JA 1T1VA 2R0GA 2YV9A 1GNWA 3GX8A 2DSAA 3DVXA 2PN8A 1DE1A 3QFBC 3APOA 2MZCA 1XZOA 4K2DA 1H75A 1V58A 2LSTA 4LMVA 2FWHA 1B48A 3C8EA 3BD2A 4MPGA 2GTUA 2UZ8A 4Q5FA 4BL7A 1G6YA 4XS4A 2B7KA 1M9BA 1FB0A 2WCIA 4HJMA 4X0XA 1FB6A 5CREA 2F8FA 1XWBA 5B7CA 3CYNA 2X64A 2VL3A 4MF6A 2R0CA 5IM9A 4BVXB 4G10A 3LXZA 2OA7A 4I8BA 1ABAA 4K5RA 4ZL9A 2IMEA 4V1Ag 1FAAA 3FR6A 4OD7A 4IKHA 4TVEA 5E59A 4TR0A 3N9JA 3UVHA 1Z6NA 4AJ6A 3Q19A 1LJRA 2H1GA 1TKDB 3IPZA 4O5QA 3P8WA 5ELGA 3GTUA 5CRHA 2C0EA 1F2EA 4KF9A 2PGTA 1UN2A 4KB3A 1PQNA 1S3AA 1AC1A 3GN3A 3I43A 3EMXA 2R3XA 4PX1A 2G2QA 5D96A 5INYA 2YZHA 3M8NA 2JZSA 3HD5A 1OYJA 2HXKA 2VL9A 4ECBA 2DC5A 2LJAA 3CXGA 3G7YA 4HU7A 4MNNA 5L71A 3VWXA 3KTLA 2LRTA 3TJFA 4JE1A 1EOGA 4HU9A 18GSA 3ERGA 3CMIA 2L5OA 2DKIA 3GFKA 4GLTA 6GSVA 1G7OA 1NW2A 2NBSA 3DMLA 3TRPA 1BG5A 1SJZA 6GSTA 4WR4A 5KOWA 4JBBA 4J56E 2DMMA 4WF5A 5KOXA 1Q98A 1R5AA 2IFQA 1XIYA 2EIQA 4PURA 2C80A 5A5KA 3WT2A 1SU9A 1QXHA 3PINA 1UVZA 4N30A 1IYHA 1OC8A 4Q5RA 5IO2A 2BMXA 1V2AA 2L4CA 2V41A 3H79A 4NWYA 2TIRA 1M9AA 5HFKA 3GNJA 2GQMA 4KSOA 4FIWA 1RK4A 1XFLA 1ACVA 4OFTA 4EC0A 4OO4A 1HYUA 3JCML 3FRCA 2EIRA 5DDLA 1A2MA 5G5EA 1O8WA 2FA4A 4IJ3A 1GSDA 2ZNMA 2H6YA 4H86A 2R5GA 2RIIA 3EC3A 2VIMA 3ZIJA 5IO0A 1B4QA 1SYXA 2H70A 2FNOA 4TXOA 2GSQA 2GSSA 2YPMA 3UMAA 5ELAA 1ERUA 4X43A 2GSRA 5ECKB 3SBCA 4EUYA 1J0FA 5CO3A 3ZZXA 3ZIVA 2K18A 3ZFLA 2C0DA 3TOTA 1EEMA 2B5XA 5D9TA 1RQMA 5JCUA 5KN2A 1FW1A 4GCIA 4ID0A 4ZBDA 2ON5A 2IIYA 4G9HA 5ID2A 3LEFA 5CRDA 2FUG2 1H4OA 3DYRA 2CZ3A 3HXSA 3VURA 1N2AA 1AIUA 4MZWA 3FMWA 1M2DA 3EPTA 2GQKA 2NVLA 2NDOA 1URMA 16GSA 3TDGA 2A2RA 2IMIA 3N5OA 4KDUA 4DSRA 4MF7A 5ECIB 3IDVA 3GSSA 4RUVA 2VOCA 4WF4A 4POKA 2QKEA 2OACA 2YWOA 19GSA 2FD3A 3ZVJD 3WGEA 2FCHA 5CP1A 5J3RA 4RI7A 4KX4A 3HJPA 3GKNA 5JWQB 1JLVA 5G31A 3FR3A 2C1YA 4KA0A 3TCOA 9GSSA 10GSA 2H74A 3HZ4A 5H5QA 4ULXA 3KIJA 2X8HA 3BJ5A 2K8VA 3GH6A 1GSFA 3GKXA 5JWOB 3HVXA 4EIQA 2B1KA 12GSA 2C3NA 4WBJA 1O73A 3LFLA 3TKSA 4GQFA 4D73A 4GSTA 3NOFA 3RPPA 1O81A 2ALBA 5J41A 3H8QA 1EV4A 1PA3A 4EKZA 2H71A 1A23A 4AJ7A 4NV2A 2FWFA 3C73A 5J9BA 4FYCA 2CAQA 1BYEA 2OJLA 1ZMAA 1A8LA 1T8EB 5HQPA 5AN1A 2LQOA 1X0RA 2X8GA 1FVJA 2ZUPA 4TR1B 3VPQA 2PERA 2LKUA 2X4AA 3D5JA 1WJKA 4HJ2A 2GZYA 3KM6A 3GKKA 3M1GA 3US3A 4PXOA 3D21A 1U3AA 4Z7XA 1UA5A 3QDNA 2HRNA 4OWYA 2ON7A 3IHGA 4G19A 4ILFA 2X49A 1M7TA 22GSA 4NHWA 1YDKA 4K8MA 1FOVA 1ON4A 1WRYA 4GTUA 4I5QA 2PPTA 3AY8A 2L59A 4MJCA 3KMOA 2VO4A 2XPEA 1VF4A 1EGRA 4MJAA 5IPGA 4POMA 2GT6A 6GSXA 5DAKA 1XXUA 17GSA 7GSSA 4YAVA 1SJIA 4ZXGA 2N5AA 5HFGA 1AXDA 4HZ2A 4PUAA 4DSSB 2TRXA 1ILOA 3M9KA 3ED3A 1MEKA 3CBUA 2OE1A 2K8SA 3VI7A 1SKSB 4DSQA 2YCDA 2CAIA 1FOHA 1OC9B 4XTSA 2HRAA 1GSYA 4Q5QA 1JFUA 2JADA 3D0ZA 3EYTA 1YKCA 3C1SA 2JACA 3EMPA 2IN3A 3PGTA 2E2GA 1PX6A 2KHPA 1XWGA 2IL3A 4ZL7A 3ZFBA 1I9DA 5H5RA 3HKRA 3F0IA 1GSUA 5B6MA 2OE3A 3GMFA 2GSTA 1THXA 4PQHA 1SL1B 4BVYA 1SK2A 2ZCTA 3FEUA 3LORA 1Y25A 2WRTA 4L5LA 2DKHA 4TN8A 3EURA 1ZYQB 1XVWA 1E2YA 4MZCA 5GSTA 1XOBA 1A2LA 2AAWA 2MBTA 2G0FA 4TR4A 3F6DA 3IBHA 2FWGA 2VL2A 3WYWA 2GZZA 1AAZA 4MA9A 4BL7B 5ABRA 3KH7A 4XS4B 2OBKA 1K3YA 3WGXA 3WGDA 3LSZA 2IWTA 4V2MA 4XS6A 3F9UA 3R3EA 3IV4A 1XW5A 2PVOC 5D93A 2P5QA 2PBJA 3UBKA 1PGTA 3F6FA 4FO5A 3J7Yb 1K0OA 3FK8A 1IYIA 5ECRB 3HJOA 3F8UA 2GVPA 2AHEA 5F06A 2JSZA 2DMLA 1M0UA 5HR1A 2YP6A 2H1DA 4ML6A 2E2MA 3TOUA 1TI3A 2HZEA 2FGXA 2EC4A 1KBNA 1A0RP 3SWLA 3MNGA 1G6WA 2LRCA 1BX9A 4LL1B 2DBCA 4E8HA 2VCQA 4CW9A 2CT6A 1GL8A 2H1AA 4YQVA 2XBQA 1F9MA 4IS0A 1ML6A 5J5NA 4XS1A 1K0CA 2DJJA 3KD0A 5AGYA 2C3TA 4ECCA 1TRVA 3HCZA 4TR3A 6GSYA 3BCIA 1Z7RA 4JEDA 3E3EA 1TK8B 3H4KA 4CHSA 2YANA 3HZ8A 3RHCA 5G5FA 1JZOA 3IAM2 1HNAA 1DSBA 2WGRA 1O6JA 4GSSA 3LW9A 3EVIA 2MMZA 5D9WA 3ME7A 3IHQA 4LA1A 3Q18A 3KJYA 1R7HA 4XRAA 4O7HA 2L57A 4IQ1A 2IFQB 3F3RA 1GSQA 4F2IA 1GTBA 3D4TA 2I4AA 4IN0A 4MABA 1QFNA 3RBTA 3IC4A 3PPUA 1YKAA 2VCZA 4RI6A 3FHKA 3GL5A 4A5PA 2GZPA 1OKDA 3GX0A 3F4RA 4V1Ap 4KUNA 2F9SA 2HZFA 4MJEA 2JZTA 1GNEA 3DRNA 2AV4A 3QAVA 1MTCA 2HRFA 3KCMA 4PNGA 3C71A 2F8AA 1QGVA 4J2FA 2DJ3A 4GSNA 4L0WA 2DIYA 1V57A 4IVFA 1A24A 3O76A 2KUCA 5GAND 2C4JA 1GLPA 3QMXA 4TXOB 2I81A 4WXTA 1KEBA 2H01A 4K7NA 1PN9A 1R5PA 2OKAA 4O5UA 1WIKA 1OC3A 4GWRA 1JHBA 1MD3A 4I6XA 1X9MB 4EL1A 3F4TA 5EPFA 2VCXA 3E9JB 4BWSA 5A4UA 3CRTA 1PSQA 5ID2B 3VLNA 2VLVA 5AISA 2CQ9A 4L5OA 4ZB9A 3BOAA 2CV4A 4O5RA 3IAS2 5IOWA 4K9ZA 3DD3A 1QQ2A 2YJHA 1TJDA 2H19A 1KTEA 4GRFA 4HQZA 3UEMA 2LUSA 3IK9A 4E8EA 1YY7A 1K0NA 1NHOA 2C8UA 2J23A 2L6DA 4KE3A 4TW5A 1F6MC 3TRQA 4V2NA 2XC2A 1XBSA 1EP8A 1V9WA 1T7PB 4KGIA 2I9HA 4X1UA 5ECMB 3GHAA 2XHFA 2LJRA 1ERWA 3BCKA 3L9VA 3F63A 5JCGA 1B8XA 3I69A 2I3YA 2R37A 4NHZA 4OMVA 2DJKA 2NPBA 3CTFA 4MCUA 1T4ZA 4AGSA 4WKWA 1U6TA 5FWGA 2H1BA 4ZB6A 1R4WA 2XBIA 1YF0A 3MAKA 3DWVA 2R6KA 4BPYA 2CVKA 2CX3A 2X8CA 3I9V2 1MDIA 3MWHA 4XIHA 2M80A 3HDCA 3APQA 3VPTA 1C72A 1GUKA 4O92A 3LQ7A 1T4YA 2V6OA 3EWLA 5KEJA 4IJIA 5ECOB 3VK9A 4EDYA 2AB6A 4K1FA 4PGTA 3KEBA 1M99A 4O32A 1AW9A 3HVVA 4D73B 5DALA 2HT9A 4QQ7A 4FYUA 1U88A 1XVQA 4YQUA 1TRWA 3P7XA 4MDCA 1OE7A 4WEYA 4TRXA 5F0GA 3L9SA 1KNGA 4K2XA 5IOXA 2F3MA 5EVOA 5GSSA 4OCFA 1GUMA 1SJ6A 2FA8A 3EE2A 3UOMA 1ZZYA 3U5RE 1V98A 4ZBAA 4HEA2 2BTOT 3G7IA 5F05A 1YQ1A 4V2LA 5D9VA 3DVWA 2VCTA 1M2BA 4WBRD 1XCCA 5H5SA 5FT3A 1WOUA 3UIWA 1B9XC 3QAGA 3L9UA 2GGTA 4RQRA 1J08A 1USBA 2V2GA 1WE0A 3CRUA 1TI1A 3M9JA 1A2JA 3VWVA 5KN3A 5DBQA 1MDJA 4IBPA 1XWCA 1SK1A 3LGCA 3ZRDA 2FHEA 2OE0A 1XWAA 2B6MA 1I5GA 1T00A 4EIPA 3PH9A 3TRXA 1JZWA 1PRXA 1X9WB 2RM5A 5IMAA 1CQHA 2LTKA 2WB9A 2FLSA 1EGOA 3F4SA 4YQMA 2B7JA 3UL3A 4PNFA 2HNLA 5LNKe 3F3QA 4KW6A 2O85A 3W8JA 3P2AA 1YEXA 2WZ9A 1ZGNA 1ZCPA 2AJQB 1O85A 1PMTA 2VAFA 4IGJA 3UJ1A 4TOPA 5A4WA 1M2AA 6GSWA 3CTGA 3FZAA 1FO5A 1QUWA 2PMTA 2WULA 5HR2A 2VD0A 3TKQA 3GSTA 4GXZA 3LYPA 4NMUA 2GS3A 3LG6A 4RQXA 2CVDA 5F8BA 2WDUA 4DVCA 2WS2A 4Z2RA 4N10A 2IJYA 1TP9A 1THOA 5IMCA 4NV5A 4PQIA 4YAPA 3HYPA 4BVYB 1X5DA 2C0GA 2LNTA 1TRUA 4LMWA 1PX7A 1PL2A 2OBIA 2VM1A 5ECPB 2YZUA 3O3TA 3U6VA 2E0QA 1G0TA 3GUSA 4K5SA 2HE3A 1ERTA 4G0LA 3GURA 3GYKA 4LL4B 2YV7A 3LXTA 1E6BA 1SKRB 5GZZB 2LQQA 1W89A 4DSSA 5IMZA 3CSHA 3RDWA 4BWQA 3EINA 1TW9A 3QR6A 5IMVA 3I6AA 3KTBA 1NM3A 1YJ6A 3RHBA 5IMDA 3UBLA 5KN1A 3H1NA 1ZL9A 3Q74A 2DJ2A 4NPBA 2NTOA 4N0ZA 3G9BA 3IOSA 3QOUA 4TKYA 2H6XA 1SL0B 2EIOA 2KP1A 2O87A 3G7JA 2AYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YH2 A;  3WD6 A;  3L78 A;  4MJB A;  2WFC A;  3FW2 A;  5G30 A;  5F07 A;  4F9Z A;  5DQS A;  3IXR A;  3CSI A;  4L8E A;  4MP4 A;  4MZB A;  3EU4 A;  1HQO A;  2LJK A;  2HZE B;  5IPH A;  3A3T A;  1YF1 A;  4KCE A;  2LEG A;  4K6X A;  1AQV A;  1AQX A;  2B3S A;  2N5F A;  2ES7 A;  3HY2 A;  5HR0 A;  3LYK A;  2O7K A;  2F51 A;  1GTU A;  5JWR B;  2DJ1 A;  1JZD A;  2C0F A;  3ZYW A;  3IE3 A;  3QCP A;  2VCV A;  1Y6E A;  1BJX A;  4F82 A;  5EY6 A;  4ACS A;  3GTU B;  2X99 A;  6GSS A;  2JZR A;  4L0U A;  2REM A;  2M46 A;  5KN0 A;  3TGZ A;  1EZK A;  3GRX A;  3DIE A;  5B8A A;  2WJU A;  4ZIJ A;  2R4V A;  4K7I A;  3GL3 A;  1LU4 A;  5DJL A;  2JU5 A;  1G7E A;  2H66 A;  4I97 A;  3R2Q A;  2J9H A;  3L0H A;  4BA7 A;  1J9B A;  1GP1 A;  3A2W A;  4N11 A;  4EO3 A;  1VF1 A;  1ST9 A;  1K0M A;  3E0U A;  1B4P A;  2MMO A;  1SK0 A;  3ME8 A;  1OVN A;  4JU5 A;  2H0H A;  4N0V A;  2YWM A;  1VF3 A;  3KMN A;  1GTA A;  3A5W A;  3HA9 A;  4HS1 A;  1A8Y A;  5ECQ B;  1VF2 A;  1VRS D;  1TRS A;  4OFM A;  3FZ9 A;  1TOF A;  2FWE A;  1PL1 A;  4BVX A;  3HHV A;  2O89 A;  4XHM A;  1SD9 A;  1EP7 A;  1TK0 B;  4Q5N A;  3TJK A;  1JLW A;  5E4W A;  1OAZ A;  4JR6 A;  2L4Q A;  5IMF A;  3EU3 A;  3FY7 A;  4PUF C;  4F0C A;  2MMN A;  2YNX A;  5IIZ A;  1GLQ A;  2H30 A;  5D9X A;  2LRN A;  1RW1 A;  2DLX A;  3TKS C;  2TRC P;  4ISD A;  3W8S A;  3O6T A;  2IMD A;  3IK7 A;  3DEX A;  1BAY A;  1K3O A;  3KGK A;  1WWJ A;  4FH8 A;  3FZ5 A;  1OKT A;  4DEJ A;  5CNW A;  3VI5 A;  5D8I A;  3GKM A;  2IMK A;  3QPM A;  3A2X A;  5G1K A;  2PUK C;  3LWA A;  4EVM A;  3ERF A;  1T3B A;  2L5L A;  2C3Q A;  4WR5 A;  1GH2 A;  2VUP A;  2B1L A;  2DJ0 A;  3IR4 A;  3Q6O A;  1DUG A;  3BBY A;  1MD4 A;  2B5Y A;  4CDO A;  1A0F A;  1QK8 A;  4K0N A;  1YEP A;  1F3B A;  8GSS A;  2YWN A;  1WPI A;  5G2Z A;  3TKP A;  2KOK A;  1UC7 A;  4NXI A;  2BJX A;  3L4N A;  1O8X A;  1R26 A;  2IPA A;  2JL4 A;  3S9F A;  2LV3 A;  3TKS E;  5B8B A;  20GS A;  3NIV A;  2GT5 A;  4JR4 A;  1NSW A;  3ZVJ A;  1SL2 B;  3TKR A;  1X9S B;  3LJR A;  5LD0 A;  1S3D A;  2FY6 A;  3HJM A;  2H76 A;  6GSU A;  1WP0 A;  1U3I A;  5J4U A;  1S3C A;  2MYG A;  3C7M A;  5DVB A;  4ECJ A;  1Z6M A;  3UAR A;  3GA4 A;  3ZMK A;  2H8L A;  4IP1 A;  1GWC A;  1K0B A;  3CSJ A;  4IW9 A;  1DE2 A;  5ECH B;  4MPF A;  2KLX A;  1PD2 1;  4NAX A;  1W4V A;  2CX4 A;  4HZ4 A;  4IP6 A;  5C04 A;  5CAX A;  2V1M A;  3FZ4 A;  1XPV A;  2E7P A;  2B5E A;  1SKW B;  4EE0 A;  2N5B A;  4IEL A;  5COH A;  2A2S A;  3DGQ A;  5FHI A;  4KND A;  1TK5 B;  1TXX A;  3H93 A;  4I2U A;  3GIX A;  1WMJ A;  2GQL A;  2P31 A;  4K0G A;  4JRR A;  3A2V A;  4HDE A;  4ZIL A;  5LCZ A;  5DAL B;  3QFA C;  4FYB A;  4KDX A;  4I2T A;  5J9C A;  3ZML A;  3D6I A;  4XCS A;  2VM2 A;  3ERW A;  3OR5 A;  5B6N A;  2K6V A;  1BED A;  4F03 A;  2R2J A;  2H72 A;  2VL2 C;  2XPD A;  1U87 A;  5IQY A;  3M0F A;  4MMM A;  2K9F A;  4KAE A;  3KXO A;  1Z5Y E;  2M72 A;  5G1L A;  5CYY A;  2QSI A;  1JZR A;  3ZTL A;  3K8N A;  4TXV A;  14GS A;  1B9Y C;  2YJ7 A;  1AUC A;  1GUH A;  4ZBB A;  4G2E A;  3IA1 A;  2RUF A;  1Z7P A;  4P3Y B;  1XW9 A;  1XOA A;  3J7Y k;  1YZX A;  4POL A;  2P0G A;  1K3L A;  1PKZ A;  2JSY A;  1MDK A;  4JZQ A;  1VGL A;  2IMF A;  2YN1 A;  5AIV A;  1EEJ A;  1FHE A;  5HR3 A;  3QAW A;  1Z3E A;  2H6Z A;  4AJ8 A;  3HVS A;  5DJM A;  5DCH A;  2H0G A;  2MMA A;  2H0I A;  1AQW A;  2GLR A;  4WET A;  13GS A;  4HOJ A;  3GH9 A;  2A4V A;  4OCE A;  1GSE A;  3KP8 A;  5ECS A;  1HD2 A;  5AIX A;  3D4M A;  4ZB8 A;  4MH2 A;  5D73 A;  1FG4 A;  1ZOF A;  3QD9 A;  3FYG A;  1X5E A;  4POB A;  2HSH A;  3VWU A;  5DAK B;  1SYR A;  3P90 A;  4ZL8 A;  1V40 A;  3ISO A;  1BQ7 A;  4MLY A;  4KSM A;  4ML1 A;  5DCG A;  3MSZ A;  2VCW A;  2YOI A;  5ECN B;  1ERV A;  2PWJ A;  3KZQ A;  2Z9S A;  4GQC A;  1F37 A;  3V1W A;  1GUL A;  1SEN A;  4IHU A;  4IQA A;  5ECL B;  2HI7 A;  1EV9 A;  3WT1 A;  4MF5 A;  5CRW A;  4TR1 A;  2LNS A;  5ENU A;  3W6G A;  1X5C A;  2H73 A;  5C00 A;  3IRA A;  4MH3 A;  1PKW A;  4XRD A;  3GV1 A;  3RAZ A;  1FVK A;  1OE8 A;  2DIZ A;  2VD1 A;  2VLU A;  1XWK A;  3C1R A;  11GS A;  2CVB A;  1SD8 A;  1QMV A;  1NHY A;  4HQS A;  1GRX A;  2D2Z A;  5HFI A;  3ZIT A;  1CQG A;  1HNB A;  3TB2 A;  2AUV A;  4HUA A;  4F0B A;  3TJG A;  4ECI A;  4EDZ A;  2LS5 A;  4GF0 A;  3TUE A;  3RPN A;  1F3A A;  2QGV A;  2HFD A;  3KH9 A;  4EF0 A;  4AF2 A;  2O8V B;  2P5R A;  1EWX A;  2YWI A;  2VLT A;  3ZRE A;  2OAD A;  2I1U A;  1TDI A;  2HLS A;  4LLR A;  2GDR A;  4MK3 A;  4QL7 A;  5CRG A;  5DQY A;  2V32 A;  1GSS A;  1XW6 A;  5JCW A;  3PR8 A;  3ZLP A;  4KDY A;  2H75 A;  1O7U A;  2RUE A;  3NZN A;  1ZYE A;  2CZ2 A;  1Z9H A;  2KP2 A;  3UVT A;  3ZL5 A;  1OC9 A;  3M3M A;  1GTI A;  3KP9 A;  1TTZ A;  2L6C A;  4KCA A;  3D22 A;  2CA8 A;  5EL8 A;  4OFN A;  2QC7 A;  4OO5 A;  3VFI A;  2V6K A;  4QL9 A;  3DKS A;  2PU9 C;  3UAP A;  3TJJ A;  4J57 E;  2MBS A;  4PQ1 A;  1LBK A;  3DXB A;  4K7O A;  3FR9 A;  1DBY A;  1K0D A;  4HI7 A;  2RM6 A;  2PVQ A;  2HSY A;  1Q4J A;  1HNC A;  5A4V A;  5GAP D;  4EXJ A;  3TJB A;  3FKF A;  3MDK A;  1K0A A;  3VWW A;  1TU8 A;  4KH7 A;  2HYX A;  2RLI A;  3APS A;  1EOH A;  1TU7 A;  1N8J A;  1T1V A;  2YV9 A;  1GNW A;  3GX8 A;  2DSA A;  3DVX A;  2PN8 A;  1DE1 A;  3QFB C;  3APO A;  2MZC A;  1XZO A;  4K2D A;  1H75 A;  1V58 A;  2LST A;  4LMV A;  2FWH A;  1B48 A;  3C8E A;  3BD2 A;  4MPG A;  2GTU A;  4Q5F A;  4BL7 A;  1G6Y A;  4XS4 A;  2B7K A;  1M9B A;  1FB0 A;  2WCI A;  4HJM A;  4X0X A;  1FB6 A;  5CRE A;  2F8F A;  1XWB A;  5B7C A;  3CYN A;  2X64 A;  2VL3 A;  4MF6 A;  5IM9 A;  4G10 A;  3LXZ A;  2OA7 A;  4I8B A;  1ABA A;  4ZL9 A;  2IME A;  4V1A g;  1FAA A;  3FR6 A;  4OD7 A;  4IKH A;  4TVE A;  5E59 A;  4TR0 A;  3N9J A;  3UVH A;  1Z6N A;  4AJ6 A;  3Q19 A;  1LJR A;  2H1G A;  1TKD B;  3IPZ A;  3P8W A;  5ELG A;  3GTU A;  5CRH A;  2C0E A;  1F2E A;  2PGT A;  1UN2 A;  4KB3 A;  1PQN A;  1S3A A;  1AC1 A;  3GN3 A;  3I43 A;  3EMX A;  2R3X A;  4PX1 A;  2G2Q A;  5D96 A;  5INY A;  2YZH A;  3M8N A;  2JZS A;  3HD5 A;  1OYJ A;  2HXK A;  2VL9 A;  4ECB A;  2DC5 A;  2LJA A;  3CXG A;  3G7Y A;  4HU7 A;  5L71 A;  3VWX A;  3KTL A;  2LRT A;  3TJF A;  4JE1 A;  1EOG A;  4HU9 A;  18GS A;  3ERG A;  3CMI A;  2L5O A;  3GFK A;  4GLT A;  6GSV A;  1G7O A;  1NW2 A;  2NBS A;  3DML A;  3TRP A;  1BG5 A;  1SJZ A;  6GST A;  4WR4 A;  4JBB A;  4J56 E;  2DMM A;  4WF5 A;  1Q98 A;  1R5A A;  2IFQ A;  1XIY A;  2EIQ A;  4PUR A;  2C80 A;  5A5K A;  3WT2 A;  1SU9 A;  1QXH A;  3PIN A;  1UVZ A;  4N30 A;  1IYH A;  1OC8 A;  4Q5R A;  5IO2 A;  2BMX A;  1V2A A;  2L4C A;  2V41 A;  3H79 A;  4NWY A;  2TIR A;  1M9A A;  5HFK A;  3GNJ A;  2GQM A;  4KSO A;  4FIW A;  1RK4 A;  1XFL A;  1ACV A;  4OFT A;  4EC0 A;  4OO4 A;  1HYU A;  3JCM L;  3FRC A;  2EIR A;  5DDL A;  1A2M A;  5G5E A;  1O8W A;  2FA4 A;  4IJ3 A;  1GSD A;  2ZNM A;  2H6Y A;  4H86 A;  2R5G A;  2RII A;  3EC3 A;  2VIM A;  3ZIJ A;  5IO0 A;  1B4Q A;  1SYX A;  2H70 A;  2FNO A;  4TXO A;  2GSQ A;  2GSS A;  2YPM A;  3UMA A;  5ELA A;  1ERU A;  4X43 A;  2GSR A;  5ECK B;  3SBC A;  4EUY A;  1J0F A;  5CO3 A;  3ZZX A;  3ZIV A;  2K18 A;  3ZFL A;  2C0D A;  3TOT A;  1EEM A;  5D9T A;  2B5X A;  1RQM A;  5JCU A;  5KN2 A;  1FW1 A;  4GCI A;  4ID0 A;  4ZBD A;  2ON5 A;  2IIY A;  4G9H A;  5ID2 A;  3LEF A;  5CRD A;  2FUG 2;  1H4O A;  3DYR A;  2CZ3 A;  3HXS A;  3VUR A;  1N2A A;  1AIU A;  4MZW A;  1M2D A;  2GQK A;  2NVL A;  2NDO A;  1URM A;  16GS A;  3TDG A;  2A2R A;  2IMI A;  3N5O A;  4KDU A;  4DSR A;  4MF7 A;  5ECI B;  3IDV A;  3GSS A;  4RUV A;  2VOC A;  4WF4 A;  4POK A;  2QKE A;  2OAC A;  2YWO A;  19GS A;  2FD3 A;  3ZVJ D;  3WGE A;  2FCH A;  5CP1 A;  5J3R A;  4RI7 A;  4KX4 A;  3HJP A;  3GKN A;  5JWQ B;  1JLV A;  5G31 A;  3FR3 A;  2C1Y A;  4KA0 A;  3TCO A;  9GSS A;  10GS A;  2H74 A;  3HZ4 A;  5H5Q A;  4ULX A;  3KIJ A;  2X8H A;  3BJ5 A;  2K8V A;  3GH6 A;  1GSF A;  3GKX A;  5JWO B;  3HVX A;  2B1K A;  12GS A;  2C3N A;  4WBJ A;  1O73 A;  3LFL A;  3TKS A;  4GQF A;  4D73 A;  4GST A;  3NOF A;  3RPP A;  1O81 A;  2ALB A;  5J41 A;  3H8Q A;  1EV4 A;  1PA3 A;  4EKZ A;  2H71 A;  1A23 A;  4AJ7 A;  4NV2 A;  2FWF A;  3C73 A;  5J9B A;  4FYC A;  2CAQ A;  1BYE A;  2OJL A;  1ZMA A;  1A8L A;  1T8E B;  5HQP A;  5AN1 A;  2LQO A;  1X0R A;  2X8G A;  1FVJ A;  2ZUP A;  4TR1 B;  3VPQ A;  2PER A;  2LKU A;  3D5J A;  1WJK A;  4HJ2 A;  2GZY A;  3KM6 A;  3GKK A;  3M1G A;  3US3 A;  4PXO A;  3D21 A;  1U3A A;  4Z7X A;  1UA5 A;  3QDN A;  2HRN A;  4OWY A;  2ON7 A;  4G19 A;  4ILF A;  1M7T A;  22GS A;  4NHW A;  1YDK A;  4K8M A;  1FOV A;  1ON4 A;  1WRY A;  4GTU A;  4I5Q A;  2PPT A;  3AY8 A;  2L59 A;  4MJC A;  3KMO A;  2VO4 A;  2XPE A;  1VF4 A;  1EGR A;  4MJA A;  5IPG A;  4POM A;  2GT6 A;  6GSX A;  5DAK A;  1XXU A;  17GS A;  7GSS A;  4YAV A;  1SJI A;  4ZXG A;  2N5A A;  5HFG A;  1AXD A;  4HZ2 A;  4PUA A;  4DSS B;  2TRX A;  1ILO A;  3M9K A;  3ED3 A;  1MEK A;  3CBU A;  2OE1 A;  2K8S A;  3VI7 A;  1SKS B;  4DSQ A;  2YCD A;  2CAI A;  1OC9 B;  4XTS A;  1GSY A;  4Q5Q A;  1JFU A;  2JAD A;  3D0Z A;  3EYT A;  1YKC A;  3C1S A;  2JAC A;  3EMP A;  2IN3 A;  3PGT A;  2E2G A;  1PX6 A;  2KHP A;  1XWG A;  2IL3 A;  4ZL7 A;  3ZFB A;  1I9D A;  5H5R A;  3HKR A;  3F0I A;  1GSU A;  5B6M A;  2OE3 A;  3GMF A;  2GST A;  1THX A;  4PQH A;  1SL1 B;  4BVY A;  1SK2 A;  2ZCT A;  3FEU A;  3LOR A;  1Y25 A;  2WRT A;  4L5L A;  4TN8 A;  3EUR A;  1ZYQ B;  1XVW A;  1E2Y A;  4MZC A;  5GST A;  1XOB A;  1A2L A;  2AAW A;  2MBT A;  2G0F A;  4TR4 A;  3F6D A;  3IBH A;  2FWG A;  2VL2 A;  3WYW A;  2GZZ A;  1AAZ A;  4MA9 A;  5ABR A;  3KH7 A;  4XS4 B;  2OBK A;  1K3Y A;  3WGX A;  3WGD A;  3LSZ A;  2IWT A;  4V2M A;  4XS6 A;  3F9U A;  3IV4 A;  1XW5 A;  2PVO C;  5D93 A;  2P5Q A;  2PBJ A;  3UBK A;  1PGT A;  3F6F A;  4FO5 A;  3J7Y b;  1K0O A;  3FK8 A;  1IYI A;  5ECR B;  3HJO A;  3F8U A;  2GVP A;  2AHE A;  5F06 A;  2JSZ A;  2DML A;  1M0U A;  5HR1 A;  2YP6 A;  2H1D A;  4ML6 A;  2E2M A;  3TOU A;  1TI3 A;  2HZE A;  2FGX A;  2EC4 A;  1KBN A;  1A0R P;  3SWL A;  3MNG A;  1G6W A;  2LRC A;  1BX9 A;  4LL1 B;  2DBC A;  4E8H A;  2VCQ A;  4CW9 A;  2CT6 A;  1GL8 A;  2H1A A;  4YQV A;  2XBQ A;  1F9M A;  4IS0 A;  1ML6 A;  5J5N A;  4XS1 A;  1K0C A;  2DJJ A;  3KD0 A;  5AGY A;  2C3T A;  4ECC A;  1TRV A;  3HCZ A;  4TR3 A;  6GSY A;  3BCI A;  1Z7R A;  4JED A;  3E3E A;  1TK8 B;  3H4K A;  4CHS A;  2YAN A;  3HZ8 A;  3RHC A;  5G5F A;  1JZO A;  3IAM 2;  1HNA A;  1DSB A;  2WGR A;  1O6J A;  4GSS A;  3EVI A;  2MMZ A;  5D9W A;  3ME7 A;  3IHQ A;  4LA1 A;  3Q18 A;  3KJY A;  1R7H A;  4XRA A;  4O7H A;  2L57 A;  4IQ1 A;  2IFQ B;  3F3R A;  1GSQ A;  4F2I A;  1GTB A;  3D4T A;  2I4A A;  4IN0 A;  4MAB A;  1QFN A;  3RBT A;  3IC4 A;  1YKA A;  2VCZ A;  4RI6 A;  3FHK A;  3GL5 A;  2GZP A;  1OKD A;  3GX0 A;  3F4R A;  4V1A p;  4KUN A;  2F9S A;  2HZF A;  4MJE A;  2JZT A;  1GNE A;  3DRN A;  2AV4 A;  3QAV A;  1MTC A;  2HRF A;  3KCM A;  4PNG A;  3C71 A;  2F8A A;  1QGV A;  4J2F A;  2DJ3 A;  4GSN A;  4L0W A;  2DIY A;  1V57 A;  4IVF A;  1A24 A;  3O76 A;  2KUC A;  5GAN D;  2C4J A;  1GLP A;  3QMX A;  4TXO B;  2I81 A;  4WXT A;  1KEB A;  2H01 A;  4K7N A;  1PN9 A;  1R5P A;  2OKA A;  1WIK A;  1OC3 A;  4GWR A;  1JHB A;  1MD3 A;  4I6X A;  1X9M B;  4EL1 A;  3F4T A;  5EPF A;  2VCX A;  3E9J B;  4BWS A;  5A4U A;  3CRT A;  1PSQ A;  5ID2 B;  3VLN A;  2VLV A;  5AIS A;  2CQ9 A;  4L5O A;  4ZB9 A;  3BOA A;  2CV4 A;  4O5R A;  3IAS 2;  5IOW A;  4K9Z A;  3DD3 A;  1QQ2 A;  2YJH A;  1TJD A;  2H19 A;  1KTE A;  4GRF A;  4HQZ A;  3UEM A;  2LUS A;  3IK9 A;  4E8E A;  1YY7 A;  1K0N A;  1NHO A;  2C8U A;  2J23 A;  2L6D A;  4KE3 A;  4TW5 A;  1F6M C;  3TRQ A;  4V2N A;  2XC2 A;  1XBS A;  1EP8 A;  1V9W A;  1T7P B;  4KGI A;  2I9H A;  4X1U A;  5ECM B;  3GHA A;  2XHF A;  2LJR A;  1ERW A;  3BCK A;  3L9V A;  3F63 A;  5JCG A;  1B8X A;  3I69 A;  2I3Y A;  2R37 A;  4NHZ A;  4OMV A;  2DJK A;  2NPB A;  3CTF A;  4MCU A;  1T4Z A;  4AGS A;  4WKW A;  1U6T A;  5FWG A;  2H1B A;  4ZB6 A;  1R4W A;  2XBI A;  1YF0 A;  3MAK A;  3DWV A;  2R6K A;  4BPY A;  2CVK A;  2CX3 A;  2X8C A;  3I9V 2;  1MDI A;  3MWH A;  4XIH A;  2M80 A;  3HDC A;  3APQ A;  3VPT A;  1C72 A;  1GUK A;  4O92 A;  3LQ7 A;  1T4Y A;  2V6O A;  3EWL A;  5KEJ A;  4IJI A;  5ECO B;  3VK9 A;  4EDY A;  2AB6 A;  4K1F A;  4PGT A;  3KEB A;  1M99 A;  4O32 A;  1AW9 A;  3HVV A;  4D73 B;  5DAL A;  2HT9 A;  4QQ7 A;  4FYU A;  1U88 A;  1XVQ A;  4YQU A;  1TRW A;  3P7X A;  4MDC A;  1OE7 A;  4WEY A;  4TRX A;  5F0G A;  3L9S A;  1KNG A;  5IOX A;  2F3M A;  5EVO A;  5GSS A;  4OCF A;  1GUM A;  1SJ6 A;  2FA8 A;  3EE2 A;  3UOM A;  1ZZY A;  3U5R E;  1V98 A;  4ZBA A;  4HEA 2;  2BTO T;  3G7I A;  5F05 A;  1YQ1 A;  4V2L A;  5D9V A;  3DVW A;  2VCT A;  1M2B A;  4WBR D;  1XCC A;  5H5S A;  5FT3 A;  1WOU A;  3UIW A;  1B9X C;  3QAG A;  3L9U A;  2GGT A;  4RQR A;  1J08 A;  1USB A;  2V2G A;  1WE0 A;  3CRU A;  1TI1 A;  3M9J A;  1A2J A;  3VWV A;  5KN3 A;  5DBQ A;  1MDJ A;  4IBP A;  1XWC A;  1SK1 A;  3LGC A;  3ZRD A;  2FHE A;  2OE0 A;  1XWA A;  2B6M A;  1I5G A;  1T00 A;  3PH9 A;  3TRX A;  1JZW A;  1PRX A;  1X9W B;  2RM5 A;  5IMA A;  1CQH A;  2LTK A;  2WB9 A;  2FLS A;  1EGO A;  3F4S A;  4YQM A;  2B7J A;  3UL3 A;  4PNF A;  2HNL A;  5LNK e;  3F3Q A;  4KW6 A;  2O85 A;  3W8J A;  3P2A A;  1YEX A;  2WZ9 A;  1ZGN A;  1ZCP A;  2AJQ B;  1O85 A;  1PMT A;  2VAF A;  4IGJ A;  3UJ1 A;  4TOP A;  5A4W A;  1M2A A;  6GSW A;  3CTG A;  3FZA A;  1FO5 A;  1QUW A;  2PMT A;  2WUL A;  5HR2 A;  2VD0 A;  3TKQ A;  3GST A;  4GXZ A;  3LYP A;  4NMU A;  2GS3 A;  3LG6 A;  4RQX A;  2CVD A;  5F8B A;  2WDU A;  4DVC A;  2WS2 A;  4N10 A;  2IJY A;  1TP9 A;  1THO A;  5IMC A;  4NV5 A;  4PQI A;  4YAP A;  3HYP A;  1X5D A;  2C0G A;  2LNT A;  1TRU A;  4LMW A;  1PX7 A;  1PL2 A;  2OBI A;  2VM1 A;  5ECP B;  2YZU A;  3O3T A;  3U6V A;  2E0Q A;  1G0T A;  3GUS A;  2HE3 A;  1ERT A;  3GUR A;  3GYK A;  4LL4 B;  2YV7 A;  3LXT A;  1E6B A;  1SKR B;  5GZZ B;  2LQQ A;  1W89 A;  4DSS A;  5IMZ A;  3CSH A;  3RDW A;  4BWQ A;  3EIN A;  1TW9 A;  3QR6 A;  5IMV A;  3I6A A;  3KTB A;  1NM3 A;  1YJ6 A;  3RHB A;  5IMD A;  3UBL A;  5KN1 A;  3H1N A;  1ZL9 A;  3Q74 A;  2DJ2 A;  4NPB A;  2NTO A;  4N0Z A;  3G9B A;  3IOS A;  3QOU A;  4TKY A;  2H6X A;  1SL0 B;  2EIO A;  2KP1 A;  2O87 A;  3G7J A;  2AYT A; 
#chains in the Genus database with same CATH topology
 2EHS A;  4YH2 A;  3WD6 A;  4F37 A;  3L78 A;  4MJB A;  2JBG A;  2WFC A;  3FW2 A;  5G30 A;  5F07 A;  4F9Z A;  2QA1 A;  5DQS A;  3IXR A;  3CSI A;  4CY8 A;  4L8E A;  4MP4 A;  4MZB A;  1IUQ A;  3EU4 A;  1HQO A;  2LJK A;  2HZE B;  5IPH A;  3A3T A;  1YF1 A;  1M74 A;  4KCE A;  2LEG A;  4K6X A;  1AQV A;  5BRT A;  1AQX A;  2JB0 A;  2B3S A;  2GYK A;  2N5F A;  3G4S P;  2ES7 A;  3HY2 A;  2K2Q A;  2PEI A;  5HR0 A;  3LYK A;  2O7K A;  2F51 A;  1GTU A;  5JWR B;  2DJ1 A;  1JZD A;  2C0F A;  3ZYW A;  3IE3 A;  3QCP A;  2VCV A;  1Y6E A;  1BJX A;  2CWO A;  4F82 A;  5EY6 A;  4ACS A;  3GTU B;  2X99 A;  1AYI A;  6GSS A;  2FQ0 A;  2JZR A;  4L0U A;  2REM A;  2M46 A;  5KN0 A;  5BS2 A;  3TGZ A;  1EZK A;  3GRX A;  3MYD A;  3DIE A;  5B8A A;  2WJU A;  4ZIJ A;  2R4V A;  4K7I A;  2EFJ A;  3GL3 A;  1LU4 A;  5DJL A;  3CCE P;  2JU5 A;  1G7E A;  2H66 A;  4I97 A;  3R2Q A;  2J9H A;  3L0H A;  4BA7 A;  1J9B A;  1GP1 A;  3A2W A;  4N11 A;  5HGL A;  4EO3 A;  1VF1 A;  1ST9 A;  1K0M A;  3E0U A;  1B4P A;  2MMO A;  1SK0 A;  3ME8 A;  1OVN A;  4JU5 A;  2H0H A;  4N0V A;  2YWM A;  1VF3 A;  3KMN A;  1GTA A;  3G1I A;  3A5W A;  3HA9 A;  4HS1 A;  1A8Y A;  5ECQ B;  1VF2 A;  2GZG A;  1VRS D;  1TRS A;  4OFM A;  3FZ9 A;  4YKF A;  1TOF A;  2FWE A;  1PL1 A;  4BVX A;  3HHV A;  2O89 A;  4XHM A;  1SD9 A;  1EP7 A;  1DV5 A;  4Q5N A;  3TJK A;  1JLW A;  1TK0 B;  5E4W A;  1OAZ A;  4JR6 A;  2L4Q A;  5IMF A;  3EU3 A;  3FY7 A;  4PUF C;  1N8R Q;  4F0C A;  2MMN A;  2MD9 A;  2YNX A;  5IIZ A;  1GLQ A;  2H30 A;  2FHS C;  5D9X A;  4ICY A;  2LRN A;  1RW1 A;  5KP8 B;  4YKG A;  2DLX A;  3TKS C;  2TRC P;  3CME P;  4ISD A;  3W8S A;  1YIJ P;  3O6T A;  2JO0 A;  2IMD A;  3IK7 A;  3DEX A;  1BAY A;  1X3O A;  1K3O A;  3KGK A;  1WWJ A;  1Q7Y Q;  4FH8 A;  3FZ5 A;  2FVA A;  1OKT A;  4DEJ A;  1KQS O;  1GXH A;  5HGM A;  5CNW A;  3VI5 A;  5D8I A;  3GKM A;  2GDY A;  2IMK A;  3QPM A;  1HQB A;  3A2X A;  5G1K A;  2PUK C;  4CA3 A;  2HRK A;  3LWA A;  4EVM A;  3ERF A;  2HSM A;  1T3B A;  2L5L A;  2R0P A;  2C3Q A;  4WR5 A;  4Z2T A;  1GH2 A;  2VUP A;  2B1L A;  2DJ0 A;  3IR4 A;  3Q6O A;  1DUG A;  3BBY A;  1MD4 A;  2B5Y A;  4CDO A;  1A0F A;  1RO0 A;  2LOL A;  1QK8 A;  4K0N A;  1YEP A;  1F3B A;  1KC8 Q;  1KD1 Q;  2YWN A;  8GSS A;  1WPI A;  5G2Z A;  3TKP A;  2KOK A;  1UC7 A;  4QNB A;  4NXI A;  4CY6 A;  3MIX A;  2BJX A;  3L4N A;  1VKU A;  1O8X A;  1R26 A;  2IPA A;  2JU1 A;  2JL4 A;  3S9F A;  2KGD A;  2LV3 A;  3TKS E;  5B8B A;  20GS A;  3NIV A;  2GT5 A;  4JR4 A;  2N5I A;  1NSW A;  3ZVJ A;  1SL2 B;  1S72 P;  3TKR A;  1L0I A;  1X9S B;  3LJR A;  5LD0 A;  3G0V A;  2GZI A;  3MGE A;  1VQ6 P;  1S3D A;  2FY6 A;  2H76 A;  3HJM A;  6GSU A;  1WP0 A;  4PTS A;  1U3I A;  5J4U A;  1S3C A;  2MYG A;  3C7M A;  5DVB A;  2KOR A;  4ECJ A;  5BMU A;  1Z6M A;  3UAR A;  3GA4 A;  3ZMK A;  2H8L A;  4IP1 A;  1GWC A;  1T8K A;  1K0B A;  3CSJ A;  4IW9 A;  1DE2 A;  2E1M A;  5ECH B;  4MPF A;  2KLX A;  1PD2 1;  1M1K Q;  4NAX A;  1W4V A;  2CX4 A;  4FQU A;  4HZ4 A;  4IP6 A;  5C04 A;  2QA2 A;  5CAX A;  2V1M A;  3FZ4 A;  1XPV A;  2E7P A;  2B5E A;  4R0M A;  1SKW B;  4EE0 A;  2N5B A;  4PH1 A;  4IEL A;  5COH A;  3CC4 P;  2A2S A;  3DGQ A;  5FHI A;  4KND A;  4USS A;  1TK5 B;  3IC8 A;  1TXX A;  3H93 A;  4I2U A;  3GIX A;  1WMJ A;  2GQL A;  1S3R A;  2P31 A;  4K0G A;  4Z2U A;  4JRR A;  3A2V A;  4HDE A;  4ZIL A;  4WYM A;  5LCZ A;  2LTE A;  5DAL B;  3QFA C;  4FYB A;  4KDX A;  1VHN A;  2L0Q A;  4I2T A;  2FQ2 A;  5J9C A;  1ZMB A;  3ZML A;  3D6I A;  4H2Y C;  4XCS A;  2VM2 A;  3ERW A;  3OR5 A;  5B6N A;  2K6V A;  2DNW A;  2FAD A;  1BED A;  4F03 A;  2LIW A;  2R2J A;  3CCQ P;  3G26 A;  2H72 A;  2VL2 C;  2XPD A;  2JQ4 A;  1U87 A;  5IQY A;  3M0F A;  4MMM A;  2K9F A;  4KAE A;  3KXO A;  1Z5Y E;  2M72 A;  5G1L A;  5CYY A;  2PEO A;  2QSI A;  1JZR A;  3ZTL A;  4HKG A;  2GZJ A;  3K8N A;  4TXV A;  14GS A;  1B9Y C;  2BUO A;  1ZYN A;  2YJ7 A;  1AUC A;  1GUH A;  4ZBB A;  4G2E A;  3IA1 A;  2RUF A;  1Z7P A;  2N6Y A;  4P3Y B;  1XW9 A;  1XOA A;  3J7Y k;  4NEO A;  1YZX A;  4POL A;  2P0G A;  3CCV P;  1K3L A;  2ROQ A;  1PKZ A;  2JSY A;  1MDK A;  4JZQ A;  2P9X A;  1VGL A;  2IMF A;  4X4J A;  2YN1 A;  2ERH A;  5AIV A;  1EEJ A;  1FHE A;  5HR3 A;  3QAW A;  1Z3E A;  3CCM P;  2H6Z A;  4AJ8 A;  2M5R A;  3HVS A;  5DJM A;  5DCH A;  2H0G A;  2MMA A;  1ZYP A;  1L0H A;  1ZNV A;  1GXG A;  2H0I A;  3DTJ A;  2A2P A;  1AQW A;  2GLR A;  4WET A;  13GS A;  4HOJ A;  3GH9 A;  2PEN A;  2A4V A;  4OCE A;  1GSE A;  3KP8 A;  5ECS A;  1HD2 A;  5AIX A;  3D4M A;  1VQ7 P;  4ZB8 A;  4MH2 A;  5D73 A;  1FG4 A;  2CGQ A;  1ZOF A;  3QD9 A;  3FYG A;  3B4Q A;  1X5E A;  4G0K A;  4POB A;  2HSH A;  3VWU A;  5DAK B;  1SYR A;  2FAC A;  3P90 A;  4ZL8 A;  1EOQ A;  3DS1 A;  1V40 A;  3ISO A;  1BQ7 A;  4MLY A;  4KSM A;  4ML1 A;  4U0D A;  5DCG A;  2MF4 A;  3MSZ A;  2VCW A;  2YOI A;  5ECN B;  1ERV A;  2PWJ A;  3KZQ A;  2Z9S A;  4GQC A;  4U0E A;  2MY5 A;  1F37 A;  1VQM P;  3V1W A;  3Q20 A;  1GUL A;  1SEN A;  4IHU A;  4IQA A;  5ECL B;  2HI7 A;  1M6E X;  1EV9 A;  3WT1 A;  4MF5 A;  5CRW A;  4TR1 A;  3I56 P;  2LNS A;  5ENU A;  3W6G A;  1X5C A;  2H73 A;  1PN0 A;  5C00 A;  1UNK A;  3IRA A;  4MH3 A;  5EJD A;  1PKW A;  1CEI A;  4XRD A;  3GV1 A;  3RAZ A;  1FVK A;  5HGO A;  1OE8 A;  2DIZ A;  1M6N A;  3I55 P;  2VD1 A;  2VLU A;  1XWK A;  3C1R A;  11GS A;  2CVB A;  1F80 D;  2L9F A;  1SD8 A;  1QMV A;  1NHY A;  4HQS A;  1GRX A;  3A5I A;  1VQK P;  2D2Z A;  5HFI A;  3ZIT A;  1CQG A;  1HNB A;  3TB2 A;  2AUV A;  3HYB A;  4HUA A;  4F0B A;  1VQP P;  3TJG A;  4ECI A;  2KOQ A;  3CCR P;  4EDZ A;  2LS5 A;  4GF0 A;  3TUE A;  3RPN A;  1F3A A;  2QGV A;  3H0D A;  2HFD A;  3KH9 A;  3DPH A;  4EF0 A;  4AF2 A;  2O8V B;  2P5R A;  3NTE A;  1EWX A;  2YWI A;  2VLT A;  3ZRE A;  2OAD A;  4GR6 A;  2I1U A;  1TDI A;  2HLS A;  2JAZ A;  4LLR A;  2GDR A;  2KWL A;  2QA4 P;  4MK3 A;  4QL7 A;  5CRG A;  5DQY A;  2V32 A;  1GSS A;  1XW6 A;  5JCW A;  3PR8 A;  3ZLP A;  2K93 A;  4KDY A;  2H75 A;  1O7U A;  2RUE A;  3NZN A;  1ZYE A;  2CZ2 A;  1Z9H A;  2KP2 A;  3UVT A;  3ZL5 A;  1OC9 A;  3M3M A;  1GTI A;  3KP9 A;  1TTZ A;  2L6C A;  4KCA A;  3D22 A;  2CA8 A;  5EL8 A;  2XXM A;  4OFN A;  2QC7 A;  4OO5 A;  4XFX A;  3VFI A;  2V6K A;  3CC2 P;  3CCJ P;  4G0I A;  4UHP B;  4QL9 A;  3DKS A;  5I4T G;  4U0C A;  2LIU A;  2PU9 C;  3UAP A;  3TJJ A;  4J57 E;  2MBS A;  2AVA A;  4PQ1 A;  1LBK A;  2K0D X;  3DXB A;  4K7O A;  4HSC X;  3FR9 A;  1DBY A;  1K0D A;  4HI7 A;  2RM6 A;  2PVQ A;  2HSY A;  2A4H A;  1Q4J A;  1HNC A;  3DS0 A;  5A4V A;  1EIA A;  4U0B A;  5GAP D;  4EXJ A;  3TJB A;  3FKF A;  3MDK A;  1K0A A;  3VWW A;  1TU8 A;  4KH7 A;  2HYX A;  2RLI A;  3APS A;  1EOH A;  1TU7 A;  1N8J A;  1T1V A;  3OW2 O;  2R0G A;  2YV9 A;  1GNW A;  3GX8 A;  2DSA A;  3DVX A;  2PN8 A;  1DE1 A;  4BPG A;  3QFB C;  3APO A;  2MZC A;  1XZO A;  4K2D A;  1H75 A;  1V58 A;  2LST A;  4LMV A;  2FWH A;  1B48 A;  3C8E A;  3BD2 A;  4MPG A;  2KG8 A;  2GTU A;  2UZ8 A;  4Q5F A;  4BL7 A;  3B5I A;  1G6Y A;  4XS4 A;  2B7K A;  1M9B A;  1FB0 A;  2OTL P;  2WCI A;  4HJM A;  4X0X A;  1FB6 A;  3G71 P;  5CRE A;  2F8F A;  1K30 A;  4PH0 A;  1XWB A;  5B7C A;  1PFO A;  2Z46 A;  3CYN A;  2X64 A;  4GR2 A;  2VL3 A;  4MF6 A;  2R0C A;  5IM9 A;  4BVX B;  4G10 A;  1K73 Q;  3LXZ A;  2K0X A;  2OA7 A;  4I8B A;  1ABA A;  4K5R A;  4ZL9 A;  2IME A;  1FAA A;  3FR6 A;  4V1A g;  4OD7 A;  4IKH A;  4TVE A;  5E59 A;  4TR0 A;  2FVF A;  3N9J A;  3UVH A;  1Z6N A;  4AJ6 A;  3Q19 A;  1LJR A;  2H1G A;  1TKD B;  3IPZ A;  4O5Q A;  3P8W A;  5ELG A;  3GTU A;  5CRH A;  2C0E A;  1F2E A;  4KF9 A;  2FQ1 A;  2PGT A;  3DS4 A;  1UN2 A;  2N98 A;  4KB3 A;  1M90 Q;  1PQN A;  1S3A A;  1AC1 A;  3GN3 A;  3I43 A;  3RG6 C;  3EMX A;  2JYG A;  2R3X A;  1OR5 A;  4PX1 A;  2G2Q A;  5D96 A;  5INY A;  2YZH A;  3M8N A;  2JZS A;  3HD5 A;  1OYJ A;  2HXK A;  1HY8 A;  2VL9 A;  4ECB A;  2DC5 A;  2LJA A;  3CXG A;  3G7Y A;  4HU7 A;  4MNN A;  2MVU A;  5L71 A;  3VWX A;  3KTL A;  2LRT A;  2DGY A;  3TJF A;  1UJZ A;  4JE1 A;  2AFD A;  4MRT C;  1EOG A;  4HU9 A;  18GS A;  3ERG A;  3CMI A;  2L5O A;  3CPW O;  2DKI A;  3GFK A;  2MR7 A;  4GLT A;  6GSV A;  1G7O A;  1NW2 A;  2NBS A;  3DML A;  3TRP A;  1BG5 A;  1SJZ A;  6GST A;  4WR4 A;  5KOW A;  4JBB A;  3G6E P;  4J56 E;  3G28 A;  2DMM A;  4WF5 A;  5KOX A;  1Q98 A;  1R5A A;  3G21 A;  2IFQ A;  1XIY A;  2EIQ A;  4PUR A;  2C80 A;  5A5K A;  3WT2 A;  1SU9 A;  1QXH A;  3PIN A;  1UVZ A;  4N30 A;  1IYH A;  1OC8 A;  4Q5R A;  5IO2 A;  2BMX A;  1V2A A;  2L4C A;  2V41 A;  3H79 A;  4NWY A;  2TIR A;  4BPF A;  1M9A A;  5HFK A;  3GNJ A;  2GQM A;  4KSO A;  1VQL P;  4FIW A;  1RK4 A;  1XFL A;  1ACV A;  3DS3 A;  4OFT A;  4EC0 A;  4OO4 A;  1HYU A;  3CD6 P;  3JCM L;  3FRC A;  2EIR A;  5DDL A;  1A2M A;  2VSQ A;  5G5E A;  1O8W A;  2FA4 A;  2LF4 A;  4IJ3 A;  1DNY A;  1GSD A;  2KOD A;  2ZNM A;  2H6Y A;  4H86 A;  2R5G A;  2RII A;  3EC3 A;  1QVG O;  2PNG A;  2GZE A;  2VIM A;  3ZIJ A;  5IO0 A;  1B4Q A;  1SYX A;  2H70 A;  2FNO A;  4TXO A;  2GSS A;  1JJ2 O;  2GSQ A;  2AF8 A;  2YPM A;  3UMA A;  5ELA A;  1ERU A;  4X43 A;  2GSR A;  5ECK B;  3SBC A;  4EUY A;  2MR8 A;  1J0F A;  5CO3 A;  3ZZX A;  2XT1 A;  1FR2 A;  3ZIV A;  2K18 A;  3ZFL A;  2M8L A;  2C0D A;  3TOT A;  1EEM A;  2B5X A;  5D9T A;  1RQM A;  4H2X C;  5JCU A;  5KN2 A;  1FW1 A;  4GCI A;  4ID0 A;  4ZBD A;  2ON5 A;  2IIY A;  4G9H A;  5ID2 A;  3LEF A;  5CRD A;  2FUG 2;  1H4O A;  3DYR A;  2CZ3 A;  3HXS A;  3VUR A;  4H2W C;  1N2A A;  1AIU A;  4MZW A;  3FMW A;  1M2D A;  3EPT A;  3DS5 A;  2GQK A;  2NVL A;  2NDO A;  1URM A;  16GS A;  3TDG A;  2A2R A;  2IMI A;  2KW2 A;  3N5O A;  4KDU A;  4DSR A;  4MF7 A;  5ECI B;  3IDV A;  3GSS A;  4RUV A;  2VOC A;  4WF4 A;  2KGC A;  4POK A;  1EMV A;  2QKE A;  2OAC A;  2YWO A;  19GS A;  2FD3 A;  5BS1 A;  3ZVJ D;  2M8N A;  3WGE A;  4BPH A;  2FCH A;  5CP1 A;  5J3R A;  4RI7 A;  4KX4 A;  3HJP A;  2CQ8 A;  3GKN A;  5JWQ B;  1JLV A;  5G31 A;  3FR3 A;  2C1Y A;  1XG8 A;  4KA0 A;  3TCO A;  1YJN P;  1VQ8 P;  9GSS A;  10GS A;  2H74 A;  3HZ4 A;  5H5Q A;  4ULX A;  5HVC A;  3KIJ A;  2X8H A;  3BJ5 A;  2K8V A;  3GH6 A;  1GSF A;  3GKX A;  5JWO B;  3HVX A;  4EIQ A;  2N50 A;  2B1K A;  12GS A;  2C3N A;  4WBJ A;  1O73 A;  3LFL A;  3TKS A;  4GQF A;  4D73 A;  4GST A;  3NOF A;  3RPP A;  1O81 A;  2ALB A;  5J41 A;  3H8Q A;  1EV4 A;  1PA3 A;  4EKZ A;  2H71 A;  1A23 A;  4AJ7 A;  4NV2 A;  3CXC O;  1A8O A;  2FWF A;  3C73 A;  2PEM A;  5J9B A;  4FYC A;  2CAQ A;  1BYE A;  2OJL A;  1ZMA A;  1A8L A;  1T8E B;  5HQP A;  2WPT A;  5AN1 A;  3GJN A;  2LQO A;  1X0R A;  2X8G A;  1FVJ A;  2ZUP A;  4TR1 B;  2QNW A;  3VPQ A;  2PER A;  2LKU A;  2X4A A;  3D5J A;  1WJK A;  4HJ2 A;  2GZY A;  3KM6 A;  3GKK A;  3WBH A;  2KG9 A;  3M1G A;  1YHQ P;  3US3 A;  2KG6 A;  4PXO A;  3D21 A;  4PXH B;  1U3A A;  4Z7X A;  5DCK A;  1YJ9 P;  1UA5 A;  3QDN A;  2HRN A;  4OWY A;  2ON7 A;  3IHG A;  4G19 A;  4ILF A;  2X49 A;  1M7T A;  22GS A;  4NHW A;  1YDK A;  4K8M A;  1FOV A;  1ON4 A;  1BAJ A;  1WRY A;  4GTU A;  5JPA A;  4I5Q A;  3RG2 A;  2PPT A;  4XFY A;  2XV6 A;  3AY8 A;  2CG5 B;  2L59 A;  2M8P A;  4MJC A;  3KMO A;  2VO4 A;  2XPE A;  1VF4 A;  1EGR A;  4MJA A;  5IPG A;  4POM A;  2GT6 A;  6GSX A;  5DAK A;  1XXU A;  17GS A;  7GSS A;  4YAV A;  1SJI A;  4ZXG A;  2N5A A;  5HFG A;  1AXD A;  4HZ2 A;  4PUA A;  4DSS B;  3EJE A;  2TRX A;  1ILO A;  3M9K A;  2JYL A;  3ED3 A;  1MEK A;  3CBU A;  2OE1 A;  2K8S A;  3VI7 A;  1SKS B;  4DSQ A;  2YCD A;  2CAI A;  1FOH A;  1OC9 B;  1AUM A;  4XTS A;  2HRA A;  1GSY A;  4Q5Q A;  1JFU A;  2JAD A;  3D0Z A;  3EYT A;  1YKC A;  3C1S A;  1YI2 P;  4XFZ A;  2JAC A;  3EMP A;  2IN3 A;  3PGT A;  2E2G A;  1PX6 A;  2KHP A;  1XWG A;  5KP7 B;  2IL3 A;  4ZL7 A;  3ZFB A;  1I9D A;  5H5R A;  3HKR A;  3F0I A;  1GSU A;  5B6M A;  2OE3 A;  2OTJ P;  3GMF A;  2LKI A;  2GST A;  2K92 A;  1THX A;  4PQH A;  1SL1 B;  4BVY A;  1SK2 A;  2ZCT A;  3FEU A;  3LOR A;  1Y25 A;  3GZM A;  2XZ1 C;  2WRT A;  4L5L A;  2DKH A;  4TN8 A;  3EUR A;  1ZYQ B;  1XVW A;  1E2Y A;  2FAE A;  4MZC A;  5GST A;  1XOB A;  2NO8 A;  1A2L A;  2AAW A;  2MBT A;  2KOO A;  2G0F A;  4TR4 A;  3F6D A;  1D1D A;  3IBH A;  3CCS P;  2FWG A;  2VL2 A;  3WYW A;  2GZZ A;  1AAZ A;  4MA9 A;  4BL7 B;  3P05 A;  5ABR A;  2PEJ A;  3KH7 A;  4XS4 B;  2OBK A;  1K3Y A;  3WGX A;  3WGD A;  3LSZ A;  2IWT A;  4V2M A;  3EJD A;  4XS6 A;  3F9U A;  3R3E A;  3IV4 A;  1XW5 A;  2PVO C;  5D93 A;  2P5Q A;  2XZ0 D;  2PBJ A;  3UBK A;  1PGT A;  3F6F A;  2PY8 A;  4FO5 A;  3J7Y b;  1K0O A;  3FK8 A;  2GDX A;  1IYI A;  5ECR B;  2KGA A;  2N6Z A;  1YJW P;  4COC A;  3HJO A;  3F8U A;  2MVV A;  2GVP A;  2AHE A;  5F06 A;  2JSZ A;  2DML A;  1M0U A;  5HR1 A;  5F2N A;  2YP6 A;  2H1D A;  5F2O A;  4ML6 A;  2E2M A;  3TOU A;  1TI3 A;  2LL8 A;  2HZE A;  2FGX A;  2EC4 A;  1KBN A;  3G29 A;  1A0R P;  2ONT A;  5F2K A;  3SWL A;  3MNG A;  1G6W A;  3LRY A;  2LRC A;  1BX9 A;  4LL1 B;  2EIA A;  2DBC A;  4E8H A;  4U0A A;  2VCQ A;  4CW9 A;  2CT6 A;  1GL8 A;  2H1A A;  4YQV A;  2VLN A;  1Q86 Q;  2XBQ A;  1F9M A;  4IS0 A;  1ML6 A;  5J5N A;  4U0F A;  4XS1 A;  1K0C A;  2DJJ A;  3KD0 A;  5AGY A;  2C3T A;  4ECC A;  1TRV A;  5CZD B;  2VLP A;  3HCZ A;  4TR3 A;  1M3I A;  6GSY A;  3BCI A;  1Z7R A;  2GZF A;  5HV8 A;  4JED A;  3E3E A;  1TK8 B;  3H4K A;  4CHS A;  4COP A;  2YAN A;  3HZ8 A;  3RHC A;  5G5F A;  1JZO A;  3IAM 2;  1HNA A;  1DSB A;  2WGR A;  1O6J A;  4GSS A;  1M3J A;  3LW9 A;  3EVI A;  3CQF A;  2MMZ A;  5D9W A;  3ME7 A;  3IHQ A;  4LA1 A;  3Q18 A;  3KJY A;  1R7H A;  4XRA A;  4O7H A;  2L57 A;  4IQ1 A;  2IFQ B;  4BIK A;  2N5H A;  3F3R A;  1GSQ A;  4F2I A;  2GDW A;  1GTB A;  3D4T A;  2I4A A;  1A43 A;  2KGE A;  3EJB A;  4IN0 A;  4MAB A;  1QFN A;  3RBT A;  1Q82 Q;  3IC4 A;  3PPU A;  3E2D A;  1VQN P;  2FVE A;  2PEQ A;  1YKA A;  2VCZ A;  4RI6 A;  3FHK A;  3GL5 A;  4A5P A;  2GZP A;  2Z44 A;  1OKD A;  3GX0 A;  3VRL C;  3F4R A;  4V1A p;  3NY7 B;  4KUN A;  4IZ6 A;  1VQO P;  2F9S A;  2HZF A;  4MJE A;  2JZT A;  2LPK A;  1GNE A;  3DRN A;  2AV4 A;  3QAV A;  1MTC A;  2HRF A;  3KCM A;  4PNG A;  3C71 A;  2F8A A;  1QGV A;  2EG5 A;  4J2F A;  2DJ3 A;  4GSN A;  4L0W A;  2DIY A;  1V57 A;  4IVF A;  1A24 A;  3O76 A;  2KUC A;  5GAN D;  2C4J A;  1GLP A;  3QMX A;  4TXO B;  2I81 A;  4WXT A;  1KEB A;  2H01 A;  4K7N A;  1PN9 A;  1R5P A;  2OKA A;  4O5U A;  1RNI A;  1WIK A;  1OC3 A;  4GWR A;  2BHV A;  1JHB A;  3H4E A;  3CE7 A;  1MD3 A;  1MZ8 A;  3G1G A;  4I6X A;  4DG9 A;  1X9M B;  4EL1 A;  3F4T A;  5EPF A;  2VCX A;  3E9J B;  4BWS A;  1QRJ A;  3CRT A;  5A4U A;  1PSQ A;  5ID2 B;  3VLN A;  2VLV A;  5AIS A;  2CQ9 A;  4L5O A;  4ZB9 A;  3BOA A;  5KP6 B;  2CV4 A;  4O5R A;  3IAS 2;  5IOW A;  4K9Z A;  3DD3 A;  1QQ2 A;  2YJH A;  4IPY A;  1TJD A;  2H19 A;  1KTE A;  4GRF A;  2L6E A;  1BXI A;  4HQZ A;  3UEM A;  2LUS A;  3IK9 A;  4E8E A;  1YY7 A;  1K0N A;  1NHO A;  2C8U A;  2J23 A;  3LMO A;  2L6D A;  2KOP A;  4KE3 A;  4TW5 A;  1F6M C;  3TRQ A;  4V2N A;  2XC2 A;  1XBS A;  1EP8 A;  1V9W A;  1T7P B;  4KGI A;  1KLP A;  2I9H A;  4X1U A;  5ECM B;  3GHA A;  2XHF A;  2LJR A;  2VLO A;  3HVN A;  1E0H A;  1ERW A;  3BCK A;  3L9V A;  3F63 A;  2EHT A;  5JCG A;  1B8X A;  3I69 A;  1ACP A;  1NQ4 A;  3GKL C;  2I3Y A;  2R37 A;  4NHZ A;  4OMV A;  2DJK A;  2NPB A;  3CTF A;  4MCU A;  1T4Z A;  4AGS A;  4WKW A;  1U6T A;  5FWG A;  2H1B A;  4ZB6 A;  1R4W A;  2XBI A;  1YF0 A;  3MAK A;  1IMQ A;  3DWV A;  2AFE A;  2R6K A;  2VLQ A;  2KOS A;  4BPY A;  2CVK A;  2CX3 A;  2X8C A;  3I9V 2;  1MDI A;  3MWH A;  3CCU P;  4XIH A;  2M80 A;  3HDC A;  3APQ A;  3VPT A;  1C72 A;  1GUK A;  4O92 A;  3LQ7 A;  1T4Y A;  2V6O A;  3EWL A;  5KEJ A;  4IJI A;  5ECO B;  2QEX P;  3VK9 A;  2Z45 A;  1VQ4 P;  4EDY A;  2CNR A;  2AB6 A;  3HZQ A;  4K1F A;  4PGT A;  3KEB A;  1M99 A;  4O32 A;  1AW9 A;  3HVV A;  4D73 B;  5DAL A;  2HT9 A;  4XRO A;  4QQ7 A;  4FYU A;  1U88 A;  1XVQ A;  4YQU A;  1TRW A;  3P7X A;  4MDC A;  3H47 A;  2L4B A;  1OE7 A;  4WEY A;  4TRX A;  5F0G A;  3L9S A;  1KNG A;  2K0Y A;  4K2X A;  5IOX A;  2LML A;  2F3M A;  5EVO A;  5GSS A;  4OCF A;  1W2B O;  1GUM A;  1SJ6 A;  2FA8 A;  1QVF O;  2JGP A;  3EE2 A;  3UOM A;  1ZZY A;  3U5R E;  1V98 A;  1AF8 A;  4ZBA A;  4HEA 2;  2BTO T;  2L22 A;  3G7I A;  5F05 A;  1YQ1 A;  4V2L A;  5D9V A;  3DVW A;  1K8A Q;  2VCT A;  1M2B A;  4WBR D;  1XCC A;  5H5S A;  5FT3 A;  1WOU A;  3UIW A;  1B9X C;  3QAG A;  3L9U A;  2X2B A;  2GGT A;  4RQR A;  1J08 A;  1USB A;  2V2G A;  1WE0 A;  3CRU A;  1TI1 A;  3M9J A;  1A2J A;  3VWV A;  5KN3 A;  5DBQ A;  1MDJ A;  4IBP A;  1XWC A;  1SK1 A;  3LGC A;  3ZRD A;  2FHE A;  2OE0 A;  1XWA A;  2B6M A;  1I5G A;  3M1M A;  1T00 A;  4EIP A;  3PH9 A;  3TRX A;  1JZW A;  2K5X A;  7CEI A;  1PRX A;  1X9W B;  1GPJ A;  2RM5 A;  5IMA A;  1CQH A;  3DS2 A;  2LTK A;  2WB9 A;  2FLS A;  1EGO A;  3F4S A;  4YQM A;  5EW5 E;  2B7J A;  3UL3 A;  4PNF A;  2HNL A;  5LNK e;  3F3Q A;  4KW6 A;  2O85 A;  3W8J A;  3P2A A;  1YEX A;  2WZ9 A;  4XRQ A;  1ZGN A;  1ZCP A;  2AJQ B;  1O85 A;  4PWV B;  1PMT A;  2VAF A;  1IMP A;  4IGJ A;  3UJ1 A;  4TOP A;  5A4W A;  1M2A A;  6GSW A;  3CTG A;  3FZA A;  1FO5 A;  3CMA P;  1QUW A;  2PMT A;  2WUL A;  5HR2 A;  2VD0 A;  3TKQ A;  1NJI Q;  3GST A;  4GXZ A;  3LYP A;  4NMU A;  2GS3 A;  3LG6 A;  4RQX A;  2CVD A;  5F8B A;  2WDU A;  4DVC A;  2WS2 A;  4Z2R A;  4N10 A;  2IJY A;  1TP9 A;  1THO A;  5IMC A;  4NV5 A;  4PQI A;  4YAP A;  3HYP A;  4M0I A;  4BVY B;  1X5D A;  2C0G A;  2LNT A;  1TRU A;  4LMW A;  1PX7 A;  1PL2 A;  2OBI A;  2VM1 A;  1VQ9 P;  5ECP B;  2YZU A;  3O3T A;  3U6V A;  2E0Q A;  1G0T A;  3GUS A;  4K5S A;  2HE3 A;  1ERT A;  4G0L A;  3CC7 P;  1E6J P;  3GUR A;  3GYK A;  4LL4 B;  2OAR A;  2PEK A;  2YV7 A;  3LXT A;  1E6B A;  1SKR B;  5GZZ B;  1YIT P;  2LQQ A;  4QKO A;  3GZL A;  1W89 A;  1RO2 A;  4DSS A;  5IMZ A;  3CSH A;  3RDW A;  4BWQ A;  3EIN A;  1Q81 Q;  1TW9 A;  3QR6 A;  5IMV A;  3I6A A;  1VQ5 P;  3KTB A;  1NM3 A;  1YJ6 A;  3RHB A;  5IMD A;  3UBL A;  3U43 A;  3CCL P;  5KN1 A;  3H1N A;  1ZL9 A;  3Q74 A;  2DJ2 A;  2K94 A;  4NPB A;  2NTO A;  4N0Z A;  2JU2 A;  3G9B A;  3IOS A;  2KR5 A;  5HGN A;  1K9M Q;  3QOU A;  4TKY A;  2H6X A;  1SL0 B;  2EIO A;  2KP1 A;  2O87 A;  3G7J A;  2AYT A; 
#chains in the Genus database with same CATH homology
 4YH2 A;  3WD6 A;  3L78 A;  4MJB A;  2WFC A;  3FW2 A;  5G30 A;  5F07 A;  4F9Z A;  2QA1 A;  5DQS A;  3IXR A;  3CSI A;  4CY8 A;  4L8E A;  4MP4 A;  4MZB A;  3EU4 A;  1HQO A;  2LJK A;  2HZE B;  5IPH A;  3A3T A;  1YF1 A;  4KCE A;  2LEG A;  4K6X A;  1AQV A;  5BRT A;  1AQX A;  2B3S A;  2N5F A;  2ES7 A;  3HY2 A;  5HR0 A;  3LYK A;  2O7K A;  2F51 A;  1GTU A;  5JWR B;  2DJ1 A;  1JZD A;  2C0F A;  3ZYW A;  3IE3 A;  3QCP A;  2VCV A;  1Y6E A;  1BJX A;  4F82 A;  5EY6 A;  4ACS A;  3GTU B;  2X99 A;  6GSS A;  2JZR A;  4L0U A;  2REM A;  2M46 A;  5KN0 A;  3TGZ A;  1EZK A;  3GRX A;  3MYD A;  3DIE A;  5B8A A;  2WJU A;  4ZIJ A;  2R4V A;  4K7I A;  3GL3 A;  1LU4 A;  5DJL A;  2JU5 A;  1G7E A;  2H66 A;  4I97 A;  3R2Q A;  2J9H A;  3L0H A;  4BA7 A;  1J9B A;  1GP1 A;  3A2W A;  4N11 A;  4EO3 A;  1VF1 A;  1ST9 A;  1K0M A;  3E0U A;  1B4P A;  2MMO A;  1SK0 A;  3ME8 A;  1OVN A;  4JU5 A;  2H0H A;  4N0V A;  2YWM A;  1VF3 A;  3KMN A;  1GTA A;  3A5W A;  3HA9 A;  4HS1 A;  1A8Y A;  5ECQ B;  1VF2 A;  1VRS D;  1TRS A;  4OFM A;  3FZ9 A;  4YKF A;  1TOF A;  2FWE A;  1PL1 A;  4BVX A;  3HHV A;  2O89 A;  4XHM A;  1SD9 A;  1EP7 A;  1TK0 B;  4Q5N A;  3TJK A;  1JLW A;  5E4W A;  1OAZ A;  4JR6 A;  2L4Q A;  5IMF A;  3EU3 A;  3FY7 A;  4PUF C;  4F0C A;  2MMN A;  2YNX A;  5IIZ A;  1GLQ A;  2H30 A;  5D9X A;  4ICY A;  2LRN A;  1RW1 A;  4YKG A;  2DLX A;  3TKS C;  2TRC P;  4ISD A;  3W8S A;  3O6T A;  2IMD A;  3IK7 A;  3DEX A;  1BAY A;  1K3O A;  3KGK A;  1WWJ A;  4FH8 A;  3FZ5 A;  1OKT A;  4DEJ A;  5CNW A;  3VI5 A;  5D8I A;  3GKM A;  2IMK A;  3QPM A;  3A2X A;  5G1K A;  2PUK C;  2HRK A;  3LWA A;  4EVM A;  3ERF A;  2HSM A;  1T3B A;  2L5L A;  2R0P A;  2C3Q A;  4WR5 A;  4Z2T A;  1GH2 A;  2VUP A;  2B1L A;  2DJ0 A;  3IR4 A;  3Q6O A;  1DUG A;  3BBY A;  1MD4 A;  2B5Y A;  4CDO A;  1A0F A;  1QK8 A;  4K0N A;  1YEP A;  1F3B A;  8GSS A;  2YWN A;  1WPI A;  5G2Z A;  3TKP A;  2KOK A;  1UC7 A;  4NXI A;  4CY6 A;  3MIX A;  2BJX A;  3L4N A;  1O8X A;  1R26 A;  2IPA A;  2JL4 A;  3S9F A;  2LV3 A;  3TKS E;  5B8B A;  20GS A;  3NIV A;  2GT5 A;  4JR4 A;  1NSW A;  3ZVJ A;  1SL2 B;  3TKR A;  1X9S B;  3LJR A;  5LD0 A;  1S3D A;  2FY6 A;  3HJM A;  2H76 A;  6GSU A;  1WP0 A;  4PTS A;  1U3I A;  5J4U A;  1S3C A;  2MYG A;  3C7M A;  5DVB A;  4ECJ A;  5BMU A;  1Z6M A;  3UAR A;  3GA4 A;  3ZMK A;  2H8L A;  4IP1 A;  1GWC A;  1K0B A;  3CSJ A;  4IW9 A;  1DE2 A;  5ECH B;  4MPF A;  2KLX A;  1PD2 1;  4NAX A;  1W4V A;  2CX4 A;  4FQU A;  4HZ4 A;  4IP6 A;  5C04 A;  2QA2 A;  5CAX A;  2V1M A;  3FZ4 A;  1XPV A;  2E7P A;  2B5E A;  1SKW B;  4EE0 A;  2N5B A;  4IEL A;  5COH A;  2A2S A;  3DGQ A;  5FHI A;  4KND A;  4USS A;  1TK5 B;  3IC8 A;  1TXX A;  3H93 A;  4I2U A;  3GIX A;  1WMJ A;  2GQL A;  2P31 A;  4K0G A;  4Z2U A;  4JRR A;  3A2V A;  4HDE A;  4ZIL A;  5LCZ A;  5DAL B;  3QFA C;  4FYB A;  4KDX A;  4I2T A;  5J9C A;  3ZML A;  3D6I A;  4XCS A;  2VM2 A;  3ERW A;  3OR5 A;  5B6N A;  2K6V A;  1BED A;  4F03 A;  2R2J A;  2H72 A;  2VL2 C;  2XPD A;  1U87 A;  5IQY A;  3M0F A;  4MMM A;  2K9F A;  4KAE A;  3KXO A;  1Z5Y E;  2M72 A;  5G1L A;  5CYY A;  2QSI A;  1JZR A;  3ZTL A;  3K8N A;  4TXV A;  14GS A;  1B9Y C;  1ZYN A;  2YJ7 A;  1AUC A;  1GUH A;  4ZBB A;  4G2E A;  3IA1 A;  2RUF A;  1Z7P A;  4P3Y B;  1XW9 A;  1XOA A;  3J7Y k;  1YZX A;  4POL A;  2P0G A;  1K3L A;  1PKZ A;  2JSY A;  1MDK A;  4JZQ A;  1VGL A;  2IMF A;  4X4J A;  2YN1 A;  5AIV A;  1EEJ A;  1FHE A;  5HR3 A;  3QAW A;  1Z3E A;  2H6Z A;  4AJ8 A;  3HVS A;  5DJM A;  5DCH A;  2H0G A;  2MMA A;  1ZYP A;  2H0I A;  2A2P A;  1AQW A;  2GLR A;  4WET A;  13GS A;  4HOJ A;  3GH9 A;  2A4V A;  4OCE A;  1GSE A;  3KP8 A;  5ECS A;  1HD2 A;  5AIX A;  3D4M A;  4ZB8 A;  4MH2 A;  5D73 A;  1FG4 A;  1ZOF A;  3QD9 A;  3FYG A;  1X5E A;  4G0K A;  4POB A;  2HSH A;  3VWU A;  5DAK B;  1SYR A;  3P90 A;  4ZL8 A;  1V40 A;  3ISO A;  1BQ7 A;  4MLY A;  4KSM A;  4ML1 A;  5DCG A;  3MSZ A;  2VCW A;  2YOI A;  5ECN B;  1ERV A;  2PWJ A;  3KZQ A;  2Z9S A;  4GQC A;  1F37 A;  3V1W A;  1GUL A;  1SEN A;  4IHU A;  4IQA A;  5ECL B;  2HI7 A;  1EV9 A;  3WT1 A;  4MF5 A;  5CRW A;  4TR1 A;  2LNS A;  5ENU A;  3W6G A;  1X5C A;  2H73 A;  1PN0 A;  5C00 A;  3IRA A;  4MH3 A;  1PKW A;  4XRD A;  3GV1 A;  3RAZ A;  1FVK A;  1OE8 A;  2DIZ A;  2VD1 A;  2VLU A;  1XWK A;  3C1R A;  11GS A;  2CVB A;  1SD8 A;  1QMV A;  1NHY A;  4HQS A;  1GRX A;  3A5I A;  2D2Z A;  5HFI A;  3ZIT A;  1CQG A;  1HNB A;  3TB2 A;  2AUV A;  4HUA A;  4F0B A;  3TJG A;  4ECI A;  4EDZ A;  2LS5 A;  4GF0 A;  3TUE A;  3RPN A;  1F3A A;  2QGV A;  2HFD A;  3KH9 A;  4EF0 A;  4AF2 A;  2O8V B;  2P5R A;  1EWX A;  2YWI A;  2VLT A;  3ZRE A;  2OAD A;  2I1U A;  1TDI A;  2HLS A;  4LLR A;  2GDR A;  4MK3 A;  4QL7 A;  5CRG A;  5DQY A;  2V32 A;  1GSS A;  1XW6 A;  5JCW A;  3PR8 A;  3ZLP A;  4KDY A;  2H75 A;  1O7U A;  2RUE A;  3NZN A;  1ZYE A;  2CZ2 A;  1Z9H A;  2KP2 A;  3UVT A;  3ZL5 A;  1OC9 A;  3M3M A;  1GTI A;  3KP9 A;  1TTZ A;  2L6C A;  4KCA A;  3D22 A;  2CA8 A;  5EL8 A;  4OFN A;  2QC7 A;  4OO5 A;  3VFI A;  2V6K A;  4G0I A;  4QL9 A;  3DKS A;  2PU9 C;  3UAP A;  3TJJ A;  4J57 E;  2MBS A;  4PQ1 A;  1LBK A;  3DXB A;  4K7O A;  3FR9 A;  1DBY A;  1K0D A;  4HI7 A;  2RM6 A;  2PVQ A;  2HSY A;  2A4H A;  1Q4J A;  1HNC A;  5A4V A;  5GAP D;  4EXJ A;  3TJB A;  3FKF A;  3MDK A;  1K0A A;  3VWW A;  1TU8 A;  4KH7 A;  2HYX A;  2RLI A;  3APS A;  1EOH A;  1TU7 A;  1N8J A;  1T1V A;  2R0G A;  2YV9 A;  1GNW A;  3GX8 A;  2DSA A;  3DVX A;  2PN8 A;  1DE1 A;  3QFB C;  3APO A;  2MZC A;  1XZO A;  4K2D A;  1H75 A;  1V58 A;  2LST A;  4LMV A;  2FWH A;  1B48 A;  3C8E A;  3BD2 A;  4MPG A;  2GTU A;  2UZ8 A;  4Q5F A;  4BL7 A;  1G6Y A;  4XS4 A;  2B7K A;  1M9B A;  1FB0 A;  2WCI A;  4HJM A;  4X0X A;  1FB6 A;  5CRE A;  2F8F A;  1XWB A;  5B7C A;  3CYN A;  2X64 A;  2VL3 A;  4MF6 A;  2R0C A;  5IM9 A;  4BVX B;  4G10 A;  3LXZ A;  2OA7 A;  4I8B A;  1ABA A;  4K5R A;  4ZL9 A;  2IME A;  4V1A g;  1FAA A;  3FR6 A;  4OD7 A;  4IKH A;  4TVE A;  5E59 A;  4TR0 A;  3N9J A;  3UVH A;  1Z6N A;  4AJ6 A;  3Q19 A;  1LJR A;  2H1G A;  1TKD B;  3IPZ A;  4O5Q A;  3P8W A;  5ELG A;  3GTU A;  5CRH A;  2C0E A;  1F2E A;  4KF9 A;  2PGT A;  1UN2 A;  4KB3 A;  1PQN A;  1S3A A;  1AC1 A;  3GN3 A;  3I43 A;  3EMX A;  2R3X A;  4PX1 A;  2G2Q A;  5D96 A;  5INY A;  2YZH A;  3M8N A;  2JZS A;  3HD5 A;  1OYJ A;  2HXK A;  2VL9 A;  4ECB A;  2DC5 A;  2LJA A;  3CXG A;  3G7Y A;  4HU7 A;  4MNN A;  5L71 A;  3VWX A;  3KTL A;  2LRT A;  3TJF A;  4JE1 A;  1EOG A;  4HU9 A;  18GS A;  3ERG A;  3CMI A;  2L5O A;  2DKI A;  3GFK A;  4GLT A;  6GSV A;  1G7O A;  1NW2 A;  2NBS A;  3DML A;  3TRP A;  1BG5 A;  1SJZ A;  6GST A;  4WR4 A;  5KOW A;  4JBB A;  4J56 E;  2DMM A;  4WF5 A;  5KOX A;  1Q98 A;  1R5A A;  2IFQ A;  1XIY A;  2EIQ A;  4PUR A;  2C80 A;  5A5K A;  3WT2 A;  1SU9 A;  1QXH A;  3PIN A;  1UVZ A;  4N30 A;  1IYH A;  1OC8 A;  4Q5R A;  5IO2 A;  2BMX A;  1V2A A;  2L4C A;  2V41 A;  3H79 A;  4NWY A;  2TIR A;  1M9A A;  5HFK A;  3GNJ A;  2GQM A;  4KSO A;  4FIW A;  1RK4 A;  1XFL A;  1ACV A;  4OFT A;  4EC0 A;  4OO4 A;  1HYU A;  3JCM L;  3FRC A;  2EIR A;  5DDL A;  1A2M A;  5G5E A;  1O8W A;  2FA4 A;  4IJ3 A;  1GSD A;  2ZNM A;  2H6Y A;  4H86 A;  2R5G A;  2RII A;  3EC3 A;  2VIM A;  3ZIJ A;  5IO0 A;  1B4Q A;  1SYX A;  2H70 A;  2FNO A;  4TXO A;  2GSQ A;  2GSS A;  2YPM A;  3UMA A;  5ELA A;  1ERU A;  4X43 A;  2GSR A;  5ECK B;  3SBC A;  4EUY A;  1J0F A;  5CO3 A;  3ZZX A;  3ZIV A;  2K18 A;  3ZFL A;  2C0D A;  3TOT A;  1EEM A;  2B5X A;  5D9T A;  1RQM A;  5JCU A;  5KN2 A;  1FW1 A;  4GCI A;  4ID0 A;  4ZBD A;  2ON5 A;  2IIY A;  4G9H A;  5ID2 A;  3LEF A;  5CRD A;  2FUG 2;  1H4O A;  3DYR A;  2CZ3 A;  3HXS A;  3VUR A;  1N2A A;  1AIU A;  4MZW A;  3FMW A;  1M2D A;  3EPT A;  2GQK A;  2NVL A;  2NDO A;  1URM A;  16GS A;  3TDG A;  2A2R A;  2IMI A;  3N5O A;  4KDU A;  4DSR A;  4MF7 A;  5ECI B;  3IDV A;  3GSS A;  4RUV A;  2VOC A;  4WF4 A;  4POK A;  2QKE A;  2OAC A;  2YWO A;  19GS A;  2FD3 A;  3ZVJ D;  3WGE A;  2FCH A;  5CP1 A;  5J3R A;  4RI7 A;  4KX4 A;  3HJP A;  3GKN A;  5JWQ B;  1JLV A;  5G31 A;  3FR3 A;  2C1Y A;  4KA0 A;  3TCO A;  9GSS A;  10GS A;  2H74 A;  3HZ4 A;  5H5Q A;  4ULX A;  3KIJ A;  2X8H A;  3BJ5 A;  2K8V A;  3GH6 A;  1GSF A;  3GKX A;  5JWO B;  3HVX A;  4EIQ A;  2B1K A;  12GS A;  2C3N A;  4WBJ A;  1O73 A;  3LFL A;  3TKS A;  4GQF A;  4D73 A;  4GST A;  3NOF A;  3RPP A;  1O81 A;  2ALB A;  5J41 A;  3H8Q A;  1EV4 A;  1PA3 A;  4EKZ A;  2H71 A;  1A23 A;  4AJ7 A;  4NV2 A;  2FWF A;  3C73 A;  5J9B A;  4FYC A;  2CAQ A;  1BYE A;  2OJL A;  1ZMA A;  1A8L A;  1T8E B;  5HQP A;  5AN1 A;  2LQO A;  1X0R A;  2X8G A;  1FVJ A;  2ZUP A;  4TR1 B;  3VPQ A;  2PER A;  2LKU A;  2X4A A;  3D5J A;  1WJK A;  4HJ2 A;  2GZY A;  3KM6 A;  3GKK A;  3M1G A;  3US3 A;  4PXO A;  3D21 A;  1U3A A;  4Z7X A;  1UA5 A;  3QDN A;  2HRN A;  4OWY A;  2ON7 A;  3IHG A;  4G19 A;  4ILF A;  2X49 A;  1M7T A;  22GS A;  4NHW A;  1YDK A;  4K8M A;  1FOV A;  1ON4 A;  1WRY A;  4GTU A;  4I5Q A;  2PPT A;  3AY8 A;  2L59 A;  4MJC A;  3KMO A;  2VO4 A;  2XPE A;  1VF4 A;  1EGR A;  4MJA A;  5IPG A;  4POM A;  2GT6 A;  6GSX A;  5DAK A;  1XXU A;  17GS A;  7GSS A;  4YAV A;  1SJI A;  4ZXG A;  2N5A A;  5HFG A;  1AXD A;  4HZ2 A;  4PUA A;  4DSS B;  2TRX A;  1ILO A;  3M9K A;  3ED3 A;  1MEK A;  3CBU A;  2OE1 A;  2K8S A;  3VI7 A;  1SKS B;  4DSQ A;  2YCD A;  2CAI A;  1FOH A;  1OC9 B;  4XTS A;  2HRA A;  1GSY A;  4Q5Q A;  1JFU A;  2JAD A;  3D0Z A;  3EYT A;  1YKC A;  3C1S A;  2JAC A;  3EMP A;  2IN3 A;  3PGT A;  2E2G A;  1PX6 A;  2KHP A;  1XWG A;  2IL3 A;  4ZL7 A;  3ZFB A;  1I9D A;  5H5R A;  3HKR A;  3F0I A;  1GSU A;  5B6M A;  2OE3 A;  3GMF A;  2GST A;  1THX A;  4PQH A;  1SL1 B;  4BVY A;  1SK2 A;  2ZCT A;  3FEU A;  3LOR A;  1Y25 A;  2WRT A;  4L5L A;  2DKH A;  4TN8 A;  3EUR A;  1ZYQ B;  1XVW A;  1E2Y A;  4MZC A;  5GST A;  1XOB A;  1A2L A;  2AAW A;  2MBT A;  2G0F A;  4TR4 A;  3F6D A;  3IBH A;  2FWG A;  2VL2 A;  3WYW A;  2GZZ A;  1AAZ A;  4MA9 A;  4BL7 B;  5ABR A;  3KH7 A;  4XS4 B;  2OBK A;  1K3Y A;  3WGX A;  3WGD A;  3LSZ A;  2IWT A;  4V2M A;  4XS6 A;  3F9U A;  3R3E A;  3IV4 A;  1XW5 A;  2PVO C;  5D93 A;  2P5Q A;  2PBJ A;  3UBK A;  1PGT A;  3F6F A;  4FO5 A;  3J7Y b;  1K0O A;  3FK8 A;  1IYI A;  5ECR B;  3HJO A;  3F8U A;  2GVP A;  2AHE A;  5F06 A;  2JSZ A;  2DML A;  1M0U A;  5HR1 A;  2YP6 A;  2H1D A;  4ML6 A;  2E2M A;  3TOU A;  1TI3 A;  2HZE A;  2FGX A;  2EC4 A;  1KBN A;  1A0R P;  3SWL A;  3MNG A;  1G6W A;  2LRC A;  1BX9 A;  4LL1 B;  2DBC A;  4E8H A;  2VCQ A;  4CW9 A;  2CT6 A;  1GL8 A;  2H1A A;  4YQV A;  2XBQ A;  1F9M A;  4IS0 A;  1ML6 A;  5J5N A;  4XS1 A;  1K0C A;  2DJJ A;  3KD0 A;  5AGY A;  2C3T A;  4ECC A;  1TRV A;  3HCZ A;  4TR3 A;  6GSY A;  3BCI A;  1Z7R A;  4JED A;  3E3E A;  1TK8 B;  3H4K A;  4CHS A;  2YAN A;  3HZ8 A;  3RHC A;  5G5F A;  1JZO A;  3IAM 2;  1HNA A;  1DSB A;  2WGR A;  1O6J A;  4GSS A;  3LW9 A;  3EVI A;  2MMZ A;  5D9W A;  3ME7 A;  3IHQ A;  4LA1 A;  3Q18 A;  3KJY A;  1R7H A;  4XRA A;  4O7H A;  2L57 A;  4IQ1 A;  2IFQ B;  3F3R A;  1GSQ A;  4F2I A;  1GTB A;  3D4T A;  2I4A A;  4IN0 A;  4MAB A;  1QFN A;  3RBT A;  3IC4 A;  3PPU A;  1YKA A;  2VCZ A;  4RI6 A;  3FHK A;  3GL5 A;  4A5P A;  2GZP A;  1OKD A;  3GX0 A;  3F4R A;  4V1A p;  4KUN A;  2F9S A;  2HZF A;  4MJE A;  2JZT A;  1GNE A;  3DRN A;  2AV4 A;  3QAV A;  1MTC A;  2HRF A;  3KCM A;  4PNG A;  3C71 A;  2F8A A;  1QGV A;  4J2F A;  2DJ3 A;  4GSN A;  4L0W A;  2DIY A;  1V57 A;  4IVF A;  1A24 A;  3O76 A;  2KUC A;  5GAN D;  2C4J A;  1GLP A;  3QMX A;  4TXO B;  2I81 A;  4WXT A;  1KEB A;  2H01 A;  4K7N A;  1PN9 A;  1R5P A;  2OKA A;  4O5U A;  1WIK A;  1OC3 A;  4GWR A;  1JHB A;  1MD3 A;  4I6X A;  1X9M B;  4EL1 A;  3F4T A;  5EPF A;  2VCX A;  3E9J B;  4BWS A;  5A4U A;  3CRT A;  1PSQ A;  5ID2 B;  3VLN A;  2VLV A;  5AIS A;  2CQ9 A;  4L5O A;  4ZB9 A;  3BOA A;  2CV4 A;  4O5R A;  3IAS 2;  5IOW A;  4K9Z A;  3DD3 A;  1QQ2 A;  2YJH A;  1TJD A;  2H19 A;  1KTE A;  4GRF A;  4HQZ A;  3UEM A;  2LUS A;  3IK9 A;  4E8E A;  1YY7 A;  1K0N A;  1NHO A;  2C8U A;  2J23 A;  2L6D A;  4KE3 A;  4TW5 A;  1F6M C;  3TRQ A;  4V2N A;  2XC2 A;  1XBS A;  1EP8 A;  1V9W A;  1T7P B;  4KGI A;  2I9H A;  4X1U A;  5ECM B;  3GHA A;  2XHF A;  2LJR A;  1ERW A;  3BCK A;  3L9V A;  3F63 A;  5JCG A;  1B8X A;  3I69 A;  2I3Y A;  2R37 A;  4NHZ A;  4OMV A;  2DJK A;  2NPB A;  3CTF A;  4MCU A;  1T4Z A;  4AGS A;  4WKW A;  1U6T A;  5FWG A;  2H1B A;  4ZB6 A;  1R4W A;  2XBI A;  1YF0 A;  3MAK A;  3DWV A;  2R6K A;  4BPY A;  2CVK A;  2CX3 A;  2X8C A;  3I9V 2;  1MDI A;  3MWH A;  4XIH A;  2M80 A;  3HDC A;  3APQ A;  3VPT A;  1C72 A;  1GUK A;  4O92 A;  3LQ7 A;  1T4Y A;  2V6O A;  3EWL A;  5KEJ A;  4IJI A;  5ECO B;  3VK9 A;  4EDY A;  2AB6 A;  4K1F A;  4PGT A;  3KEB A;  1M99 A;  4O32 A;  1AW9 A;  3HVV A;  4D73 B;  5DAL A;  2HT9 A;  4QQ7 A;  4FYU A;  1U88 A;  1XVQ A;  4YQU A;  1TRW A;  3P7X A;  4MDC A;  1OE7 A;  4WEY A;  4TRX A;  5F0G A;  3L9S A;  1KNG A;  4K2X A;  5IOX A;  2F3M A;  5EVO A;  5GSS A;  4OCF A;  1GUM A;  1SJ6 A;  2FA8 A;  3EE2 A;  3UOM A;  1ZZY A;  3U5R E;  1V98 A;  4ZBA A;  4HEA 2;  2BTO T;  3G7I A;  5F05 A;  1YQ1 A;  4V2L A;  5D9V A;  3DVW A;  2VCT A;  1M2B A;  4WBR D;  1XCC A;  5H5S A;  5FT3 A;  1WOU A;  3UIW A;  1B9X C;  3QAG A;  3L9U A;  2GGT A;  4RQR A;  1J08 A;  1USB A;  2V2G A;  1WE0 A;  3CRU A;  1TI1 A;  3M9J A;  1A2J A;  3VWV A;  5KN3 A;  5DBQ A;  1MDJ A;  4IBP A;  1XWC A;  1SK1 A;  3LGC A;  3ZRD A;  2FHE A;  2OE0 A;  1XWA A;  2B6M A;  1I5G A;  1T00 A;  4EIP A;  3PH9 A;  3TRX A;  1JZW A;  1PRX A;  1X9W B;  2RM5 A;  5IMA A;  1CQH A;  2LTK A;  2WB9 A;  2FLS A;  1EGO A;  3F4S A;  4YQM A;  2B7J A;  3UL3 A;  4PNF A;  2HNL A;  5LNK e;  3F3Q A;  4KW6 A;  2O85 A;  3W8J A;  3P2A A;  1YEX A;  2WZ9 A;  1ZGN A;  1ZCP A;  2AJQ B;  1O85 A;  1PMT A;  2VAF A;  4IGJ A;  3UJ1 A;  4TOP A;  5A4W A;  1M2A A;  6GSW A;  3CTG A;  3FZA A;  1FO5 A;  1QUW A;  2PMT A;  2WUL A;  5HR2 A;  2VD0 A;  3TKQ A;  3GST A;  4GXZ A;  3LYP A;  4NMU A;  2GS3 A;  3LG6 A;  4RQX A;  2CVD A;  5F8B A;  2WDU A;  4DVC A;  2WS2 A;  4Z2R A;  4N10 A;  2IJY A;  1TP9 A;  1THO A;  5IMC A;  4NV5 A;  4PQI A;  4YAP A;  3HYP A;  4BVY B;  1X5D A;  2C0G A;  2LNT A;  1TRU A;  4LMW A;  1PX7 A;  1PL2 A;  2OBI A;  2VM1 A;  5ECP B;  2YZU A;  3O3T A;  3U6V A;  2E0Q A;  1G0T A;  3GUS A;  4K5S A;  2HE3 A;  1ERT A;  4G0L A;  3GUR A;  3GYK A;  4LL4 B;  2YV7 A;  3LXT A;  1E6B A;  1SKR B;  5GZZ B;  2LQQ A;  1W89 A;  4DSS A;  5IMZ A;  3CSH A;  3RDW A;  4BWQ A;  3EIN A;  1TW9 A;  3QR6 A;  5IMV A;  3I6A A;  3KTB A;  1NM3 A;  1YJ6 A;  3RHB A;  5IMD A;  3UBL A;  5KN1 A;  3H1N A;  1ZL9 A;  3Q74 A;  2DJ2 A;  4NPB A;  2NTO A;  4N0Z A;  3G9B A;  3IOS A;  3QOU A;  4TKY A;  2H6X A;  1SL0 B;  2EIO A;  2KP1 A;  2O87 A;  3G7J A;  2AYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...