1Z6MA

Structure of conserved protein of unknown function from enterococcus faecalis v583
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
175
structure length
175
Chain Sequence
SNAMDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELLAQSVKSGKVERIIKLFDKEKESLQRGNVMHHYIDYSAPEQALSALHKMFATQDEWGNLTLEEVATYAEKNLGLKEQKDATLVSAVIAEANAAHIQFVPTIIIGEYIFDESVTEEELRGYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Structure of a conserved hypothetical protein from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 57
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.90 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A DsbA-like domain 1z6mA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1z6mA01
4K0GA 4MF5A 1SK0A 2LQOA 4MMMA 1UVZA 1PN9A 5CYYA 3F63A 4ZB8A 3HCZA 3GTUB 1EEMA 1OKDA 3LYKA 1XFLA 4Z7XA 2ES7A 2DC5A 4JEDA 2HZEB 5ELGA 2X8CA 1NSWA 1XW5A 3HVXA 3PGTA 4K9ZA 4X43A 3BOAA 2DIZA 1MTCA 1SL2B 3L4NA 1U6TA 1M0UA 5IO0A 4HDEA 2VOCA 4KDUA 2L4QA 5G5EA 1EV9A 4I6XA 3QMXA 1TP9A 4XS6A 1BJXA 4XHMA 3CRUA 2C0FA 2O8VB 5JWQB 1GSFA 3N9JA 2KUCA 1GLQA 5C00A 1WRYA 2X8GA 1DSBA 1F37A 2FGXA 5IIZA 3UMAA 1FB6A 5EVOA 5DCGA 4PQIA 2GQKA 1Z6MA 2OJLA 3QPMA 2H0GA 3TJKA 4XTSA 3GFKA 2J9HA 1XVWA 2EIQA 2E2MA 5F05A 3W6GA 1XWGA 3QAGA 2LNTA 1THXA 2ON7A 4I2TA 2WS2A 1O8XA 2CQ9A 3OR5A 1XZOA 2N5FA 1LJRA 2WJUA 4WR4A 3W8JA 3QCPA 4ZILA 5HR0A 4TOPA 2DIYA 4YQMA 2LRCA 4PNGA 2PVQA 2FD3A 1EOHA 3ED3A 3PINA 4EVMA 4GLTA 2XC2A 3KM6A 5IOWA 3G7JA 5DJLA 1VF1A 2NPBA 2L5OA 2H73A 1ACVA 2DSAA 1BG5A 1Z9HA 4KE3A 5LD0A 2P0GA 1SYXA 2ZCTA 2CT6A 1WPIA 1GNWA 3HYPA 3ZVJD 2Z9SA 2PVOC 1NHOA 2EC4A 2PPTA 2VCTA 1WJKA 2MZCA 3DGQA 4YQUA 3MNGA 17GSA 2NVLA 5AIXA 2HFDA 3LEFA 4BL7A 3BD2A 3UBKA 5F8BA 3GUSA 4DSQA 4XRAA 4F2IA 4LA1A 2V1MA 5CO3A 3HHVA 1OC9A 2H30A 2VD0A 5IMDA 2KP2A 5J5NA 1M2AA 2N5BA 2C3QA 1A23A 3DMLA 2FWGA 1JLWA 1U88A 3D0ZA 4GRFA 1A8YA 3WD6A 2GSTA 3IR4A 4OD7A 4JR4A 2MBTA 2RLIA 1SL0B 1RW1A 5A4WA 5CREA 1A0FA 2BTOT 1F6MC 1LU4A 1AUCA 4KCAA 2CV4A 4MPGA 3WGDA 2GT5A 3DXBA 3LYPA 2ON5A 3HZ8A 3RDWA 10GSA 2XPDA 1O6JA 4ML1A 3TDGA 3RPPA 5IPGA 2VAFA 4KX4A 1NHYA 2TRXA 2JL4A 1ERWA 4Q5QA 4V1Ag 2MMZA 18GSA 2EIOA 5FHIA 3KP9A 3MSZA 4PURA 4HJ2A 2PMTA 1DE1A 3DIEA 1EOGA 3F8UA 1XXUA 4DSSB 2GDRA 4E8EA 2A2SA 3VWXA 1JZRA 4IKHA 1M7TA 4EC0A 3APSA 4EO3A 3CSHA 1Z7PA 2CX3A 5HQPA 1XWCA 3ZMKA 4MABA 5DAKA 2ZUPA 1WMJA 4HS1A 1PQNA 4TXVA 1S3CA 2C3NA 4RQXA 3FHKA 3QOUA 3GX0A 5D96A 3D6IA 4F0BA 3I6AA 3A5WA 4AGSA 2C0EA 1VRSD 3GURA 4NWYA 1A2MA 2I1UA 1TU8A 4PX1A 5DCHA 4ZL9A 1EEJA 2VLVA 3MAKA 3US3A 4G10A 2H66A 2P5RA 3HVSA 3EINA 2C0GA 4ZB6A 1B48A 19GSA 4V2MA 3IC4A 2B5EA 4BPYA 2JSZA 1XWBA 1TK0B 2VO4A 3G9BA 5F06A 2C4JA 2LSTA 3IE3A 2PWJA 1B4PA 2OE1A 1OAZA 2B1KA 3L78A 4FO5A 4HU9A 3FYGA 3BBYA 5GAND 1AC1A 1XVQA 1QGVA 4TKYA 4DEJA 1QQ2A 3E3EA 1K0OA 4O32A 3DYRA 4ISDA 3IRAA 3U6VA 1G6YA 4DVCA 3DKSA 2PERA 1NM3A 5AISA 2PBJA 3GN3A 3JCML 1X5DA 1U3AA 4MP4A 2V32A 1H4OA 3LORA 2F3MA 5J3RA 1PD21 1SJ6A 4MJBA 1K0BA 1USBA 1QUWA 3GV1A 5D9XA 1V57A 3I9V2 2DMMA 3ZIJA 4MJCA 3KXOA 4JU5A 1G0TA 1DUGA 1A2LA 3CRTA 3TRXA 13GSA 2PU9C 1K0CA 2HYXA 1Z7RA 3KMOA 4MF7A 1TU7A 3FZ4A 4NHWA 3F4TA 4E8HA 2IFQB 4TR0A 1M2DA 3N5OA 4RQRA 1SKRB 3VLNA 1ZGNA 4QL9A 2YWOA 2XBQA 4HZ2A 1OKTA 5AIVA 2VIMA 3Q18A 4N30A 1G7OA 5CP1A 4KSOA 3V1WA 5E59A 4GWRA 4XS4A 2V6OA 4F0CA 4JBBA 1OC3A 4ZBAA 3P2AA 4OWYA 6GSSA 2AJQB 1PX6A 3GMFA 4HEA2 1T1VA 1PGTA 3ZITA 5CRWA 4IGJA 2YZUA 4MJAA 3L0HA 3VI7A 4DSRA 3LWAA 4I5QA 2F8FA 6GSYA 3LQ7A 4ECCA 5L71A 3GH6A 2VCWA 4F03A 3TKPA 3GX8A 3KZQA 2K6VA 1KNGA 1U3IA 2YWIA 3QR6A 3TJGA 2HXKA 2KLXA 3GH9A 5DDLA 1KBNA 2H19A 22GSA 1XWAA 2OBKA 2QGVA 2YPMA 1BEDA 3HY2A 3APOA 2C3TA 3F6DA 1WIKA 2IJYA 3KH9A 1XOAA 3U5RE 2RM6A 5DQYA 1K0AA 2RUEA 3WT1A 1GL8A 3DVWA 9GSSA 2H1DA 1E2YA 1FVJA 2NTOA 4K1FA 1HYUA 4I97A 4ML6A 2VLTA 4ILFA 5G30A 3M9KA 1A8LA 5J9BA 1GTBA 3TKRA 5DALB 4EE0A 1SD8A 3GSTA 5AN1A 4Q5FA 4IP1A 4LMVA 3KGKA 1FVKA 1EGOA 4HOJA 3KP8A 1T3BA 1EGRA 5JWOB 2BMXA 3GHAA 2FNOA 1GWCA 2JACA 4P3YB 3TCOA 3HD5A 5CRGA 3GKKA 3ZZXA 1QXHA 4MLYA 1ZOFA 2CX4A 4Q5RA 1TXXA 3ZL5A 2HE3A 2OADA 4PQ1A 3APQA 2B7JA 1A0RP 3IV4A 5B8BA 3QAVA 3H4KA 1XBSA 1NW2A 5G5FA 1TTZA 2R37A 5IMZA 3RHCA 1FAAA 2H1GA 1ILOA 1ABAA 1Y25A 1PKZA 3FR6A 4O7HA 2H76A 3SBCA 3HJMA 3KEBA 1MDIA 2X64A 2WFCA 1B4QA 1XOBA 2LJKA 4IW9A 1GUHA 5ECLB 4MJEA 4EL1A 3PR8A 4K7OA 1GUKA 2F9SA 3O76A 3F9UA 1TRVA 2IMIA 3FZAA 4POBA 3L9SA 1B9XC 5H5RA 2WB9A 1FB0A 4V1Ap 2J23A 2VL2C 5CAXA 3P90A 3TJFA 3P8WA 1OYJA 3EC3A 3KIJA 4HQSA 4D73B 1MD4A 2YV7A 1T8EB 1KEBA 1UC7A 1URMA 3F4SA 3UL3A 4ECJA 1GSEA 1X9WB 4K6XA 5ECOB 1ZYEA 1SU9A 3EU3A 2CZ2A 4NXIA 2QSIA 4OFTA 1YKAA 2AAWA 2GGTA 2HSHA 2L6CA 4YAPA 1R4WA 1S3DA 2OACA 1TRSA 3C7MA 2M72A 1AQWA 4F9ZA 4J2FA 1XWKA 3UVHA 3F0IA 3GYKA 1GTAA 1T4ZA 2YV9A 4ZBBA 3TKSC 4OMVA 3G7YA 4PUAA 2L59A 3QAWA 4O92A 5IQYA 2JZTA 2MMOA 1AXDA 2GSRA 4MF6A 4ZXGA 5B6NA 8GSSA 2X8HA 4IQAA 1YF0A 3BCKA 4KDYA 1T00A 5J41A 2GT6A 4KGIA 3W8SA 5H5SA 3H1NA 4PGTA 4NPBA 4YAVA 3VPQA 1HQOA 3D4MA 3O6TA 5D73A 2O7KA 2C80A 1Z5YE 5LCZA 1FHEA 1F9MA 1RK4A 3LG6A 2L57A 3WT2A 2A2RA 1V2AA 6GSVA 1R7HA 5IMVA 5IPHA 4MPFA 3FK8A 2VD1A 5KN3A 3VWVA 4TVEA 2H1BA 2F8AA 2H1AA 2WZ9A 4EKZA 2GSSA 3EYTA 1GH2A 3EURA 3QD9A 2HLSA 5G1LA 1WE0A 3H8QA 5EY6A 2GQMA 2LS5A 5GSSA 2VCQA 3E0UA 2IFQA 1UA5A 3GL5A 4NAXA 2LTKA 2IMEA 6GSXA 3J7Yk 3VI5A 12GSA 3CXGA 2MBSA 1VF4A 1VGLA 3IDVA 2FLSA 5H5QA 4PNFA 2R5GA 5ECKB 1ZCPA 1QMVA 2QKEA 4K0NA 1V40A 3H79A 4NV5A 2JSYA 1TI3A 1K3OA 2FCHA 1K0MA 4BVXA 2R2JA 5AGYA 4PXOA 4WR5A 4K8MA 4BWQA 5ENUA 2F51A 5COHA 2OE0A 4MZBA 3TOTA 4IN0A 1M2BA 3PH9A 4J57E 1RQMA 1ML6A 4LL4B 5ECRB 1AQVA 1FG4A 2K8SA 3TKSE 4N0ZA 4TXOA 4HUAA 3Q19A 3UEMA 3HDCA 1EZKA 3AY8A 1HNAA 4PUFC 1I9DA 5GSTA 3VFIA 4GXZA 4TR4A 2R4VA 5JCWA 4WETA 1BAYA 4QL7A 1XCCA 5J4UA 3CBUA 3DEXA 2H01A 1GNEA 1M9AA 4HU7A 2VCZA 2AB6A 1GSUA 3IK9A 4EDYA 4FIWA 2YJ7A 5ID2A 3UAPA 4EF0A 1BX9A 1V9WA 3MDKA 4FYCA 4BVYA 5IMAA 2H72A 5IM9A 2AV4A 2B5YA 1AIUA 1TK5B 2JZSA 2VL3A 3CMIA 3F3QA 4HI7A 2AUVA 1WP0A 3VWUA 4G9HA 4NMUA 4Q5NA 3C1RA 2L4CA 4KH7A 4L5OA 4GF0A 1ON4A 2KOKA 3WGXA 2DMLA 5HFIA 5D9TA 2FHEA 1HNBA 2HRFA 3IA1A 2DJ2A 2O85A 1E6BA 3GTUA 5ECIB 5C04A 1XW9A 1GP1A 2H70A 2XBIA 5DVBA 1AW9A 4MA9A 4POMA 2LQQA 2HZEA 4GSTA 1MD3A 2FA8A 3S9FA 2OBIA 2QC7A 3I43A 2VM2A 4MH2A 2GVPA 2DLXA 2HI7A 2GSQA 1JZWA 3H93A 4G2EA 4WKWA 2FWEA 3GSSA 3BCIA 2H0IA 5J9CA 1OVNA 1OC9B 2C1YA 5DQSA 5IMCA 2L5LA 3RPNA 2JZRA 2GZPA 3UVTA 5ELAA 2I4AA 4LMWA 2B5XA 4JR6A 4HQZA 2YNXA 1ST9A 5B6MA 6GSTA 2DJ1A 1PA3A 1Y6EA 2FWHA 2GTUA 3A3TA 3QFAC 1OE7A 3CSJA 1VF2A 4K7IA 3NIVA 5ECPB 1YF1A 1YEXA 1HNCA 3LGCA 4QQ7A 3HJPA 5CRDA 3KJYA 1SL1B 4G19A 2AHEA 2YN1A 1CQHA 3GKXA 4XCSA 4JZQA 2K9FA 4EDZA 4KW6A 2GS3A 5IMFA 1CQGA 2GQLA 3SWLA 1ZYQB 3UBLA 3FR3A 3ME8A 1XIYA 2IIYA 5HR1A 1DE2A 4RI7A 2HZFA 4NV2A 3E9JB 5DJMA 4XRDA 2LRNA 5FWGA 4J56E 3GA4A 1SJZA 1GSQA 1N2AA 1O73A 1G6WA 4X0XA 4JE1A 5G1KA 3CSIA 2AYTA 4KDXA 5DAKB 3IPZA 4TRXA 3HXSA 4JRRA 5B8AA 2IL3A 4GQCA 3EWLA 1O7UA 1GULA 4OO5A 2B6MA 3ZMLA 3I69A 2C0DA 1HD2A 2I9HA 4AJ6A 3KTBA 3UJ1A 1H75A 4MCUA 2E7PA 4GTUA 1O81A 4IELA 4K2DA 3GKNA 1N8JA 1PL1A 4KUNA 4TR1B 1MEKA 1F3AA 2R6KA 5HFKA 2VCXA 1TJDA 2YANA 3NOFA 2IPAA 4KB3A 5KN1A 1YZXA 4OFNA 3ZYWA 5B7CA 1GSDA 5ECQB 3GL3A 2YP6A 1AQXA 2V2GA 5JWRB 3F6FA 3KCMA 3ERGA 3GIXA 3KTLA 3QDNA 4ZB9A 4WBRD 1IYHA 1PMTA 3ISOA 1B8XA 5HFGA 3TB2A 3DWVA 1ERUA 1TKDB 3ZIVA 1GSSA 1W89A 2H6ZA 3CYNA 5G2ZA 3TGZA 2DJJA 3C71A 5A4UA 3HJOA 2BJXA 1K3YA 2WGRA 5IOXA 3FKFA 4TN8A 4L0WA 2YWNA 2CA8A 4IVFA 2YOIA 4FYUA 3CTFA 2YZHA 4RUVA 1GSYA 4O5RA 4KSMA 2ZNMA 1JZOA 1UN2A 2X99A 4DSSA 3M3MA 3ERFA 2IN3A 1BQ7A 4V2NA 4FYBA 3UOMA 2V41A 1TW9A 2CVBA 4WEYA 1TRWA 1GTIA 4WBJA 1JHBA 2DJ0A 5D9VA 2EIRA 4IP6A 2I3YA 4KCEA 5ECSA 3EMPA 2H75A 3A2VA 1R5PA 1G7EA 1A24A 1R26A 5CRHA 1I5GA 2C8UA 2OKAA 4L8EA 2TRCP 3P7XA 3LXZA 1SK2A 2VL9A 3O3TA 1QFNA 5GZZB 3Q6OA 4K7NA 1C72A 1TOFA 1FO5A 3ME7A 4MZWA 1EP8A 2WULA 2L6DA 2ALBA 1MDKA 2XPEA 4XS4B 3M9JA 3L9VA 1U87A 1ZMAA 4HJMA 2IMFA 3J7Yb 4WF4A 1LBKA 4NHZA 4IJ3A 1V58A 4H86A 2I81A 2VUPA 4IHUA 3TRPA 3GNJA 2LJAA 3TJJA 5DBQA 4I8BA 2WCIA 5HR2A 2FUG2 4POKA 2IMKA 3M8NA 4YH2A 3Q74A 1Q4JA 4ID0A 3ZLPA 2E0QA 5KN2A 4MDCA 4X1UA 2YJHA 3ZREA 4KNDA 2LV3A 1AAZA 1SD9A 5KN0A 3MWHA 5F07A 1THOA 1F2EA 2N5AA 3IK7A 3A2WA 3IXRA 2GZZA 2CAQA 1PL2A 5JCGA 5ECNB 3D5JA 3ZRDA 4HZ4A 2HT9A 1T4YA 2H6YA 2O87A 3HVVA 3RAZA 2VL2A 1SKWB 7GSSA 2REMA 5CNWA 2IMDA 4GSNA 4AJ8A 3TJBA 1YEPA 3VURA 2CVDA 4IS0A 1TDIA 1ERVA 4MH3A 4AF2A 3KH7A 3UARA 2M46A 3FW2A 2LKUA 3VK9A 4ECBA 2O89A 4PQHA 3CTGA 2E2GA 4XIHA 5EL8A 2VCVA 2WRTA 4RI6A 1V98A 4N11A 3ZTLA 4TR3A 2V6KA 1KTEA 4WF5A 1EP7A 1J9BA 2LRTA 3HZ4A 1TRUA 3IAM2 2D2ZA 1O8WA 1SK1A 1J08A 14GSA 3LSZA 3DVXA 3A2XA 1Z6NA 3TKSA 2OE3A 2YWMA 3M1GA 2RM5A 4ZIJA 3C8EA 3HA9A 2H6XA 1X5CA 4OO4A 3F4RA 3QFBC 1Q98A 1EWXA 3LFLA 4OCEA 4CW9A 2CZ3A 2RUFA 5E4WA 2VM1A 1YQ1A 5GAPD 1GTUA 3FZ9A 2G2QA 4ECIA 20GSA 2WDUA 2IWTA 3GKMA 1OE8A 3VPTA 3IBHA 3UIWA 1BYEA 1T7PB 2K8VA 1X9MB 5ECMB 2LEGA 3M0FA 1WOUA 1B9YC 3D21A 5DALA 4I2UA 1R5AA 4IJIA 1SENA 5JCUA 3C1SA 3WGEA 4N0VA 1GLPA 3EU4A 2H0HA 2MYGA 4TR1A 3ERWA 2FA4A 4CHSA 2FWFA 2H8LA 1X5EA 1YDKA 3LXTA 3WYWA 1M9BA 1TK8B 4MZCA 2DJ3A 3TRQA 1PX7A 3ZVJA 3LJRA 3TOUA 5D93A 1DBYA 4OCFA 4BWSA 4GQFA 4N10A 1W4VA 1SYRA 2CVKA 2LJRA 1XW6A 1MDJA 1ERTA 3D22A 3FR9A 4ZBDA 2KP1A 2PUKC 2DBCA 5INYA 1X9SB 1K3LA 1YKCA 3ZFBA 1EV4A 3L9UA 3FEUA 2HSYA 3HKRA 2JADA 1JLVA 4EXJA 1YJ6A 1FW1A 3EE2A 4BA7A 2HNLA 4KA0A 2PGTA 3GRXA 4CDOA 1Z3EA 3IOSA 1JFUA 1QK8A 1XPVA 4GSSA 4FH8A 2B7KA 4ACSA 2YCDA 3C73A 4GCIA 4D73A 2H71A 4V2LA 3D4TA 5G31A 3NZNA 1ZZYA 1O85A 3KMNA 2P5QA 3DD3A 3TUEA 4TW5A 4AJ7A 11GSA 2PN8A 5ABRA 1OC8A 4ZL7A 1SKSB 1M99A 6GSUA 1K0DA 2JU5A 16GSA 2K18A 4IBPA 4L5LA 2MMNA 5FT3A 2VLUA 2M80A 2R3XA 2CAIA 4L0UA 3TKQA 6GSWA 2MMAA 1PSQA 2XHFA 2G0FA 3IHQA 4F82A 2OA7A 4ZL8A 1VF3A 2RIIA 2GLRA 4KAEA 3EVIA 4XS1A 1PRXA 3G7IA 1ZL9A 3R2QA 2B3SA 4WXTA 4LLRA 5KEJA 4EUYA 5F0GA 5LNKe 1JZDA 1PKWA 2KHPA 2NDOA 1FOVA 4OFMA 3RBTA 2LUSA 1J0FA 4TXOB 1S3AA 1K0NA 1F3BA 3VWWA 3FY7A 2FY6A 2GZYA 4MK3A 5D9WA 3FZ5A 5ECHB 4YQVA 1SJIA 4ULXA 3DRNA 3RHBA 5A4VA 2P31A 3FRCA 5IO2A 1GRXA 3BJ5A 2DJKA 2NBSA 2TIRA 3IAS2 3EMXA 1YY7A 3ZFLA 4POLA 1IYIA 5ID2B 3K8NA 5HR3A 2B1LA 2HRNA 2LNSA 5A5KA 1TI1A 3KD0A 1X0RA 1GUMA 1WWJA 2A4VA 5D8IA 4IQ1A 4LL1B 5EPFA 3F3RA 2H74A 1A2JA
chains in the Genus database with same CATH superfamily
4K0GA 4PTSA 4MF5A 1SK0A 2LQOA 4MMMA 2CNRA 1UVZA 1PN9A 2PEOA 5CYYA 3F63A 4ZB8A 3HCZA 2PEIA 3GTUB 1EEMA 1OKDA 4DG9A 3LYKA 1XFLA 4X4JA 4Z7XA 2JYGA 2ES7A 2DC5A 4JEDA 2HZEB 5ELGA 2X8CA 1NSWA 1XW5A 3HVXA 3PGTA 2P9XA 4K9ZA 4X43A 3BOAA 2DIZA 1MTCA 1SL2B 1M6EX 2NO8A 3L4NA 1U6TA 1M0UA 5IO0A 4HDEA 4IZ6A 3Q20A 2VOCA 4KDUA 2L4QA 1Q82Q 5G5EA 1EV9A 4I6XA 1KC8Q 3QMXA 1TP9A 4XS6A 1BJXA 4XHMA 3CRUA 2C0FA 2O8VB 5JWQB 1K9MQ 2QA2A 1GSFA 3N9JA 2KUCA 1GLQA 5C00A 1WRYA 2X8GA 1DSBA 1F37A 2FGXA 4CY8A 5IIZA 3UMAA 1FB6A 5EVOA 5DCGA 4PQIA 2GQKA 1Z6MA 2OJLA 3QPMA 4CA3A 2H0GA 3TJKA 4XTSA 3GFKA 3FMWA 2J9HA 1EOQA 1XVWA 2LPKA 2LKIA 2VSQA 2EIQA 2E2MA 5F05A 3W6GA 1RO2A 1XWGA 1ACPA 3QAGA 2KGDA 2LNTA 1THXA 2ON7A 4ICYA 4I2TA 2WS2A 5EJDA 1O8XA 2CQ9A 3OR5A 1XZOA 2N5FA 1YHQP 1LJRA 2WJUA 4WR4A 3W8JA 3CXCO 3QCPA 4ZILA 5HR0A 2ERHA 4FQUA 4TOPA 2DIYA 4YQMA 2LRCA 2AF8A 4PNGA 2PVQA 2FD3A 5HGMA 1EOHA 3ED3A 3PINA 4EVMA 4GLTA 2XC2A 3KM6A 5IOWA 3G7JA 2K5XA 5DJLA 1VF1A 5I4TG 3DPHA 2NPBA 2L5OA 2H73A 1ACVA 2DSAA 1BG5A 1Z9HA 4KE3A 5LD0A 2P0GA 1SYXA 2ZCTA 2CT6A 1WPIA 1GNWA 3HYPA 3ZVJD 1BXIA 2Z9SA 2PVOC 1NHOA 2EC4A 2PPTA 2VCTA 1WJKA 2MZCA 3DGQA 4YQUA 3MNGA 17GSA 2NVLA 4PH1A 4PXHB 5AIXA 2HFDA 1VQNP 3LRYA 2X49A 3LEFA 1ZMBA 4BL7A 2ROQA 3BD2A 3UBKA 5F8BA 2LL8A 3E2DA 3GUSA 4DSQA 4XRAA 4F2IA 1EMVA 4LA1A 2V1MA 5CO3A 3HHVA 1OC9A 2FVAA 2H30A 2VD0A 5IMDA 2KP2A 5J5NA 1M2AA 2N5BA 4G0IA 1F80D 2C3QA 1A23A 3DMLA 2FWGA 1JLWA 1U88A 3D0ZA 4GRFA 2KODA 2OARA 1A8YA 3WD6A 2JU2A 2GSTA 3IR4A 4OD7A 2X4AA 4JR4A 2MBTA 2RLIA 1SL0B 1RW1A 5A4WA 5CREA 1A0FA 2BTOT 1F6MC 1LU4A 1AUCA 4KCAA 2CV4A 4MPGA 3WGDA 2GT5A 3DXBA 3LYPA 2X2BA 2ON5A 3HZ8A 3RDWA 3G71P 10GSA 2XPDA 1O6JA 4ML1A 3TDGA 3RPPA 5IPGA 2VAFA 4KX4A 1NHYA 2TRXA 2JL4A 2Z44A 1ERWA 4O5UA 4Q5QA 4V1Ag 2MMZA 18GSA 2EIOA 5FHIA 3KP9A 3MSZA 4PURA 3MIXA 2PMTA 4HJ2A 2MR8A 1DE1A 3DIEA 1EOGA 3F8UA 1XXUA 4DSSB 2GDRA 4E8EA 2A2SA 3VWXA 1JZRA 4IKHA 4XFZA 1M7TA 4USSA 3APSA 4EC0A 4EO3A 3CSHA 1Z7PA 5HGNA 2CX3A 5HQPA 1XWCA 3H47A 3ZMKA 3GKLC 2L22A 3WBHA 3G1IA 4MABA 5DAKA 2ZUPA 1WMJA 4HS1A 4HSCX 1PQNA 4TXVA 3CCEP 1S3CA 2C3NA 4RQXA 3FHKA 3QOUA 3GX0A 5D96A 3D6IA 4F0BA 3I6AA 3A5WA 4AGSA 2QA1A 2C0EA 1VRSD 3GURA 3HZQA 4NWYA 1A2MA 2I1UA 1TU8A 4PX1A 5DCHA 4ZL9A 1EEJA 2VLVA 3MAKA 3US3A 4G10A 2LIWA 3RG2A 2H66A 4COCA 2P5RA 3HVSA 2JBGA 1W2BO 3EINA 2K0YA 1D1DA 2C0GA 4ZB6A 1B48A 2LTEA 19GSA 1OR5A 1UJZA 4V2MA 1IMQA 3IC4A 2B5EA 4BPYA 4XRQA 2JSZA 1XWBA 1TK0B 2VO4A 3G9BA 5F06A 2GDYA 2K94A 2C4JA 2LSTA 3IE3A 2PWJA 1B4PA 2OE1A 1OAZA 2B1KA 2JYLA 3L78A 4FO5A 4HU9A 2XV6A 3FYGA 1XG8A 3BBYA 5GAND 1AC1A 1XVQA 1QGVA 3I56P 5KP7B 4TKYA 4DEJA 1QQ2A 3E3EA 1K0OA 4O32A 2KGAA 3DYRA 4ISDA 3IRAA 1FOHA 3U6VA 1G6YA 4DVCA 3DKSA 2PERA 1NM3A 5AISA 2PBJA 3GN3A 3JCML 1X5DA 1U3AA 4MP4A 2V32A 1H4OA 3LORA 2F3MA 5J3RA 1PD21 1SJ6A 4MJBA 1K0BA 1USBA 1QUWA 2CG5B 3GV1A 5D9XA 1V57A 3I9V2 1VQLP 2DMMA 2LIUA 3ZIJA 4MJCA 1AF8A 3KXOA 4JU5A 1L0HA 1G0TA 1DUGA 1A2LA 2N6ZA 3CRTA 3TRXA 13GSA 2AFEA 2PU9C 1K0CA 2HYXA 1Z7RA 3KMOA 4MF7A 1ZNVA 1TU7A 3FZ4A 4NHWA 3F4TA 4E8HA 2IFQB 4TR0A 1M2DA 3N5OA 4RQRA 1SKRB 2FACA 3VLNA 3CC2P 2HRKA 1ZGNA 4QL9A 2YWOA 2XBQA 4HZ2A 1OKTA 3NTEA 5AIVA 2VIMA 3Q18A 4N30A 1G7OA 5CP1A 4KSOA 3V1WA 5E59A 2GZFA 3OW2O 4GWRA 4XS4A 2V6OA 4F0CA 4JBBA 1OC3A 4ZBAA 2FQ0A 3P2AA 4OWYA 6GSSA 2AJQB 1PX6A 3GMFA 4HEA2 3CCJP 1PGTA 1T1VA 3ZITA 2FHSC 5CRWA 4IGJA 2YZUA 4MJAA 3L0HA 1M1KQ 3VI7A 4DSRA 3GJNA 3LWAA 4I5QA 2F8FA 6GSYA 3M1MA 4G0KA 3LQ7A 4ECCA 5L71A 3GH6A 2VCWA 4F03A 3TKPA 3GX8A 3KZQA 2K6VA 1KNGA 4PWVB 1YJNP 1U3IA 2YWIA 3QR6A 2PNGA 3TJGA 3CC4P 4F37A 2HXKA 2KLXA 3GH9A 2OBKA 1KBNA 2H19A 22GSA 1XWAA 2QGVA 2YPMA 5DDLA 1BEDA 3HY2A 3APOA 2VLOA 2C3TA 3F6DA 1WIKA 2IJYA 3KH9A 1XOAA 3G29A 3U5RE 2RM6A 5DQYA 1K0AA 2RUEA 3WT1A 3EJEA 1GL8A 3DVWA 9GSSA 2H1DA 1E2YA 1FVJA 2NTOA 4K1FA 1HYUA 4I97A 4ML6A 2VLTA 4ILFA 5G30A 3M9KA 4KF9A 1A8LA 5J9BA 1GTBA 3TKRA 5DALB 4EE0A 2M5RA 1SD8A 3GSTA 5AN1A 4Q5FA 4IP1A 4LMVA 3KGKA 1FVKA 1EGOA 4HOJA 3KP8A 1T3BA 1EGRA 5JWOB 2BMXA 3GHAA 2FNOA 1Q81Q 1GWCA 2JACA 2GYKA 4P3YB 3TCOA 4EIPA 3HD5A 5CRGA 3A5IA 3GKKA 3ZZXA 1QXHA 4MLYA 1ZOFA 2CX4A 4GR6A 4Q5RA 1TXXA 3ZL5A 2HE3A 2OADA 4PQ1A 3APQA 2B7JA 1A0RP 1S3RA 3IV4A 4BIKA 5B8BA 3QAVA 3H4KA 1VQOP 3DS0A 5CZDB 1XBSA 1NW2A 5G5FA 1TTZA 2R37A 5IMZA 3RHCA 1FAAA 1AYIA 2H1GA 1ILOA 1ABAA 1Y25A 1PKZA 3FR6A 4O7HA 2H76A 3SBCA 3HJMA 3KEBA 1MDIA 2X64A 2WFCA 1B4QA 1XOBA 3G28A 3G6EP 2LJKA 4IW9A 4COPA 1GUHA 2MR7A 5ECLB 4K2XA 4MJEA 4EL1A 2KGEA 3PR8A 2DKIA 1DNYA 4K7OA 1GUKA 2F9SA 1GXGA 3O76A 3F9UA 1TRVA 2IMIA 3FZAA 4POBA 3L9SA 4UHPB 1B9XC 5H5RA 2WB9A 1FB0A 4V1Ap 1VQ7P 2J23A 1E0HA 5F2NA 2VL2C 5CAXA 3P90A 2XT1A 3TJFA 3P8WA 1OYJA 3EC3A 3KIJA 4HQSA 4D73B 5BS1A 1MD4A 2YV7A 4GR2A 1T8EB 5KP6B 2MF4A 1M3JA 4Z2UA 1KEBA 1UC7A 1URMA 3F4SA 3UL3A 4ECJA 1GSEA 1PN0A 1X9WB 1AUMA 1JJ2O 4K6XA 5ECOB 2EG5A 2ONTA 2XZ1C 1ZYEA 1SU9A 3EU3A 3CQFA 2CZ2A 4NXIA 2QSIA 4BPGA 4OFTA 1YKAA 2AAWA 2GGTA 2HSHA 2L6CA 4YAPA 5HGLA 1R4WA 1S3DA 2OACA 1TRSA 3C7MA 2M72A 1AQWA 2PEQA 4F9ZA 4J2FA 1XWKA 3UVHA 3F0IA 3GYKA 1GTAA 1T4ZA 2YV9A 4ZBBA 3TKSC 7CEIA 4OMVA 1VQ6P 3G7YA 5BS2A 4PUAA 2K92A 2L59A 2MY5A 3QAWA 4O92A 4U0EA 5IQYA 1L0IA 2JZTA 2MMOA 1AXDA 2GSRA 4MF6A 4ZXGA 5B6NA 8GSSA 2X8HA 3CCUP 4IQAA 2FVFA 2GZJA 3H0DA 2AFDA 1YF0A 3BCKA 4KDYA 1T00A 4Z2TA 5J41A 5DCKA 2BHVA 2GT6A 4KGIA 1FR2A 3W8SA 5H5SA 4M0IA 5KOWA 3H1NA 4PGTA 1KD1Q 4NPBA 4YAVA 3VPQA 1HQOA 3D4MA 3O6TA 5D73A 2O7KA 2C80A 1Z5YE 5LCZA 4XFXA 1FHEA 1F9MA 1RK4A 3LG6A 2L57A 2N5HA 3WT2A 2A2RA 1V2AA 6GSVA 1R7HA 5IMVA 5IPHA 2VLNA 4MPFA 3FK8A 3RG6C 2VD1A 5KN3A 2K2QA 3VWVA 2KWLA 1NQ4A 2JB0A 4TVEA 2H1BA 1VQMP 2F8AA 2H1AA 2WZ9A 4CY6A 4EKZA 2GSSA 3EYTA 1GH2A 3EURA 3QD9A 2HLSA 2PEJA 5G1LA 1WE0A 3H8QA 5EY6A 2GQMA 2LS5A 5GSSA 2KOQA 2VCQA 3E0UA 2IFQA 1UA5A 2KG9A 3GL5A 4NAXA 2LTKA 2IMEA 6GSXA 3J7Yk 3VI5A 12GSA 3CXGA 2MBSA 1VF4A 1VGLA 3IDVA 1ZYNA 2FLSA 5H5QA 1Q7YQ 4PNFA 2R5GA 5ECKB 1ZCPA 1QMVA 1QVGO 2QKEA 4K0NA 1V40A 4MNNA 3H79A 4NV5A 3EJDA 2JSYA 4MRTC 1TI3A 1K3OA 2FCHA 3HYBA 1K0MA 4BVXA 2R2JA 5AGYA 4PXOA 4WR5A 4K8MA 4BWQA 4H2XC 5ENUA 2F51A 5COHA 2OE0A 4MZBA 3TOTA 4R0MA 4IN0A 1M2BA 3PH9A 4J57E 1RQMA 1ML6A 4LL4B 5ECRB 1AQVA 1FG4A 2DNWA 2K8SA 3TKSE 4N0ZA 4TXOA 4HUAA 3Q19A 2KOSA 3CCVP 1NJIQ 3UEMA 3HDCA 2EHTA 1EZKA 3AY8A 1HNAA 4PUFC 1I9DA 5GSTA 3VFIA 4GXZA 4TR4A 1VQ4P 2R4VA 5JCWA 4WETA 1BAYA 4QL7A 1XCCA 5J4UA 3CBUA 3DEXA 2H01A 2M8NA 2LOLA 2PENA 5HV8A 1GNEA 1M9AA 3EJBA 4HU7A 2VCZA 2AB6A 1GSUA 3IK9A 4EDYA 4FIWA 2YJ7A 5ID2A 3UAPA 4EF0A 1BX9A 1V9WA 2JGPA 3MDKA 4FYCA 1VKUA 4BVYA 5IMAA 2H72A 5IM9A 2AV4A 2B5YA 1AIUA 1TK5B 2JZSA 2VL3A 3CMIA 3F3QA 4HI7A 2AUVA 1WP0A 3VWUA 4G9HA 4NMUA 4Q5NA 3C1RA 2L4CA 4KH7A 1S72P 4L5OA 4GF0A 2E1MA 1ON4A 2KOKA 3CD6P 1YIJP 3WGXA 2DMLA 5HFIA 5D9TA 2FHEA 1HNBA 2XXMA 2HRFA 3IA1A 2DJ2A 2O85A 1E6BA 3GTUA 5ECIB 4U0AA 5C04A 1XW9A 1GP1A 2K93A 2H70A 2XBIA 5DVBA 1AW9A 4MA9A 4POMA 2LQQA 2HZEA 4GSTA 1MD3A 2FA8A 3S9FA 2OBIA 2QC7A 3LMOA 3I43A 2VM2A 4MH2A 2GVPA 2DLXA 2HI7A 2GSQA 1JZWA 3H93A 4G2EA 4WKWA 2FWEA 3GSSA 3BCIA 2H0IA 5J9CA 1OVNA 1OC9B 2C1YA 5DQSA 1VQ9P 5IMCA 3G0VA 2L5LA 2R0GA 3RPNA 3DTJA 2JZRA 2GZPA 3UVTA 5ELAA 2I4AA 4LMWA 5JPAA 2B5XA 2MVUA 4QNBA 4JR6A 4HQZA 4XFYA 2YNXA 2EFJA 1ST9A 2BUOA 5B6MA 6GSTA 2DJ1A 1PA3A 1Y6EA 2LF4A 2FWHA 2GTUA 3A3TA 3QFAC 1OE7A 3CSJA 2KG6A 1VF2A 4K7IA 3NIVA 5ECPB 1YF1A 1YEXA 1HNCA 3LGCA 4QQ7A 3HJPA 5CRDA 2KORA 3KJYA 1SL1B 4G19A 2AHEA 2YN1A 1CQHA 2Z46A 4U0FA 3GKXA 1YI2P 4BPHA 4XCSA 4JZQA 2K9FA 4EDZA 4KW6A 2GDWA 2GS3A 5IMFA 2L9FA 1CQGA 2M8LA 2GQLA 3SWLA 1ZYQB 3UBLA 3FR3A 3ME8A 1XIYA 2IIYA 5HR1A 2UZ8A 1DE2A 4RI7A 2HZFA 2FAEA 4NV2A 3E9JB 2GZEA 5DJMA 4XRDA 2PEKA 2LRNA 2L4BA 5FWGA 4J56E 3GA4A 1SJZA 1GSQA 1N2AA 1O73A 1G6WA 4X0XA 4JE1A 5G1KA 3CSIA 2AYTA 4KDXA 5DAKB 2GZIA 3IPZA 4TRXA 3HXSA 4JRRA 5B8AA 2IL3A 4HKGA 4GQCA 3EWLA 1O7UA 1GULA 4OO5A 2B6MA 2FVEA 1M3IA 3ZMLA 3I69A 4K5RA 4H2WC 2C0DA 1HD2A 2I9HA 4AJ6A 3IHGA 3KTBA 3UJ1A 1H75A 4MCUA 2E7PA 4GTUA 1O81A 4IELA 4K2DA 3GKNA 1N8JA 1PL1A 4KUNA 4TR1B 1MEKA 1F3AA 2R6KA 5HFKA 2VCXA 2FQ1A 1TJDA 2YANA 4K5SA 3NOFA 2IPAA 4KB3A 5KN1A 2MD9A 1YZXA 4OFNA 3ZYWA 5B7CA 1GSDA 5ECQB 3GL3A 1QRJA 4U0DA 2YP6A 1AQXA 2V2GA 1ZYPA 4H2YC 5JWRB 3F6FA 3KCMA 2CQ8A 3ERGA 3GIXA 3IC8A 3KTLA 3QDNA 4WBRD 4ZB9A 1GXHA 1IYHA 2R0PA 2XZ0D 1PMTA 3ISOA 1B8XA 5HVCA 5HFGA 3NY7B 3TB2A 3DWVA 1ERUA 5BRTA 1TKDB 3ZIVA 2JAZA 1GSSA 1W89A 2H6ZA 3CYNA 5G2ZA 3TGZA 2DJJA 3C71A 5A4UA 3HJOA 2BJXA 2QA4P 1K3YA 2WGRA 5IOXA 5BMUA 3FKFA 4TN8A 4L0WA 2YWNA 2CA8A 2KOPA 4IVFA 2YOIA 1Q86Q 4FYUA 3CTFA 2YZHA 1VQPP 1K8AQ 4RUVA 1GSYA 2OTJP 4O5RA 4KSMA 2ZNMA 1JZOA 1UN2A 2X99A 4DSSA 3M3MA 3ERFA 2IN3A 3CC7P 1BQ7A 4FYBA 4V2NA 3UOMA 2V41A 3G1GA 4WYMA 1TW9A 2CVBA 4WEYA 1TRWA 1GTIA 4WBJA 5HGOA 1JHBA 2DJ0A 5D9VA 2EIRA 4IP6A 2I3YA 4KCEA 3R3EA 5ECSA 3I55P 3EMPA 2H75A 3A2VA 1R5PA 1G7EA 2KOOA 1PFOA 2VLPA 1A24A 1R26A 5CRHA 1I5GA 4XROA 1M90Q 2C8UA 2OKAA 3G26A 4L8EA 3CCMP 2TRCP 2Z45A 3P7XA 3LXZA 1IUQA 1SK2A 2VL9A 1E6JP 3O3TA 1QFNA 5GZZB 3Q6OA 4K7NA 3G21A 1RNIA 1C72A 3MGEA 3GZLA 1TOFA 1FO5A 3ME7A 4MZWA 3CMAP 1EP8A 2WULA 2L6DA 2ALBA 1MDKA 2XPEA 4XS4B 3M9JA 3L9VA 1KLPA 1U87A 1ZMAA 4HJMA 2IMFA 3J7Yb 2HRAA 4WF4A 2K0XA 1LBKA 2PY8A 4Z2RA 4NHZA 4IJ3A 1V58A 4H86A 2I81A 1MZ8A 2VUPA 4IHUA 3TRPA 3GNJA 2LJAA 3TJJA 5DBQA 4I8BA 2WCIA 5HR2A 2FUG2 4POKA 2IMKA 3M8NA 2OTLP 1YJ9P 4YH2A 3Q74A 2EIAA 1Q4JA 1A43A 4ID0A 1M6NA 1BAJA 3ZLPA 2E0QA 5KN2A 4MDCA 3EPTA 4X1UA 2YJHA 1UNKA 3ZREA 2KGCA 4KNDA 2LV3A 2R0CA 2LMLA 1AAZA 1SD9A 5KN0A 3MWHA 5F07A 1THOA 4U0BA 1F2EA 2N5AA 3IK7A 3A2WA 3IXRA 2GZZA 2CAQA 1HY8A 3MYDA 1PL2A 5JCGA 2GDXA 3CCSP 5ECNB 2JU1A 2N5IA 3D5JA 1VQ5P 3ZRDA 4HZ4A 2HT9A 1T4YA 2H6YA 2O87A 3HVVA 3RAZA 2VL2A 1SKWB 7GSSA 2N50A 1K30A 1K73Q 2QEXP 2REMA 5CNWA 2IMDA 2N6YA 4GSNA 4AJ8A 3TJBA 1YEPA 3VURA 2CVDA 2GZGA 4IS0A 1TDIA 1ERVA 4MH3A 4AF2A 5KOXA 3KH7A 3UARA 2M46A 3FW2A 2LKUA 3VK9A 4ECBA 2O89A 4PQHA 2A2PA 3CTGA 2E2GA 4XIHA 3CCQP 5EL8A 2KG8A 2VCVA 2WRTA 4RI6A 3PPUA 1V98A 2JO0A 4N11A 3U43A 3CMEP 3ZTLA 4TR3A 1N8RQ 2V6KA 1KTEA 4WF5A 1EP7A 1J9BA 2LRTA 3HZ4A 1HQBA 2PEMA 1TRUA 3IAM2 2AVAA 2D2ZA 1VQ8P 1O8WA 3CE7A 1A8OA 1SK1A 1J08A 1QVFO 14GSA 3LSZA 3DVXA 2KR5A 3A2XA 1Z6NA 3TKSA 2OE3A 2YWMA 3M1GA 2RM5A 4ZIJA 3C8EA 3HA9A 2H6XA 1X5CA 4OO4A 3F4RA 3QFBC 1Q98A 1EWXA 3LFLA 4OCEA 4CW9A 2CZ3A 2RUFA 4EIQA 5E4WA 3H4EA 2VM1A 1YQ1A 5GAPD 2JQ4A 1GTUA 3FZ9A 2WPTA 1CEIA 2G2QA 4ECIA 20GSA 2DKHA 3B4QA 2WDUA 2IWTA 3GKMA 1OE8A 3VPTA 3IBHA 3UIWA 3DS5A 1BYEA 1T7PB 2K8VA 3DS3A 1YITP 4YKGA 1X9MB 5ECMB 2LEGA 3M0FA 1WOUA 1B9YC 3D21A 5DALA 4YKFA 4I2UA 2MVVA 1R5AA 4IJIA 1SENA 5JCUA 3C1SA 3WGEA 4A5PA 4N0VA 3CCRP 1GLPA 3EU4A 2H0HA 2MYGA 4TR1A 2EHSA 3ERWA 2FA4A 4CHSA 2FWFA 2H8LA 1X5EA 1YDKA 3LXTA 3WYWA 1M9BA 1TK8B 4MZCA 4NEOA 2DJ3A 3TRQA 1PX7A 3ZVJA 3LJRA 3TOUA 5D93A 1DBYA 4OCFA 4BWSA 4GQFA 4N10A 1W4VA 4U0CA 5KP8B 1SYRA 2CVKA 2LJRA 1XW6A 1MDJA 1ERTA 3D22A 4BL7B 3FR9A 4ZBDA 2KP1A 2PUKC 2DBCA 1GPJA 5INYA 1X9SB 2CWOA 1K3LA 1YKCA 3ZFBA 1EV4A 3L9UA 1EIAA 2L0QA 1YJWP 1VHNA 2M8PA 3FEUA 2HSYA 1IMPA 3HKRA 2JADA 1JLVA 4EXJA 1YJ6A 1FW1A 2L6EA 3EE2A 4BA7A 2HNLA 4KA0A 2PGTA 3GRXA 2VLQA 2N98A 4CDOA 1Z3EA 3IOSA 2CGQA 1JFUA 1QK8A 1XPVA 4GSSA 4FH8A 2A4HA 2B7KA 1DV5A 4ACSA 2YCDA 3DS2A 3C73A 2DGYA 4GCIA 4D73A 2H71A 4V2LA 3DS1A 3B5IA 3D4TA 5G31A 3NZNA 4BPFA 1ZZYA 1O85A 3KMNA 2P5QA 3DD3A 3TUEA 4TW5A 4AJ7A 11GSA 2PN8A 4PH0A 5ABRA 1T8KA 4IPYA 1OC8A 4ZL7A 1SKSB 1M99A 6GSUA 1K0DA 2JU5A 16GSA 2K18A 3HVNA 4IBPA 4L5LA 2MMNA 5FT3A 2VLUA 2M80A 2R3XA 2CAIA 4L0UA 4G0LA 5EW5E 3TKQA 6GSWA 2MMAA 1PSQA 2XHFA 2G0FA 3IHQA 4BVXB 4F82A 2OA7A 2FADA 1VF3A 4ZL8A 2RIIA 2QNWA 2GLRA 4KAEA 3EVIA 3G4SP 4XS1A 2K0DX 1PRXA 3G7IA 1ZL9A 3R2QA 2B3SA 4WXTA 1RO0A 4LLRA 5KEJA 4EUYA 2KW2A 5F0GA 5LNKe 3CPWO 1JZDA 1PKWA 2KHPA 2NDOA 1FOVA 4OFMA 3RBTA 2LUSA 1J0FA 4TXOB 1S3AA 1K0NA 1X3OA 1F3BA 3VWWA 3FY7A 3GZMA 2FY6A 2GZYA 4MK3A 5D9WA 3FZ5A 5ECHB 4YQVA 1SJIA 4ULXA 1M74A 2HSMA 3DRNA 3RHBA 5A4VA 3P05A 5F2KA 2P31A 3DS4A 3FRCA 3LW9A 4QKOA 1VQKP 5IO2A 1GRXA 3BJ5A 5F2OA 2DJKA 2NBSA 3VRLC 2TIRA 3IAS2 3EMXA 1YY7A 3ZFLA 4POLA 1IYIA 5ID2B 3K8NA 5HR3A 2B1LA 2HRNA 2LNSA 5A5KA 3CCLP 1TI1A 3KD0A 4BVYB 1X0RA 1GUMA 1WWJA 4O5QA 2FQ2A 2A4VA 5D8IA 4IQ1A 4LL1B 5EPFA 3F3RA 1KQSO 2H74A 1A2JA
chains in the Genus database with same CATH topology
4K0GA 4PTSA 4MF5A 1SK0A 2LQOA 4MMMA 1UVZA 1PN9A 5CYYA 3F63A 4ZB8A 3HCZA 3GTUB 1EEMA 1OKDA 3LYKA 1XFLA 4X4JA 4Z7XA 2ES7A 2DC5A 4JEDA 2HZEB 5ELGA 2X8CA 1NSWA 1XW5A 3HVXA 3PGTA 4K9ZA 4X43A 3BOAA 2DIZA 1MTCA 1SL2B 3L4NA 1U6TA 1M0UA 5IO0A 4HDEA 2VOCA 4KDUA 2L4QA 5G5EA 1EV9A 4I6XA 3QMXA 1TP9A 4XS6A 1BJXA 4XHMA 3CRUA 2C0FA 2O8VB 5JWQB 2QA2A 1GSFA 3N9JA 2KUCA 1GLQA 5C00A 1WRYA 2X8GA 1DSBA 1F37A 2FGXA 4CY8A 5IIZA 3UMAA 1FB6A 5EVOA 5DCGA 4PQIA 2GQKA 1Z6MA 2OJLA 3QPMA 2H0GA 3TJKA 4XTSA 3GFKA 3FMWA 2J9HA 1XVWA 2EIQA 2E2MA 5F05A 3W6GA 1XWGA 3QAGA 2LNTA 1THXA 2ON7A 4ICYA 4I2TA 2WS2A 1O8XA 2CQ9A 3OR5A 1XZOA 2N5FA 1LJRA 2WJUA 4WR4A 3W8JA 3QCPA 4ZILA 5HR0A 4FQUA 4TOPA 2DIYA 4YQMA 2LRCA 4PNGA 2PVQA 2FD3A 1EOHA 3ED3A 3PINA 4EVMA 4GLTA 2XC2A 3KM6A 5IOWA 3G7JA 5DJLA 1VF1A 2NPBA 2L5OA 2H73A 1ACVA 2DSAA 1BG5A 1Z9HA 4KE3A 5LD0A 2P0GA 1SYXA 2ZCTA 2CT6A 1WPIA 1GNWA 3HYPA 3ZVJD 2Z9SA 2PVOC 1NHOA 2EC4A 2PPTA 2VCTA 1WJKA 2MZCA 3DGQA 4YQUA 3MNGA 17GSA 2NVLA 5AIXA 2HFDA 2X49A 3LEFA 4BL7A 3BD2A 3UBKA 5F8BA 3GUSA 4DSQA 4XRAA 4F2IA 4LA1A 2V1MA 5CO3A 3HHVA 1OC9A 2H30A 2VD0A 5IMDA 2KP2A 5J5NA 1M2AA 2N5BA 4G0IA 2C3QA 1A23A 3DMLA 2FWGA 1JLWA 1U88A 3D0ZA 4GRFA 1A8YA 3WD6A 2GSTA 3IR4A 4OD7A 2X4AA 4JR4A 2MBTA 2RLIA 1SL0B 1RW1A 5A4WA 5CREA 1A0FA 2BTOT 1F6MC 1LU4A 1AUCA 4KCAA 2CV4A 4MPGA 3WGDA 2GT5A 3DXBA 3LYPA 2ON5A 3HZ8A 3RDWA 10GSA 2XPDA 1O6JA 4ML1A 3TDGA 3RPPA 5IPGA 2VAFA 4KX4A 1NHYA 2TRXA 2JL4A 1ERWA 4O5UA 4Q5QA 4V1Ag 2MMZA 18GSA 2EIOA 5FHIA 3KP9A 3MSZA 4PURA 3MIXA 2PMTA 4HJ2A 1DE1A 3DIEA 1EOGA 3F8UA 1XXUA 4DSSB 2GDRA 4E8EA 2A2SA 3VWXA 1JZRA 4IKHA 1M7TA 4USSA 3APSA 4EC0A 4EO3A 3CSHA 1Z7PA 2CX3A 5HQPA 1XWCA 3ZMKA 4MABA 5DAKA 2ZUPA 1WMJA 4HS1A 1PQNA 4TXVA 1S3CA 2C3NA 4RQXA 3FHKA 3QOUA 3GX0A 5D96A 3D6IA 4F0BA 3I6AA 3A5WA 4AGSA 2QA1A 2C0EA 1VRSD 3GURA 4NWYA 1A2MA 2I1UA 1TU8A 4PX1A 5DCHA 4ZL9A 1EEJA 2VLVA 3MAKA 3US3A 4G10A 2H66A 2P5RA 3HVSA 3EINA 2C0GA 4ZB6A 1B48A 19GSA 4V2MA 3IC4A 2B5EA 4BPYA 2JSZA 1XWBA 1TK0B 2VO4A 3G9BA 5F06A 2C4JA 2LSTA 3IE3A 2PWJA 1B4PA 2OE1A 1OAZA 2B1KA 3L78A 4FO5A 4HU9A 3FYGA 3BBYA 5GAND 1AC1A 1XVQA 1QGVA 4TKYA 4DEJA 1QQ2A 3E3EA 1K0OA 4O32A 3DYRA 4ISDA 3IRAA 1FOHA 3U6VA 1G6YA 4DVCA 3DKSA 2PERA 1NM3A 5AISA 2PBJA 3GN3A 3JCML 1X5DA 1U3AA 4MP4A 2V32A 1H4OA 3LORA 2F3MA 5J3RA 1PD21 1SJ6A 4MJBA 1K0BA 1USBA 1QUWA 3GV1A 5D9XA 1V57A 3I9V2 2DMMA 3ZIJA 4MJCA 3KXOA 4JU5A 1G0TA 1DUGA 1A2LA 3CRTA 3TRXA 13GSA 2PU9C 1K0CA 2HYXA 1Z7RA 3KMOA 4MF7A 1TU7A 3FZ4A 4NHWA 3F4TA 4E8HA 2IFQB 4TR0A 1M2DA 3N5OA 4RQRA 1SKRB 3VLNA 2HRKA 1ZGNA 4QL9A 2YWOA 2XBQA 4HZ2A 1OKTA 5AIVA 2VIMA 3Q18A 4N30A 1G7OA 5CP1A 4KSOA 3V1WA 5E59A 4GWRA 4XS4A 2V6OA 4F0CA 4JBBA 1OC3A 4ZBAA 3P2AA 4OWYA 6GSSA 2AJQB 1PX6A 3GMFA 4HEA2 1T1VA 1PGTA 3ZITA 5CRWA 4IGJA 2YZUA 4MJAA 3L0HA 3VI7A 4DSRA 3LWAA 4I5QA 2F8FA 6GSYA 4G0KA 3LQ7A 4ECCA 5L71A 3GH6A 2VCWA 4F03A 3TKPA 3GX8A 3KZQA 2K6VA 1KNGA 1U3IA 2YWIA 3QR6A 3TJGA 2HXKA 2KLXA 3GH9A 2OBKA 1KBNA 2H19A 22GSA 1XWAA 2QGVA 2YPMA 5DDLA 1BEDA 3HY2A 3APOA 2C3TA 3F6DA 1WIKA 2IJYA 3KH9A 1XOAA 3U5RE 2RM6A 5DQYA 1K0AA 2RUEA 3WT1A 1GL8A 3DVWA 9GSSA 2H1DA 1E2YA 1FVJA 2NTOA 4K1FA 1HYUA 4I97A 4ML6A 2VLTA 4ILFA 5G30A 3M9KA 4KF9A 1A8LA 5J9BA 1GTBA 3TKRA 5DALB 4EE0A 1SD8A 3GSTA 5AN1A 4Q5FA 4IP1A 4LMVA 3KGKA 1FVKA 1EGOA 4HOJA 3KP8A 1T3BA 1EGRA 5JWOB 2BMXA 3GHAA 2FNOA 1GWCA 2JACA 4P3YB 3TCOA 4EIPA 3HD5A 5CRGA 3A5IA 3GKKA 3ZZXA 1QXHA 4MLYA 1ZOFA 2CX4A 4Q5RA 1TXXA 3ZL5A 2HE3A 2OADA 4PQ1A 3APQA 2B7JA 1A0RP 3IV4A 5B8BA 3QAVA 3H4KA 1XBSA 1NW2A 5G5FA 1TTZA 2R37A 5IMZA 3RHCA 1FAAA 2H1GA 1ILOA 1ABAA 1Y25A 1PKZA 3FR6A 4O7HA 2H76A 3SBCA 3HJMA 3KEBA 1MDIA 2X64A 2WFCA 1B4QA 1XOBA 2LJKA 4IW9A 1GUHA 5ECLB 4K2XA 4MJEA 4EL1A 3PR8A 2DKIA 4K7OA 1GUKA 2F9SA 3O76A 3F9UA 1TRVA 2IMIA 3FZAA 4POBA 3L9SA 1B9XC 5H5RA 2WB9A 1FB0A 4V1Ap 2J23A 2VL2C 5CAXA 3P90A 3TJFA 3P8WA 1OYJA 3EC3A 3KIJA 4HQSA 4D73B 1MD4A 2YV7A 1T8EB 4Z2UA 1KEBA 1UC7A 1URMA 3F4SA 3UL3A 4ECJA 1GSEA 1PN0A 1X9WB 4K6XA 5ECOB 1ZYEA 1SU9A 3EU3A 2CZ2A 4NXIA 2QSIA 4OFTA 1YKAA 2AAWA 2GGTA 2HSHA 2L6CA 4YAPA 1R4WA 1S3DA 2OACA 1TRSA 3C7MA 2M72A 1AQWA 4F9ZA 4J2FA 1XWKA 3UVHA 3F0IA 3GYKA 1GTAA 1T4ZA 2YV9A 4ZBBA 3TKSC 4OMVA 3G7YA 4PUAA 2L59A 3QAWA 4O92A 5IQYA 2JZTA 2MMOA 1AXDA 2GSRA 4MF6A 4ZXGA 5B6NA 8GSSA 2X8HA 4IQAA 1YF0A 3BCKA 4KDYA 1T00A 4Z2TA 5J41A 2GT6A 4KGIA 3W8SA 5H5SA 5KOWA 3H1NA 4PGTA 4NPBA 4YAVA 3VPQA 1HQOA 3D4MA 3O6TA 5D73A 2O7KA 2C80A 1Z5YE 5LCZA 1FHEA 1F9MA 1RK4A 3LG6A 2L57A 3WT2A 2A2RA 1V2AA 6GSVA 1R7HA 5IMVA 5IPHA 4MPFA 3FK8A 2VD1A 5KN3A 3VWVA 4TVEA 2H1BA 2F8AA 2H1AA 2WZ9A 4CY6A 4EKZA 2GSSA 3EYTA 1GH2A 3EURA 3QD9A 2HLSA 5G1LA 1WE0A 3H8QA 5EY6A 2GQMA 2LS5A 5GSSA 2VCQA 3E0UA 2IFQA 1UA5A 3GL5A 4NAXA 2LTKA 2IMEA 6GSXA 3J7Yk 3VI5A 12GSA 3CXGA 2MBSA 1VF4A 1VGLA 3IDVA 1ZYNA 2FLSA 5H5QA 4PNFA 2R5GA 5ECKB 1ZCPA 1QMVA 2QKEA 4K0NA 1V40A 4MNNA 3H79A 4NV5A 2JSYA 1TI3A 1K3OA 2FCHA 1K0MA 4BVXA 2R2JA 5AGYA 4PXOA 4WR5A 4K8MA 4BWQA 5ENUA 2F51A 5COHA 2OE0A 4MZBA 3TOTA 4IN0A 1M2BA 3PH9A 4J57E 1RQMA 1ML6A 4LL4B 5ECRB 1AQVA 1FG4A 2K8SA 3TKSE 4N0ZA 4TXOA 4HUAA 3Q19A 3UEMA 3HDCA 1EZKA 3AY8A 1HNAA 4PUFC 1I9DA 5GSTA 3VFIA 4GXZA 4TR4A 2R4VA 5JCWA 4WETA 1BAYA 4QL7A 1XCCA 5J4UA 3CBUA 3DEXA 2H01A 1GNEA 1M9AA 4HU7A 2VCZA 2AB6A 1GSUA 3IK9A 4EDYA 4FIWA 2YJ7A 5ID2A 3UAPA 4EF0A 1BX9A 1V9WA 3MDKA 4FYCA 4BVYA 5IMAA 2H72A 5IM9A 2AV4A 2B5YA 1AIUA 1TK5B 2JZSA 2VL3A 3CMIA 3F3QA 4HI7A 2AUVA 1WP0A 3VWUA 4G9HA 4NMUA 4Q5NA 3C1RA 2L4CA 4KH7A 4L5OA 4GF0A 1ON4A 2KOKA 3WGXA 2DMLA 5HFIA 5D9TA 2FHEA 1HNBA 2HRFA 3IA1A 2DJ2A 2O85A 1E6BA 3GTUA 5ECIB 5C04A 1XW9A 1GP1A 2H70A 2XBIA 5DVBA 1AW9A 4MA9A 4POMA 2LQQA 2HZEA 4GSTA 1MD3A 2FA8A 3S9FA 2OBIA 2QC7A 3I43A 2VM2A 4MH2A 2GVPA 2DLXA 2HI7A 2GSQA 1JZWA 3H93A 4G2EA 4WKWA 2FWEA 3GSSA 3BCIA 2H0IA 5J9CA 1OVNA 1OC9B 2C1YA 5DQSA 5IMCA 2L5LA 2R0GA 3RPNA 2JZRA 2GZPA 3UVTA 5ELAA 2I4AA 4LMWA 2B5XA 4JR6A 4HQZA 2YNXA 1ST9A 5B6MA 6GSTA 2DJ1A 1PA3A 1Y6EA 2FWHA 2GTUA 3A3TA 3QFAC 1OE7A 3CSJA 1VF2A 4K7IA 3NIVA 5ECPB 1YF1A 1YEXA 1HNCA 3LGCA 4QQ7A 3HJPA 5CRDA 3KJYA 1SL1B 4G19A 2AHEA 2YN1A 1CQHA 3GKXA 4XCSA 4JZQA 2K9FA 4EDZA 4KW6A 2GS3A 5IMFA 1CQGA 2GQLA 3SWLA 1ZYQB 3UBLA 3FR3A 3ME8A 1XIYA 2IIYA 5HR1A 2UZ8A 1DE2A 4RI7A 2HZFA 4NV2A 3E9JB 5DJMA 4XRDA 2LRNA 5FWGA 4J56E 3GA4A 1SJZA 1GSQA 1N2AA 1O73A 1G6WA 4X0XA 4JE1A 5G1KA 3CSIA 2AYTA 4KDXA 5DAKB 3IPZA 4TRXA 3HXSA 4JRRA 5B8AA 2IL3A 4GQCA 3EWLA 1O7UA 1GULA 4OO5A 2B6MA 3ZMLA 3I69A 4K5RA 2C0DA 1HD2A 2I9HA 4AJ6A 3IHGA 3KTBA 3UJ1A 1H75A 4MCUA 2E7PA 4GTUA 1O81A 4IELA 4K2DA 3GKNA 1N8JA 1PL1A 4KUNA 4TR1B 1MEKA 1F3AA 2R6KA 5HFKA 2VCXA 1TJDA 2YANA 4K5SA 3NOFA 2IPAA 4KB3A 5KN1A 1YZXA 4OFNA 3ZYWA 5B7CA 1GSDA 5ECQB 3GL3A 2YP6A 1AQXA 2V2GA 1ZYPA 5JWRB 3F6FA 3KCMA 3ERGA 3GIXA 3IC8A 3KTLA 3QDNA 4WBRD 4ZB9A 1IYHA 2R0PA 1PMTA 3ISOA 1B8XA 5HFGA 3TB2A 3DWVA 1ERUA 5BRTA 1TKDB 3ZIVA 1GSSA 1W89A 2H6ZA 3CYNA 5G2ZA 3TGZA 2DJJA 3C71A 5A4UA 3HJOA 2BJXA 1K3YA 2WGRA 5IOXA 5BMUA 3FKFA 4TN8A 4L0WA 2YWNA 2CA8A 4IVFA 2YOIA 4FYUA 3CTFA 2YZHA 4RUVA 1GSYA 4O5RA 4KSMA 2ZNMA 1JZOA 1UN2A 2X99A 4DSSA 3M3MA 3ERFA 2IN3A 1BQ7A 4V2NA 4FYBA 3UOMA 2V41A 1TW9A 2CVBA 4WEYA 1TRWA 1GTIA 4WBJA 1JHBA 2DJ0A 5D9VA 2EIRA 4IP6A 2I3YA 4KCEA 3R3EA 5ECSA 3EMPA 2H75A 3A2VA 1R5PA 1G7EA 1A24A 1R26A 5CRHA 1I5GA 2C8UA 2OKAA 4L8EA 2TRCP 3P7XA 3LXZA 1SK2A 2VL9A 3O3TA 1QFNA 5GZZB 3Q6OA 4K7NA 1C72A 1TOFA 1FO5A 3ME7A 4MZWA 1EP8A 2WULA 2L6DA 2ALBA 1MDKA 2XPEA 4XS4B 3M9JA 3L9VA 1U87A 1ZMAA 4HJMA 2IMFA 3J7Yb 2HRAA 4WF4A 1LBKA 4Z2RA 4NHZA 4IJ3A 1V58A 4H86A 2I81A 2VUPA 4IHUA 3TRPA 3GNJA 2LJAA 3TJJA 5DBQA 4I8BA 2WCIA 5HR2A 2FUG2 4POKA 2IMKA 3M8NA 4YH2A 3Q74A 1Q4JA 4ID0A 3ZLPA 2E0QA 5KN2A 4MDCA 3EPTA 4X1UA 2YJHA 3ZREA 4KNDA 2LV3A 2R0CA 1AAZA 1SD9A 5KN0A 3MWHA 5F07A 1THOA 1F2EA 2N5AA 3IK7A 3A2WA 3IXRA 2GZZA 2CAQA 3MYDA 1PL2A 5JCGA 5ECNB 3D5JA 3ZRDA 4HZ4A 2HT9A 1T4YA 2H6YA 2O87A 3HVVA 3RAZA 2VL2A 1SKWB 7GSSA 2REMA 5CNWA 2IMDA 4GSNA 4AJ8A 3TJBA 1YEPA 3VURA 2CVDA 4IS0A 1TDIA 1ERVA 4MH3A 4AF2A 5KOXA 3KH7A 3UARA 2M46A 3FW2A 2LKUA 3VK9A 4ECBA 2O89A 4PQHA 2A2PA 3CTGA 2E2GA 4XIHA 5EL8A 2VCVA 2WRTA 4RI6A 3PPUA 1V98A 4N11A 3ZTLA 4TR3A 2V6KA 1KTEA 4WF5A 1EP7A 1J9BA 2LRTA 3HZ4A 1TRUA 3IAM2 2D2ZA 1O8WA 1SK1A 1J08A 14GSA 3LSZA 3DVXA 3A2XA 1Z6NA 3TKSA 2OE3A 2YWMA 3M1GA 2RM5A 4ZIJA 3C8EA 3HA9A 2H6XA 1X5CA 4OO4A 3F4RA 3QFBC 1Q98A 1EWXA 3LFLA 4OCEA 4CW9A 2CZ3A 2RUFA 4EIQA 5E4WA 2VM1A 1YQ1A 5GAPD 1GTUA 3FZ9A 2G2QA 4ECIA 20GSA 2DKHA 2WDUA 2IWTA 3GKMA 1OE8A 3VPTA 3IBHA 3UIWA 1BYEA 1T7PB 2K8VA 4YKGA 1X9MB 5ECMB 2LEGA 3M0FA 1WOUA 1B9YC 3D21A 5DALA 4YKFA 4I2UA 1R5AA 4IJIA 1SENA 5JCUA 3C1SA 3WGEA 4A5PA 4N0VA 1GLPA 3EU4A 2H0HA 2MYGA 4TR1A 3ERWA 2FA4A 4CHSA 2FWFA 2H8LA 1X5EA 1YDKA 3LXTA 3WYWA 1M9BA 1TK8B 4MZCA 2DJ3A 3TRQA 1PX7A 3ZVJA 3LJRA 3TOUA 5D93A 1DBYA 4OCFA 4BWSA 4GQFA 4N10A 1W4VA 1SYRA 2CVKA 2LJRA 1XW6A 1MDJA 1ERTA 3D22A 4BL7B 3FR9A 4ZBDA 2KP1A 2PUKC 2DBCA 5INYA 1X9SB 1K3LA 1YKCA 3ZFBA 1EV4A 3L9UA 3FEUA 2HSYA 3HKRA 2JADA 1JLVA 4EXJA 1YJ6A 1FW1A 3EE2A 4BA7A 2HNLA 4KA0A 2PGTA 3GRXA 4CDOA 1Z3EA 3IOSA 1JFUA 1QK8A 1XPVA 4GSSA 4FH8A 2A4HA 2B7KA 4ACSA 2YCDA 3C73A 4GCIA 4D73A 2H71A 4V2LA 3D4TA 5G31A 3NZNA 1ZZYA 1O85A 3KMNA 2P5QA 3DD3A 3TUEA 4TW5A 4AJ7A 11GSA 2PN8A 5ABRA 1OC8A 4ZL7A 1SKSB 1M99A 6GSUA 1K0DA 2JU5A 16GSA 2K18A 4IBPA 4L5LA 2MMNA 5FT3A 2VLUA 2M80A 2R3XA 2CAIA 4L0UA 4G0LA 3TKQA 6GSWA 2MMAA 1PSQA 2XHFA 2G0FA 3IHQA 4BVXB 4F82A 2OA7A 4ZL8A 1VF3A 2RIIA 2GLRA 4KAEA 3EVIA 4XS1A 1PRXA 3G7IA 1ZL9A 3R2QA 2B3SA 4WXTA 4LLRA 5KEJA 4EUYA 5F0GA 5LNKe 1JZDA 1PKWA 2KHPA 2NDOA 1FOVA 4OFMA 3RBTA 2LUSA 1J0FA 4TXOB 1S3AA 1K0NA 1F3BA 3VWWA 3FY7A 2FY6A 2GZYA 4MK3A 5D9WA 3FZ5A 5ECHB 4YQVA 1SJIA 4ULXA 2HSMA 3DRNA 3RHBA 5A4VA 2P31A 3FRCA 3LW9A 5IO2A 1GRXA 3BJ5A 2DJKA 2NBSA 2TIRA 3IAS2 3EMXA 1YY7A 3ZFLA 4POLA 1IYIA 5ID2B 3K8NA 5HR3A 2B1LA 2HRNA 2LNSA 5A5KA 1TI1A 3KD0A 4BVYB 1X0RA 1GUMA 1WWJA 4O5QA 2A4VA 5D8IA 4IQ1A 4LL1B 5EPFA 3F3RA 2H74A 1A2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0G A;  4MF5 A;  1SK0 A;  2LQO A;  4MMM A;  1UVZ A;  1PN9 A;  5CYY A;  3F63 A;  4ZB8 A;  3HCZ A;  3GTU B;  1EEM A;  1OKD A;  3LYK A;  1XFL A;  4Z7X A;  2ES7 A;  2DC5 A;  4JED A;  2HZE B;  5ELG A;  2X8C A;  1NSW A;  1XW5 A;  3HVX A;  3PGT A;  4K9Z A;  4X43 A;  3BOA A;  2DIZ A;  1MTC A;  1SL2 B;  3L4N A;  1U6T A;  1M0U A;  5IO0 A;  4HDE A;  2VOC A;  4KDU A;  2L4Q A;  5G5E A;  1EV9 A;  4I6X A;  3QMX A;  1TP9 A;  4XS6 A;  1BJX A;  4XHM A;  3CRU A;  2C0F A;  2O8V B;  5JWQ B;  1GSF A;  3N9J A;  2KUC A;  1GLQ A;  5C00 A;  1WRY A;  2X8G A;  1DSB A;  1F37 A;  2FGX A;  5IIZ A;  3UMA A;  1FB6 A;  5EVO A;  5DCG A;  4PQI A;  2GQK A;  1Z6M A;  2OJL A;  3QPM A;  2H0G A;  3TJK A;  4XTS A;  3GFK A;  2J9H A;  1XVW A;  2EIQ A;  2E2M A;  5F05 A;  3W6G A;  1XWG A;  3QAG A;  2LNT A;  1THX A;  2ON7 A;  4I2T A;  2WS2 A;  1O8X A;  2CQ9 A;  3OR5 A;  1XZO A;  2N5F A;  1LJR A;  2WJU A;  4WR4 A;  3W8J A;  3QCP A;  4ZIL A;  5HR0 A;  4TOP A;  2DIY A;  4YQM A;  2LRC A;  4PNG A;  2PVQ A;  2FD3 A;  1EOH A;  3ED3 A;  3PIN A;  4EVM A;  4GLT A;  2XC2 A;  3KM6 A;  5IOW A;  3G7J A;  5DJL A;  1VF1 A;  2NPB A;  2L5O A;  2H73 A;  1ACV A;  2DSA A;  1BG5 A;  1Z9H A;  4KE3 A;  5LD0 A;  2P0G A;  1SYX A;  2ZCT A;  2CT6 A;  1WPI A;  1GNW A;  3HYP A;  3ZVJ D;  2Z9S A;  2PVO C;  1NHO A;  2EC4 A;  2PPT A;  2VCT A;  1WJK A;  2MZC A;  3DGQ A;  4YQU A;  3MNG A;  17GS A;  2NVL A;  5AIX A;  2HFD A;  3LEF A;  4BL7 A;  3BD2 A;  3UBK A;  5F8B A;  3GUS A;  4DSQ A;  4XRA A;  4F2I A;  4LA1 A;  2V1M A;  5CO3 A;  3HHV A;  1OC9 A;  2H30 A;  2VD0 A;  5IMD A;  2KP2 A;  5J5N A;  1M2A A;  2N5B A;  2C3Q A;  1A23 A;  3DML A;  2FWG A;  1JLW A;  1U88 A;  3D0Z A;  4GRF A;  1A8Y A;  3WD6 A;  2GST A;  3IR4 A;  4OD7 A;  4JR4 A;  2MBT A;  2RLI A;  1SL0 B;  1RW1 A;  5A4W A;  5CRE A;  1A0F A;  2BTO T;  1F6M C;  1LU4 A;  1AUC A;  4KCA A;  2CV4 A;  4MPG A;  3WGD A;  2GT5 A;  3DXB A;  3LYP A;  2ON5 A;  3HZ8 A;  3RDW A;  10GS A;  2XPD A;  1O6J A;  4ML1 A;  3TDG A;  3RPP A;  5IPG A;  2VAF A;  4KX4 A;  1NHY A;  2TRX A;  2JL4 A;  1ERW A;  4Q5Q A;  4V1A g;  2MMZ A;  18GS A;  2EIO A;  5FHI A;  3KP9 A;  3MSZ A;  4PUR A;  4HJ2 A;  2PMT A;  1DE1 A;  3DIE A;  1EOG A;  3F8U A;  1XXU A;  4DSS B;  2GDR A;  4E8E A;  2A2S A;  3VWX A;  1JZR A;  4IKH A;  1M7T A;  4EC0 A;  3APS A;  4EO3 A;  3CSH A;  1Z7P A;  2CX3 A;  5HQP A;  1XWC A;  3ZMK A;  4MAB A;  5DAK A;  2ZUP A;  1WMJ A;  4HS1 A;  1PQN A;  4TXV A;  1S3C A;  2C3N A;  4RQX A;  3FHK A;  3QOU A;  3GX0 A;  5D96 A;  3D6I A;  4F0B A;  3I6A A;  3A5W A;  4AGS A;  2C0E A;  1VRS D;  3GUR A;  4NWY A;  1A2M A;  2I1U A;  1TU8 A;  4PX1 A;  5DCH A;  4ZL9 A;  1EEJ A;  2VLV A;  3MAK A;  3US3 A;  4G10 A;  2H66 A;  2P5R A;  3HVS A;  3EIN A;  2C0G A;  4ZB6 A;  1B48 A;  19GS A;  4V2M A;  3IC4 A;  2B5E A;  4BPY A;  2JSZ A;  1XWB A;  1TK0 B;  2VO4 A;  3G9B A;  5F06 A;  2C4J A;  2LST A;  3IE3 A;  2PWJ A;  1B4P A;  2OE1 A;  1OAZ A;  2B1K A;  3L78 A;  4FO5 A;  4HU9 A;  3FYG A;  3BBY A;  5GAN D;  1AC1 A;  1XVQ A;  1QGV A;  4TKY A;  4DEJ A;  1QQ2 A;  3E3E A;  1K0O A;  4O32 A;  3DYR A;  4ISD A;  3IRA A;  3U6V A;  1G6Y A;  4DVC A;  3DKS A;  2PER A;  1NM3 A;  5AIS A;  2PBJ A;  3GN3 A;  3JCM L;  1X5D A;  1U3A A;  4MP4 A;  2V32 A;  1H4O A;  3LOR A;  2F3M A;  5J3R A;  1PD2 1;  1SJ6 A;  4MJB A;  1K0B A;  1USB A;  1QUW A;  3GV1 A;  5D9X A;  1V57 A;  3I9V 2;  2DMM A;  3ZIJ A;  4MJC A;  3KXO A;  4JU5 A;  1G0T A;  1DUG A;  1A2L A;  3CRT A;  3TRX A;  13GS A;  2PU9 C;  1K0C A;  2HYX A;  1Z7R A;  3KMO A;  4MF7 A;  1TU7 A;  3FZ4 A;  4NHW A;  3F4T A;  4E8H A;  2IFQ B;  4TR0 A;  1M2D A;  3N5O A;  4RQR A;  1SKR B;  3VLN A;  1ZGN A;  4QL9 A;  2YWO A;  2XBQ A;  4HZ2 A;  1OKT A;  5AIV A;  2VIM A;  3Q18 A;  4N30 A;  1G7O A;  5CP1 A;  4KSO A;  3V1W A;  5E59 A;  4GWR A;  4XS4 A;  2V6O A;  4F0C A;  4JBB A;  1OC3 A;  4ZBA A;  3P2A A;  4OWY A;  6GSS A;  2AJQ B;  1PX6 A;  3GMF A;  4HEA 2;  1T1V A;  1PGT A;  3ZIT A;  5CRW A;  4IGJ A;  2YZU A;  4MJA A;  3L0H A;  3VI7 A;  4DSR A;  3LWA A;  4I5Q A;  2F8F A;  6GSY A;  3LQ7 A;  4ECC A;  5L71 A;  3GH6 A;  2VCW A;  4F03 A;  3TKP A;  3GX8 A;  3KZQ A;  2K6V A;  1KNG A;  1U3I A;  2YWI A;  3QR6 A;  3TJG A;  2HXK A;  2KLX A;  3GH9 A;  5DDL A;  1KBN A;  2H19 A;  22GS A;  1XWA A;  2OBK A;  2QGV A;  2YPM A;  1BED A;  3HY2 A;  3APO A;  2C3T A;  3F6D A;  1WIK A;  2IJY A;  3KH9 A;  1XOA A;  3U5R E;  2RM6 A;  5DQY A;  1K0A A;  2RUE A;  3WT1 A;  1GL8 A;  3DVW A;  9GSS A;  2H1D A;  1E2Y A;  1FVJ A;  2NTO A;  4K1F A;  1HYU A;  4I97 A;  4ML6 A;  2VLT A;  4ILF A;  5G30 A;  3M9K A;  1A8L A;  5J9B A;  1GTB A;  3TKR A;  5DAL B;  4EE0 A;  1SD8 A;  3GST A;  5AN1 A;  4Q5F A;  4IP1 A;  4LMV A;  3KGK A;  1FVK A;  1EGO A;  4HOJ A;  3KP8 A;  1T3B A;  1EGR A;  5JWO B;  2BMX A;  3GHA A;  2FNO A;  1GWC A;  2JAC A;  4P3Y B;  3TCO A;  3HD5 A;  5CRG A;  3GKK A;  3ZZX A;  1QXH A;  4MLY A;  1ZOF A;  2CX4 A;  4Q5R A;  1TXX A;  3ZL5 A;  2HE3 A;  2OAD A;  4PQ1 A;  3APQ A;  2B7J A;  1A0R P;  3IV4 A;  5B8B A;  3QAV A;  3H4K A;  1XBS A;  1NW2 A;  5G5F A;  1TTZ A;  2R37 A;  5IMZ A;  3RHC A;  1FAA A;  2H1G A;  1ILO A;  1ABA A;  1Y25 A;  1PKZ A;  3FR6 A;  4O7H A;  2H76 A;  3SBC A;  3HJM A;  3KEB A;  1MDI A;  2X64 A;  2WFC A;  1B4Q A;  1XOB A;  2LJK A;  4IW9 A;  1GUH A;  5ECL B;  4MJE A;  4EL1 A;  3PR8 A;  4K7O A;  1GUK A;  2F9S A;  3O76 A;  3F9U A;  1TRV A;  2IMI A;  3FZA A;  4POB A;  3L9S A;  1B9X C;  5H5R A;  2WB9 A;  1FB0 A;  4V1A p;  2J23 A;  2VL2 C;  5CAX A;  3P90 A;  3TJF A;  3P8W A;  1OYJ A;  3EC3 A;  3KIJ A;  4HQS A;  4D73 B;  1MD4 A;  2YV7 A;  1T8E B;  1KEB A;  1UC7 A;  1URM A;  3F4S A;  3UL3 A;  4ECJ A;  1GSE A;  1X9W B;  4K6X A;  5ECO B;  1ZYE A;  1SU9 A;  3EU3 A;  2CZ2 A;  4NXI A;  2QSI A;  4OFT A;  1YKA A;  2AAW A;  2GGT A;  2HSH A;  2L6C A;  4YAP A;  1R4W A;  1S3D A;  2OAC A;  1TRS A;  3C7M A;  2M72 A;  1AQW A;  4F9Z A;  4J2F A;  1XWK A;  3UVH A;  3F0I A;  3GYK A;  1GTA A;  1T4Z A;  2YV9 A;  4ZBB A;  3TKS C;  4OMV A;  3G7Y A;  4PUA A;  2L59 A;  3QAW A;  4O92 A;  5IQY A;  2JZT A;  2MMO A;  1AXD A;  2GSR A;  4MF6 A;  4ZXG A;  5B6N A;  8GSS A;  2X8H A;  4IQA A;  1YF0 A;  3BCK A;  4KDY A;  1T00 A;  5J41 A;  2GT6 A;  4KGI A;  3W8S A;  5H5S A;  3H1N A;  4PGT A;  4NPB A;  4YAV A;  3VPQ A;  1HQO A;  3D4M A;  3O6T A;  5D73 A;  2O7K A;  2C80 A;  1Z5Y E;  5LCZ A;  1FHE A;  1F9M A;  1RK4 A;  3LG6 A;  2L57 A;  3WT2 A;  2A2R A;  1V2A A;  6GSV A;  1R7H A;  5IMV A;  5IPH A;  4MPF A;  3FK8 A;  2VD1 A;  5KN3 A;  3VWV A;  4TVE A;  2H1B A;  2F8A A;  2H1A A;  2WZ9 A;  4EKZ A;  2GSS A;  3EYT A;  1GH2 A;  3EUR A;  3QD9 A;  2HLS A;  5G1L A;  1WE0 A;  3H8Q A;  5EY6 A;  2GQM A;  2LS5 A;  5GSS A;  2VCQ A;  3E0U A;  2IFQ A;  1UA5 A;  3GL5 A;  4NAX A;  2LTK A;  2IME A;  6GSX A;  3J7Y k;  3VI5 A;  12GS A;  3CXG A;  2MBS A;  1VF4 A;  1VGL A;  3IDV A;  2FLS A;  5H5Q A;  4PNF A;  2R5G A;  5ECK B;  1ZCP A;  1QMV A;  2QKE A;  4K0N A;  1V40 A;  3H79 A;  4NV5 A;  2JSY A;  1TI3 A;  1K3O A;  2FCH A;  1K0M A;  4BVX A;  2R2J A;  5AGY A;  4PXO A;  4WR5 A;  4K8M A;  4BWQ A;  5ENU A;  2F51 A;  5COH A;  2OE0 A;  4MZB A;  3TOT A;  4IN0 A;  1M2B A;  3PH9 A;  4J57 E;  1RQM A;  1ML6 A;  4LL4 B;  5ECR B;  1AQV A;  1FG4 A;  2K8S A;  3TKS E;  4N0Z A;  4TXO A;  4HUA A;  3Q19 A;  3UEM A;  3HDC A;  1EZK A;  3AY8 A;  1HNA A;  4PUF C;  1I9D A;  5GST A;  3VFI A;  4GXZ A;  4TR4 A;  2R4V A;  5JCW A;  4WET A;  1BAY A;  4QL7 A;  1XCC A;  5J4U A;  3CBU A;  3DEX A;  2H01 A;  1GNE A;  1M9A A;  4HU7 A;  2VCZ A;  2AB6 A;  1GSU A;  3IK9 A;  4EDY A;  4FIW A;  2YJ7 A;  5ID2 A;  3UAP A;  4EF0 A;  1BX9 A;  1V9W A;  3MDK A;  4FYC A;  4BVY A;  5IMA A;  2H72 A;  5IM9 A;  2AV4 A;  2B5Y A;  1AIU A;  1TK5 B;  2JZS A;  2VL3 A;  3CMI A;  3F3Q A;  4HI7 A;  2AUV A;  1WP0 A;  3VWU A;  4G9H A;  4NMU A;  4Q5N A;  3C1R A;  2L4C A;  4KH7 A;  4L5O A;  4GF0 A;  1ON4 A;  2KOK A;  3WGX A;  2DML A;  5HFI A;  5D9T A;  2FHE A;  1HNB A;  2HRF A;  3IA1 A;  2DJ2 A;  2O85 A;  1E6B A;  3GTU A;  5ECI B;  5C04 A;  1XW9 A;  1GP1 A;  2H70 A;  2XBI A;  5DVB A;  1AW9 A;  4MA9 A;  4POM A;  2LQQ A;  2HZE A;  4GST A;  1MD3 A;  2FA8 A;  3S9F A;  2OBI A;  2QC7 A;  3I43 A;  2VM2 A;  4MH2 A;  2GVP A;  2DLX A;  2HI7 A;  2GSQ A;  1JZW A;  3H93 A;  4G2E A;  4WKW A;  2FWE A;  3GSS A;  3BCI A;  2H0I A;  5J9C A;  1OVN A;  1OC9 B;  2C1Y A;  5DQS A;  5IMC A;  2L5L A;  3RPN A;  2JZR A;  2GZP A;  3UVT A;  5ELA A;  2I4A A;  4LMW A;  2B5X A;  4JR6 A;  4HQZ A;  2YNX A;  1ST9 A;  5B6M A;  6GST A;  2DJ1 A;  1PA3 A;  1Y6E A;  2FWH A;  2GTU A;  3A3T A;  3QFA C;  1OE7 A;  3CSJ A;  1VF2 A;  4K7I A;  3NIV A;  5ECP B;  1YF1 A;  1YEX A;  1HNC A;  3LGC A;  4QQ7 A;  3HJP A;  5CRD A;  3KJY A;  1SL1 B;  4G19 A;  2AHE A;  2YN1 A;  1CQH A;  3GKX A;  4XCS A;  4JZQ A;  2K9F A;  4EDZ A;  4KW6 A;  2GS3 A;  5IMF A;  1CQG A;  2GQL A;  3SWL A;  1ZYQ B;  3UBL A;  3FR3 A;  3ME8 A;  1XIY A;  2IIY A;  5HR1 A;  1DE2 A;  4RI7 A;  2HZF A;  4NV2 A;  3E9J B;  5DJM A;  4XRD A;  2LRN A;  5FWG A;  4J56 E;  3GA4 A;  1SJZ A;  1GSQ A;  1N2A A;  1O73 A;  1G6W A;  4X0X A;  4JE1 A;  5G1K A;  3CSI A;  2AYT A;  4KDX A;  5DAK B;  3IPZ A;  4TRX A;  3HXS A;  4JRR A;  5B8A A;  2IL3 A;  4GQC A;  3EWL A;  1O7U A;  1GUL A;  4OO5 A;  2B6M A;  3ZML A;  3I69 A;  2C0D A;  1HD2 A;  2I9H A;  4AJ6 A;  3KTB A;  3UJ1 A;  1H75 A;  4MCU A;  2E7P A;  4GTU A;  1O81 A;  4IEL A;  4K2D A;  3GKN A;  1N8J A;  1PL1 A;  4KUN A;  4TR1 B;  1MEK A;  1F3A A;  2R6K A;  5HFK A;  2VCX A;  1TJD A;  2YAN A;  3NOF A;  2IPA A;  4KB3 A;  5KN1 A;  1YZX A;  4OFN A;  3ZYW A;  5B7C A;  1GSD A;  5ECQ B;  3GL3 A;  2YP6 A;  1AQX A;  2V2G A;  5JWR B;  3F6F A;  3KCM A;  3ERG A;  3GIX A;  3KTL A;  3QDN A;  4ZB9 A;  4WBR D;  1IYH A;  1PMT A;  3ISO A;  1B8X A;  5HFG A;  3TB2 A;  3DWV A;  1ERU A;  1TKD B;  3ZIV A;  1GSS A;  1W89 A;  2H6Z A;  3CYN A;  5G2Z A;  3TGZ A;  2DJJ A;  3C71 A;  5A4U A;  3HJO A;  2BJX A;  1K3Y A;  2WGR A;  5IOX A;  3FKF A;  4TN8 A;  4L0W A;  2YWN A;  2CA8 A;  4IVF A;  2YOI A;  4FYU A;  3CTF A;  2YZH A;  4RUV A;  1GSY A;  4O5R A;  4KSM A;  2ZNM A;  1JZO A;  1UN2 A;  2X99 A;  4DSS A;  3M3M A;  3ERF A;  2IN3 A;  1BQ7 A;  4V2N A;  4FYB A;  3UOM A;  2V41 A;  1TW9 A;  2CVB A;  4WEY A;  1TRW A;  1GTI A;  4WBJ A;  1JHB A;  2DJ0 A;  5D9V A;  2EIR A;  4IP6 A;  2I3Y A;  4KCE A;  5ECS A;  3EMP A;  2H75 A;  3A2V A;  1R5P A;  1G7E A;  1A24 A;  1R26 A;  5CRH A;  1I5G A;  2C8U A;  2OKA A;  4L8E A;  2TRC P;  3P7X A;  3LXZ A;  1SK2 A;  2VL9 A;  3O3T A;  1QFN A;  5GZZ B;  3Q6O A;  4K7N A;  1C72 A;  1TOF A;  1FO5 A;  3ME7 A;  4MZW A;  1EP8 A;  2WUL A;  2L6D A;  2ALB A;  1MDK A;  2XPE A;  4XS4 B;  3M9J A;  3L9V A;  1U87 A;  1ZMA A;  4HJM A;  2IMF A;  3J7Y b;  4WF4 A;  1LBK A;  4NHZ A;  4IJ3 A;  1V58 A;  4H86 A;  2I81 A;  2VUP A;  4IHU A;  3TRP A;  3GNJ A;  2LJA A;  3TJJ A;  5DBQ A;  4I8B A;  2WCI A;  5HR2 A;  2FUG 2;  4POK A;  2IMK A;  3M8N A;  4YH2 A;  3Q74 A;  1Q4J A;  4ID0 A;  3ZLP A;  2E0Q A;  5KN2 A;  4MDC A;  4X1U A;  2YJH A;  3ZRE A;  4KND A;  2LV3 A;  1AAZ A;  1SD9 A;  5KN0 A;  3MWH A;  5F07 A;  1THO A;  1F2E A;  2N5A A;  3IK7 A;  3A2W A;  3IXR A;  2GZZ A;  2CAQ A;  1PL2 A;  5JCG A;  5ECN B;  3D5J A;  3ZRD A;  4HZ4 A;  2HT9 A;  1T4Y A;  2H6Y A;  2O87 A;  3HVV A;  3RAZ A;  2VL2 A;  1SKW B;  7GSS A;  2REM A;  5CNW A;  2IMD A;  4GSN A;  4AJ8 A;  3TJB A;  1YEP A;  3VUR A;  2CVD A;  4IS0 A;  1TDI A;  1ERV A;  4MH3 A;  4AF2 A;  3KH7 A;  3UAR A;  2M46 A;  3FW2 A;  2LKU A;  3VK9 A;  4ECB A;  2O89 A;  4PQH A;  3CTG A;  2E2G A;  4XIH A;  5EL8 A;  2VCV A;  2WRT A;  4RI6 A;  1V98 A;  4N11 A;  3ZTL A;  4TR3 A;  2V6K A;  1KTE A;  4WF5 A;  1EP7 A;  1J9B A;  2LRT A;  3HZ4 A;  1TRU A;  3IAM 2;  2D2Z A;  1O8W A;  1SK1 A;  1J08 A;  14GS A;  3LSZ A;  3DVX A;  3A2X A;  1Z6N A;  3TKS A;  2OE3 A;  2YWM A;  3M1G A;  2RM5 A;  4ZIJ A;  3C8E A;  3HA9 A;  2H6X A;  1X5C A;  4OO4 A;  3F4R A;  3QFB C;  1Q98 A;  1EWX A;  3LFL A;  4OCE A;  4CW9 A;  2CZ3 A;  2RUF A;  5E4W A;  2VM1 A;  1YQ1 A;  5GAP D;  1GTU A;  3FZ9 A;  2G2Q A;  4ECI A;  20GS A;  2WDU A;  2IWT A;  3GKM A;  1OE8 A;  3VPT A;  3IBH A;  3UIW A;  1BYE A;  1T7P B;  2K8V A;  1X9M B;  5ECM B;  2LEG A;  3M0F A;  1WOU A;  1B9Y C;  3D21 A;  5DAL A;  4I2U A;  1R5A A;  4IJI A;  1SEN A;  5JCU A;  3C1S A;  3WGE A;  4N0V A;  1GLP A;  3EU4 A;  2H0H A;  2MYG A;  4TR1 A;  3ERW A;  2FA4 A;  4CHS A;  2FWF A;  2H8L A;  1X5E A;  1YDK A;  3LXT A;  3WYW A;  1M9B A;  1TK8 B;  4MZC A;  2DJ3 A;  3TRQ A;  1PX7 A;  3ZVJ A;  3LJR A;  3TOU A;  5D93 A;  1DBY A;  4OCF A;  4BWS A;  4GQF A;  4N10 A;  1W4V A;  1SYR A;  2CVK A;  2LJR A;  1XW6 A;  1MDJ A;  1ERT A;  3D22 A;  3FR9 A;  4ZBD A;  2KP1 A;  2PUK C;  2DBC A;  5INY A;  1X9S B;  1K3L A;  1YKC A;  3ZFB A;  1EV4 A;  3L9U A;  3FEU A;  2HSY A;  3HKR A;  2JAD A;  1JLV A;  4EXJ A;  1YJ6 A;  1FW1 A;  3EE2 A;  4BA7 A;  2HNL A;  4KA0 A;  2PGT A;  3GRX A;  4CDO A;  1Z3E A;  3IOS A;  1JFU A;  1QK8 A;  1XPV A;  4GSS A;  4FH8 A;  2B7K A;  4ACS A;  2YCD A;  3C73 A;  4GCI A;  4D73 A;  2H71 A;  4V2L A;  3D4T A;  5G31 A;  3NZN A;  1ZZY A;  1O85 A;  3KMN A;  2P5Q A;  3DD3 A;  3TUE A;  4TW5 A;  4AJ7 A;  11GS A;  2PN8 A;  5ABR A;  1OC8 A;  4ZL7 A;  1SKS B;  1M99 A;  6GSU A;  1K0D A;  2JU5 A;  16GS A;  2K18 A;  4IBP A;  4L5L A;  2MMN A;  5FT3 A;  2VLU A;  2M80 A;  2R3X A;  2CAI A;  4L0U A;  3TKQ A;  6GSW A;  2MMA A;  1PSQ A;  2XHF A;  2G0F A;  3IHQ A;  4F82 A;  2OA7 A;  4ZL8 A;  1VF3 A;  2RII A;  2GLR A;  4KAE A;  3EVI A;  4XS1 A;  1PRX A;  3G7I A;  1ZL9 A;  3R2Q A;  2B3S A;  4WXT A;  4LLR A;  5KEJ A;  4EUY A;  5F0G A;  5LNK e;  1JZD A;  1PKW A;  2KHP A;  2NDO A;  1FOV A;  4OFM A;  3RBT A;  2LUS A;  1J0F A;  4TXO B;  1S3A A;  1K0N A;  1F3B A;  3VWW A;  3FY7 A;  2FY6 A;  2GZY A;  4MK3 A;  5D9W A;  3FZ5 A;  5ECH B;  4YQV A;  1SJI A;  4ULX A;  3DRN A;  3RHB A;  5A4V A;  2P31 A;  3FRC A;  5IO2 A;  1GRX A;  3BJ5 A;  2DJK A;  2NBS A;  2TIR A;  3IAS 2;  3EMX A;  1YY7 A;  3ZFL A;  4POL A;  1IYI A;  5ID2 B;  3K8N A;  5HR3 A;  2B1L A;  2HRN A;  2LNS A;  5A5K A;  1TI1 A;  3KD0 A;  1X0R A;  1GUM A;  1WWJ A;  2A4V A;  5D8I A;  4IQ1 A;  4LL1 B;  5EPF A;  3F3R A;  2H74 A;  1A2J A; 
#chains in the Genus database with same CATH topology
 4K0G A;  4PTS A;  4MF5 A;  1SK0 A;  2LQO A;  4MMM A;  2CNR A;  1UVZ A;  1PN9 A;  2PEO A;  5CYY A;  3F63 A;  4ZB8 A;  3HCZ A;  2PEI A;  3GTU B;  1EEM A;  1OKD A;  4DG9 A;  3LYK A;  1XFL A;  4X4J A;  4Z7X A;  2JYG A;  2ES7 A;  2DC5 A;  4JED A;  2HZE B;  5ELG A;  2X8C A;  1NSW A;  1XW5 A;  3HVX A;  3PGT A;  2P9X A;  4K9Z A;  4X43 A;  3BOA A;  2DIZ A;  1MTC A;  1SL2 B;  1M6E X;  2NO8 A;  3L4N A;  1U6T A;  1M0U A;  5IO0 A;  4HDE A;  4IZ6 A;  3Q20 A;  2VOC A;  4KDU A;  2L4Q A;  1Q82 Q;  5G5E A;  1EV9 A;  4I6X A;  1KC8 Q;  3QMX A;  1TP9 A;  4XS6 A;  1BJX A;  4XHM A;  3CRU A;  2C0F A;  2O8V B;  5JWQ B;  1K9M Q;  2QA2 A;  1GSF A;  3N9J A;  2KUC A;  1GLQ A;  5C00 A;  1WRY A;  2X8G A;  1DSB A;  1F37 A;  2FGX A;  4CY8 A;  5IIZ A;  3UMA A;  1FB6 A;  5EVO A;  5DCG A;  4PQI A;  2GQK A;  1Z6M A;  2OJL A;  3QPM A;  4CA3 A;  2H0G A;  3TJK A;  4XTS A;  3GFK A;  3FMW A;  2J9H A;  1EOQ A;  1XVW A;  2LPK A;  2LKI A;  2VSQ A;  2EIQ A;  2E2M A;  5F05 A;  3W6G A;  1RO2 A;  1XWG A;  1ACP A;  3QAG A;  2KGD A;  2LNT A;  1THX A;  2ON7 A;  4ICY A;  4I2T A;  2WS2 A;  5EJD A;  1O8X A;  2CQ9 A;  3OR5 A;  1XZO A;  2N5F A;  1YHQ P;  1LJR A;  2WJU A;  4WR4 A;  3W8J A;  3CXC O;  3QCP A;  4ZIL A;  5HR0 A;  2ERH A;  4FQU A;  4TOP A;  2DIY A;  4YQM A;  2LRC A;  2AF8 A;  4PNG A;  2PVQ A;  2FD3 A;  5HGM A;  1EOH A;  3ED3 A;  3PIN A;  4EVM A;  4GLT A;  2XC2 A;  3KM6 A;  5IOW A;  3G7J A;  2K5X A;  5DJL A;  1VF1 A;  5I4T G;  3DPH A;  2NPB A;  2L5O A;  2H73 A;  1ACV A;  2DSA A;  1BG5 A;  1Z9H A;  4KE3 A;  5LD0 A;  2P0G A;  1SYX A;  2ZCT A;  2CT6 A;  1WPI A;  1GNW A;  3HYP A;  3ZVJ D;  1BXI A;  2Z9S A;  2PVO C;  1NHO A;  2EC4 A;  2PPT A;  2VCT A;  1WJK A;  2MZC A;  3DGQ A;  4YQU A;  3MNG A;  17GS A;  2NVL A;  4PH1 A;  4PXH B;  5AIX A;  2HFD A;  1VQN P;  3LRY A;  2X49 A;  3LEF A;  1ZMB A;  4BL7 A;  2ROQ A;  3BD2 A;  3UBK A;  5F8B A;  2LL8 A;  3E2D A;  3GUS A;  4DSQ A;  4XRA A;  4F2I A;  1EMV A;  4LA1 A;  2V1M A;  5CO3 A;  3HHV A;  1OC9 A;  2FVA A;  2H30 A;  2VD0 A;  5IMD A;  2KP2 A;  5J5N A;  1M2A A;  2N5B A;  4G0I A;  1F80 D;  2C3Q A;  1A23 A;  3DML A;  2FWG A;  1JLW A;  1U88 A;  3D0Z A;  4GRF A;  2KOD A;  2OAR A;  1A8Y A;  3WD6 A;  2JU2 A;  2GST A;  3IR4 A;  4OD7 A;  2X4A A;  4JR4 A;  2MBT A;  2RLI A;  1SL0 B;  1RW1 A;  5A4W A;  5CRE A;  1A0F A;  2BTO T;  1F6M C;  1LU4 A;  1AUC A;  4KCA A;  2CV4 A;  4MPG A;  3WGD A;  2GT5 A;  3DXB A;  3LYP A;  2X2B A;  2ON5 A;  3HZ8 A;  3RDW A;  3G71 P;  10GS A;  2XPD A;  1O6J A;  4ML1 A;  3TDG A;  3RPP A;  5IPG A;  2VAF A;  4KX4 A;  1NHY A;  2TRX A;  2JL4 A;  2Z44 A;  1ERW A;  4O5U A;  4Q5Q A;  4V1A g;  2MMZ A;  18GS A;  2EIO A;  5FHI A;  3KP9 A;  3MSZ A;  4PUR A;  3MIX A;  2PMT A;  4HJ2 A;  2MR8 A;  1DE1 A;  3DIE A;  1EOG A;  3F8U A;  1XXU A;  4DSS B;  2GDR A;  4E8E A;  2A2S A;  3VWX A;  1JZR A;  4IKH A;  4XFZ A;  1M7T A;  4USS A;  3APS A;  4EC0 A;  4EO3 A;  3CSH A;  1Z7P A;  5HGN A;  2CX3 A;  5HQP A;  1XWC A;  3H47 A;  3ZMK A;  3GKL C;  2L22 A;  3WBH A;  3G1I A;  4MAB A;  5DAK A;  2ZUP A;  1WMJ A;  4HS1 A;  4HSC X;  1PQN A;  4TXV A;  3CCE P;  1S3C A;  2C3N A;  4RQX A;  3FHK A;  3QOU A;  3GX0 A;  5D96 A;  3D6I A;  4F0B A;  3I6A A;  3A5W A;  4AGS A;  2QA1 A;  2C0E A;  1VRS D;  3GUR A;  3HZQ A;  4NWY A;  1A2M A;  2I1U A;  1TU8 A;  4PX1 A;  5DCH A;  4ZL9 A;  1EEJ A;  2VLV A;  3MAK A;  3US3 A;  4G10 A;  2LIW A;  3RG2 A;  2H66 A;  4COC A;  2P5R A;  3HVS A;  2JBG A;  1W2B O;  3EIN A;  2K0Y A;  1D1D A;  2C0G A;  4ZB6 A;  1B48 A;  2LTE A;  19GS A;  1OR5 A;  1UJZ A;  4V2M A;  1IMQ A;  3IC4 A;  2B5E A;  4BPY A;  4XRQ A;  2JSZ A;  1XWB A;  1TK0 B;  2VO4 A;  3G9B A;  5F06 A;  2GDY A;  2K94 A;  2C4J A;  2LST A;  3IE3 A;  2PWJ A;  1B4P A;  2OE1 A;  1OAZ A;  2B1K A;  2JYL A;  3L78 A;  4FO5 A;  4HU9 A;  2XV6 A;  3FYG A;  1XG8 A;  3BBY A;  5GAN D;  1AC1 A;  1XVQ A;  1QGV A;  3I56 P;  5KP7 B;  4TKY A;  4DEJ A;  1QQ2 A;  3E3E A;  1K0O A;  4O32 A;  2KGA A;  3DYR A;  4ISD A;  3IRA A;  1FOH A;  3U6V A;  1G6Y A;  4DVC A;  3DKS A;  2PER A;  1NM3 A;  5AIS A;  2PBJ A;  3GN3 A;  3JCM L;  1X5D A;  1U3A A;  4MP4 A;  2V32 A;  1H4O A;  3LOR A;  2F3M A;  5J3R A;  1PD2 1;  1SJ6 A;  4MJB A;  1K0B A;  1USB A;  1QUW A;  2CG5 B;  3GV1 A;  5D9X A;  1V57 A;  3I9V 2;  1VQL P;  2DMM A;  2LIU A;  3ZIJ A;  4MJC A;  1AF8 A;  3KXO A;  4JU5 A;  1L0H A;  1G0T A;  1DUG A;  1A2L A;  2N6Z A;  3CRT A;  3TRX A;  13GS A;  2AFE A;  2PU9 C;  1K0C A;  2HYX A;  1Z7R A;  3KMO A;  4MF7 A;  1ZNV A;  1TU7 A;  3FZ4 A;  4NHW A;  3F4T A;  4E8H A;  2IFQ B;  4TR0 A;  1M2D A;  3N5O A;  4RQR A;  1SKR B;  2FAC A;  3VLN A;  3CC2 P;  2HRK A;  1ZGN A;  4QL9 A;  2YWO A;  2XBQ A;  4HZ2 A;  1OKT A;  3NTE A;  5AIV A;  2VIM A;  3Q18 A;  4N30 A;  1G7O A;  5CP1 A;  4KSO A;  3V1W A;  5E59 A;  2GZF A;  3OW2 O;  4GWR A;  4XS4 A;  2V6O A;  4F0C A;  4JBB A;  1OC3 A;  4ZBA A;  2FQ0 A;  3P2A A;  4OWY A;  6GSS A;  2AJQ B;  1PX6 A;  3GMF A;  4HEA 2;  3CCJ P;  1PGT A;  1T1V A;  3ZIT A;  2FHS C;  5CRW A;  4IGJ A;  2YZU A;  4MJA A;  3L0H A;  1M1K Q;  3VI7 A;  4DSR A;  3GJN A;  3LWA A;  4I5Q A;  2F8F A;  6GSY A;  3M1M A;  4G0K A;  3LQ7 A;  4ECC A;  5L71 A;  3GH6 A;  2VCW A;  4F03 A;  3TKP A;  3GX8 A;  3KZQ A;  2K6V A;  1KNG A;  4PWV B;  1YJN P;  1U3I A;  2YWI A;  3QR6 A;  2PNG A;  3TJG A;  3CC4 P;  4F37 A;  2HXK A;  2KLX A;  3GH9 A;  2OBK A;  1KBN A;  2H19 A;  22GS A;  1XWA A;  2QGV A;  2YPM A;  5DDL A;  1BED A;  3HY2 A;  3APO A;  2VLO A;  2C3T A;  3F6D A;  1WIK A;  2IJY A;  3KH9 A;  1XOA A;  3G29 A;  3U5R E;  2RM6 A;  5DQY A;  1K0A A;  2RUE A;  3WT1 A;  3EJE A;  1GL8 A;  3DVW A;  9GSS A;  2H1D A;  1E2Y A;  1FVJ A;  2NTO A;  4K1F A;  1HYU A;  4I97 A;  4ML6 A;  2VLT A;  4ILF A;  5G30 A;  3M9K A;  4KF9 A;  1A8L A;  5J9B A;  1GTB A;  3TKR A;  5DAL B;  4EE0 A;  2M5R A;  1SD8 A;  3GST A;  5AN1 A;  4Q5F A;  4IP1 A;  4LMV A;  3KGK A;  1FVK A;  1EGO A;  4HOJ A;  3KP8 A;  1T3B A;  1EGR A;  5JWO B;  2BMX A;  3GHA A;  2FNO A;  1Q81 Q;  1GWC A;  2JAC A;  2GYK A;  4P3Y B;  3TCO A;  4EIP A;  3HD5 A;  5CRG A;  3A5I A;  3GKK A;  3ZZX A;  1QXH A;  4MLY A;  1ZOF A;  2CX4 A;  4GR6 A;  4Q5R A;  1TXX A;  3ZL5 A;  2HE3 A;  2OAD A;  4PQ1 A;  3APQ A;  2B7J A;  1A0R P;  1S3R A;  3IV4 A;  4BIK A;  5B8B A;  3QAV A;  3H4K A;  1VQO P;  3DS0 A;  5CZD B;  1XBS A;  1NW2 A;  5G5F A;  1TTZ A;  2R37 A;  5IMZ A;  3RHC A;  1FAA A;  1AYI A;  2H1G A;  1ILO A;  1ABA A;  1Y25 A;  1PKZ A;  3FR6 A;  4O7H A;  2H76 A;  3SBC A;  3HJM A;  3KEB A;  1MDI A;  2X64 A;  2WFC A;  1B4Q A;  1XOB A;  3G28 A;  3G6E P;  2LJK A;  4IW9 A;  4COP A;  1GUH A;  2MR7 A;  5ECL B;  4K2X A;  4MJE A;  4EL1 A;  2KGE A;  3PR8 A;  2DKI A;  1DNY A;  4K7O A;  1GUK A;  2F9S A;  1GXG A;  3O76 A;  3F9U A;  1TRV A;  2IMI A;  3FZA A;  4POB A;  3L9S A;  4UHP B;  1B9X C;  5H5R A;  2WB9 A;  1FB0 A;  4V1A p;  1VQ7 P;  2J23 A;  1E0H A;  5F2N A;  2VL2 C;  5CAX A;  3P90 A;  2XT1 A;  3TJF A;  3P8W A;  1OYJ A;  3EC3 A;  3KIJ A;  4HQS A;  4D73 B;  5BS1 A;  1MD4 A;  2YV7 A;  4GR2 A;  1T8E B;  5KP6 B;  2MF4 A;  1M3J A;  4Z2U A;  1KEB A;  1UC7 A;  1URM A;  3F4S A;  3UL3 A;  4ECJ A;  1GSE A;  1PN0 A;  1X9W B;  1AUM A;  1JJ2 O;  4K6X A;  5ECO B;  2EG5 A;  2ONT A;  2XZ1 C;  1ZYE A;  1SU9 A;  3EU3 A;  3CQF A;  2CZ2 A;  4NXI A;  2QSI A;  4BPG A;  4OFT A;  1YKA A;  2AAW A;  2GGT A;  2HSH A;  2L6C A;  4YAP A;  5HGL A;  1R4W A;  1S3D A;  2OAC A;  1TRS A;  3C7M A;  2M72 A;  1AQW A;  2PEQ A;  4F9Z A;  4J2F A;  1XWK A;  3UVH A;  3F0I A;  3GYK A;  1GTA A;  1T4Z A;  2YV9 A;  4ZBB A;  3TKS C;  7CEI A;  4OMV A;  1VQ6 P;  3G7Y A;  5BS2 A;  4PUA A;  2K92 A;  2L59 A;  2MY5 A;  3QAW A;  4O92 A;  4U0E A;  5IQY A;  1L0I A;  2JZT A;  2MMO A;  1AXD A;  2GSR A;  4MF6 A;  4ZXG A;  5B6N A;  8GSS A;  2X8H A;  3CCU P;  4IQA A;  2FVF A;  2GZJ A;  3H0D A;  2AFD A;  1YF0 A;  3BCK A;  4KDY A;  1T00 A;  4Z2T A;  5J41 A;  5DCK A;  2BHV A;  2GT6 A;  4KGI A;  1FR2 A;  3W8S A;  5H5S A;  4M0I A;  5KOW A;  3H1N A;  4PGT A;  1KD1 Q;  4NPB A;  4YAV A;  3VPQ A;  1HQO A;  3D4M A;  3O6T A;  5D73 A;  2O7K A;  2C80 A;  1Z5Y E;  5LCZ A;  4XFX A;  1FHE A;  1F9M A;  1RK4 A;  3LG6 A;  2L57 A;  2N5H A;  3WT2 A;  2A2R A;  1V2A A;  6GSV A;  1R7H A;  5IMV A;  5IPH A;  2VLN A;  4MPF A;  3FK8 A;  3RG6 C;  2VD1 A;  5KN3 A;  2K2Q A;  3VWV A;  2KWL A;  1NQ4 A;  2JB0 A;  4TVE A;  2H1B A;  1VQM P;  2F8A A;  2H1A A;  2WZ9 A;  4CY6 A;  4EKZ A;  2GSS A;  3EYT A;  1GH2 A;  3EUR A;  3QD9 A;  2HLS A;  2PEJ A;  5G1L A;  1WE0 A;  3H8Q A;  5EY6 A;  2GQM A;  2LS5 A;  5GSS A;  2KOQ A;  2VCQ A;  3E0U A;  2IFQ A;  1UA5 A;  2KG9 A;  3GL5 A;  4NAX A;  2LTK A;  2IME A;  6GSX A;  3J7Y k;  3VI5 A;  12GS A;  3CXG A;  2MBS A;  1VF4 A;  1VGL A;  3IDV A;  1ZYN A;  2FLS A;  5H5Q A;  1Q7Y Q;  4PNF A;  2R5G A;  5ECK B;  1ZCP A;  1QMV A;  1QVG O;  2QKE A;  4K0N A;  1V40 A;  4MNN A;  3H79 A;  4NV5 A;  3EJD A;  2JSY A;  4MRT C;  1TI3 A;  1K3O A;  2FCH A;  3HYB A;  1K0M A;  4BVX A;  2R2J A;  5AGY A;  4PXO A;  4WR5 A;  4K8M A;  4BWQ A;  4H2X C;  5ENU A;  2F51 A;  5COH A;  2OE0 A;  4MZB A;  3TOT A;  4R0M A;  4IN0 A;  1M2B A;  3PH9 A;  4J57 E;  1RQM A;  1ML6 A;  4LL4 B;  5ECR B;  1AQV A;  1FG4 A;  2DNW A;  2K8S A;  3TKS E;  4N0Z A;  4TXO A;  4HUA A;  3Q19 A;  2KOS A;  3CCV P;  1NJI Q;  3UEM A;  3HDC A;  2EHT A;  1EZK A;  3AY8 A;  1HNA A;  4PUF C;  1I9D A;  5GST A;  3VFI A;  4GXZ A;  4TR4 A;  1VQ4 P;  2R4V A;  5JCW A;  4WET A;  1BAY A;  4QL7 A;  1XCC A;  5J4U A;  3CBU A;  3DEX A;  2H01 A;  2M8N A;  2LOL A;  2PEN A;  5HV8 A;  1GNE A;  1M9A A;  3EJB A;  4HU7 A;  2VCZ A;  2AB6 A;  1GSU A;  3IK9 A;  4EDY A;  4FIW A;  2YJ7 A;  5ID2 A;  3UAP A;  4EF0 A;  1BX9 A;  1V9W A;  2JGP A;  3MDK A;  4FYC A;  1VKU A;  4BVY A;  5IMA A;  2H72 A;  5IM9 A;  2AV4 A;  2B5Y A;  1AIU A;  1TK5 B;  2JZS A;  2VL3 A;  3CMI A;  3F3Q A;  4HI7 A;  2AUV A;  1WP0 A;  3VWU A;  4G9H A;  4NMU A;  4Q5N A;  3C1R A;  2L4C A;  4KH7 A;  1S72 P;  4L5O A;  4GF0 A;  2E1M A;  1ON4 A;  2KOK A;  3CD6 P;  1YIJ P;  3WGX A;  2DML A;  5HFI A;  5D9T A;  2FHE A;  1HNB A;  2XXM A;  2HRF A;  3IA1 A;  2DJ2 A;  2O85 A;  1E6B A;  3GTU A;  5ECI B;  4U0A A;  5C04 A;  1XW9 A;  1GP1 A;  2K93 A;  2H70 A;  2XBI A;  5DVB A;  1AW9 A;  4MA9 A;  4POM A;  2LQQ A;  2HZE A;  4GST A;  1MD3 A;  2FA8 A;  3S9F A;  2OBI A;  2QC7 A;  3LMO A;  3I43 A;  2VM2 A;  4MH2 A;  2GVP A;  2DLX A;  2HI7 A;  2GSQ A;  1JZW A;  3H93 A;  4G2E A;  4WKW A;  2FWE A;  3GSS A;  3BCI A;  2H0I A;  5J9C A;  1OVN A;  1OC9 B;  2C1Y A;  5DQS A;  1VQ9 P;  5IMC A;  3G0V A;  2L5L A;  2R0G A;  3RPN A;  3DTJ A;  2JZR A;  2GZP A;  3UVT A;  5ELA A;  2I4A A;  4LMW A;  5JPA A;  2B5X A;  2MVU A;  4QNB A;  4JR6 A;  4HQZ A;  4XFY A;  2YNX A;  2EFJ A;  1ST9 A;  2BUO A;  5B6M A;  6GST A;  2DJ1 A;  1PA3 A;  1Y6E A;  2LF4 A;  2FWH A;  2GTU A;  3A3T A;  3QFA C;  1OE7 A;  3CSJ A;  2KG6 A;  1VF2 A;  4K7I A;  3NIV A;  5ECP B;  1YF1 A;  1YEX A;  1HNC A;  3LGC A;  4QQ7 A;  3HJP A;  5CRD A;  2KOR A;  3KJY A;  1SL1 B;  4G19 A;  2AHE A;  2YN1 A;  1CQH A;  2Z46 A;  4U0F A;  3GKX A;  1YI2 P;  4BPH A;  4XCS A;  4JZQ A;  2K9F A;  4EDZ A;  4KW6 A;  2GDW A;  2GS3 A;  5IMF A;  2L9F A;  1CQG A;  2M8L A;  2GQL A;  3SWL A;  1ZYQ B;  3UBL A;  3FR3 A;  3ME8 A;  1XIY A;  2IIY A;  5HR1 A;  2UZ8 A;  1DE2 A;  4RI7 A;  2HZF A;  2FAE A;  4NV2 A;  3E9J B;  2GZE A;  5DJM A;  4XRD A;  2PEK A;  2LRN A;  2L4B A;  5FWG A;  4J56 E;  3GA4 A;  1SJZ A;  1GSQ A;  1N2A A;  1O73 A;  1G6W A;  4X0X A;  4JE1 A;  5G1K A;  3CSI A;  2AYT A;  4KDX A;  5DAK B;  2GZI A;  3IPZ A;  4TRX A;  3HXS A;  4JRR A;  5B8A A;  2IL3 A;  4HKG A;  4GQC A;  3EWL A;  1O7U A;  1GUL A;  4OO5 A;  2B6M A;  2FVE A;  1M3I A;  3ZML A;  3I69 A;  4K5R A;  4H2W C;  2C0D A;  1HD2 A;  2I9H A;  4AJ6 A;  3IHG A;  3KTB A;  3UJ1 A;  1H75 A;  4MCU A;  2E7P A;  4GTU A;  1O81 A;  4IEL A;  4K2D A;  3GKN A;  1N8J A;  1PL1 A;  4KUN A;  4TR1 B;  1MEK A;  1F3A A;  2R6K A;  5HFK A;  2VCX A;  2FQ1 A;  1TJD A;  2YAN A;  4K5S A;  3NOF A;  2IPA A;  4KB3 A;  5KN1 A;  2MD9 A;  1YZX A;  4OFN A;  3ZYW A;  5B7C A;  1GSD A;  5ECQ B;  3GL3 A;  1QRJ A;  4U0D A;  2YP6 A;  1AQX A;  2V2G A;  1ZYP A;  4H2Y C;  5JWR B;  3F6F A;  3KCM A;  2CQ8 A;  3ERG A;  3GIX A;  3IC8 A;  3KTL A;  3QDN A;  4WBR D;  4ZB9 A;  1GXH A;  1IYH A;  2R0P A;  2XZ0 D;  1PMT A;  3ISO A;  1B8X A;  5HVC A;  5HFG A;  3NY7 B;  3TB2 A;  3DWV A;  1ERU A;  5BRT A;  1TKD B;  3ZIV A;  2JAZ A;  1GSS A;  1W89 A;  2H6Z A;  3CYN A;  5G2Z A;  3TGZ A;  2DJJ A;  3C71 A;  5A4U A;  3HJO A;  2BJX A;  2QA4 P;  1K3Y A;  2WGR A;  5IOX A;  5BMU A;  3FKF A;  4TN8 A;  4L0W A;  2YWN A;  2CA8 A;  2KOP A;  4IVF A;  2YOI A;  1Q86 Q;  4FYU A;  3CTF A;  2YZH A;  1VQP P;  1K8A Q;  4RUV A;  1GSY A;  2OTJ P;  4O5R A;  4KSM A;  2ZNM A;  1JZO A;  1UN2 A;  2X99 A;  4DSS A;  3M3M A;  3ERF A;  2IN3 A;  3CC7 P;  1BQ7 A;  4FYB A;  4V2N A;  3UOM A;  2V41 A;  3G1G A;  4WYM A;  1TW9 A;  2CVB A;  4WEY A;  1TRW A;  1GTI A;  4WBJ A;  5HGO A;  1JHB A;  2DJ0 A;  5D9V A;  2EIR A;  4IP6 A;  2I3Y A;  4KCE A;  3R3E A;  5ECS A;  3I55 P;  3EMP A;  2H75 A;  3A2V A;  1R5P A;  1G7E A;  2KOO A;  1PFO A;  2VLP A;  1A24 A;  1R26 A;  5CRH A;  1I5G A;  4XRO A;  1M90 Q;  2C8U A;  2OKA A;  3G26 A;  4L8E A;  3CCM P;  2TRC P;  2Z45 A;  3P7X A;  3LXZ A;  1IUQ A;  1SK2 A;  2VL9 A;  1E6J P;  3O3T A;  1QFN A;  5GZZ B;  3Q6O A;  4K7N A;  3G21 A;  1RNI A;  1C72 A;  3MGE A;  3GZL A;  1TOF A;  1FO5 A;  3ME7 A;  4MZW A;  3CMA P;  1EP8 A;  2WUL A;  2L6D A;  2ALB A;  1MDK A;  2XPE A;  4XS4 B;  3M9J A;  3L9V A;  1KLP A;  1U87 A;  1ZMA A;  4HJM A;  2IMF A;  3J7Y b;  2HRA A;  4WF4 A;  2K0X A;  1LBK A;  2PY8 A;  4Z2R A;  4NHZ A;  4IJ3 A;  1V58 A;  4H86 A;  2I81 A;  1MZ8 A;  2VUP A;  4IHU A;  3TRP A;  3GNJ A;  2LJA A;  3TJJ A;  5DBQ A;  4I8B A;  2WCI A;  5HR2 A;  2FUG 2;  4POK A;  2IMK A;  3M8N A;  2OTL P;  1YJ9 P;  4YH2 A;  3Q74 A;  2EIA A;  1Q4J A;  1A43 A;  4ID0 A;  1M6N A;  1BAJ A;  3ZLP A;  2E0Q A;  5KN2 A;  4MDC A;  3EPT A;  4X1U A;  2YJH A;  1UNK A;  3ZRE A;  2KGC A;  4KND A;  2LV3 A;  2R0C A;  2LML A;  1AAZ A;  1SD9 A;  5KN0 A;  3MWH A;  5F07 A;  1THO A;  4U0B A;  1F2E A;  2N5A A;  3IK7 A;  3A2W A;  3IXR A;  2GZZ A;  2CAQ A;  1HY8 A;  3MYD A;  1PL2 A;  5JCG A;  2GDX A;  3CCS P;  5ECN B;  2JU1 A;  2N5I A;  3D5J A;  1VQ5 P;  3ZRD A;  4HZ4 A;  2HT9 A;  1T4Y A;  2H6Y A;  2O87 A;  3HVV A;  3RAZ A;  2VL2 A;  1SKW B;  7GSS A;  2N50 A;  1K30 A;  1K73 Q;  2QEX P;  2REM A;  5CNW A;  2IMD A;  2N6Y A;  4GSN A;  4AJ8 A;  3TJB A;  1YEP A;  3VUR A;  2CVD A;  2GZG A;  4IS0 A;  1TDI A;  1ERV A;  4MH3 A;  4AF2 A;  5KOX A;  3KH7 A;  3UAR A;  2M46 A;  3FW2 A;  2LKU A;  3VK9 A;  4ECB A;  2O89 A;  4PQH A;  2A2P A;  3CTG A;  2E2G A;  4XIH A;  3CCQ P;  5EL8 A;  2KG8 A;  2VCV A;  2WRT A;  4RI6 A;  3PPU A;  1V98 A;  2JO0 A;  4N11 A;  3U43 A;  3CME P;  3ZTL A;  4TR3 A;  1N8R Q;  2V6K A;  1KTE A;  4WF5 A;  1EP7 A;  1J9B A;  2LRT A;  3HZ4 A;  1HQB A;  2PEM A;  1TRU A;  3IAM 2;  2AVA A;  2D2Z A;  1VQ8 P;  1O8W A;  3CE7 A;  1A8O A;  1SK1 A;  1J08 A;  1QVF O;  14GS A;  3LSZ A;  3DVX A;  2KR5 A;  3A2X A;  1Z6N A;  3TKS A;  2OE3 A;  2YWM A;  3M1G A;  2RM5 A;  4ZIJ A;  3C8E A;  3HA9 A;  2H6X A;  1X5C A;  4OO4 A;  3F4R A;  3QFB C;  1Q98 A;  1EWX A;  3LFL A;  4OCE A;  4CW9 A;  2CZ3 A;  2RUF A;  4EIQ A;  5E4W A;  3H4E A;  2VM1 A;  1YQ1 A;  5GAP D;  2JQ4 A;  1GTU A;  3FZ9 A;  2WPT A;  1CEI A;  2G2Q A;  4ECI A;  20GS A;  2DKH A;  3B4Q A;  2WDU A;  2IWT A;  3GKM A;  1OE8 A;  3VPT A;  3IBH A;  3UIW A;  3DS5 A;  1BYE A;  1T7P B;  2K8V A;  3DS3 A;  1YIT P;  4YKG A;  1X9M B;  5ECM B;  2LEG A;  3M0F A;  1WOU A;  1B9Y C;  3D21 A;  5DAL A;  4YKF A;  4I2U A;  2MVV A;  1R5A A;  4IJI A;  1SEN A;  5JCU A;  3C1S A;  3WGE A;  4A5P A;  4N0V A;  3CCR P;  1GLP A;  3EU4 A;  2H0H A;  2MYG A;  4TR1 A;  2EHS A;  3ERW A;  2FA4 A;  4CHS A;  2FWF A;  2H8L A;  1X5E A;  1YDK A;  3LXT A;  3WYW A;  1M9B A;  1TK8 B;  4MZC A;  4NEO A;  2DJ3 A;  3TRQ A;  1PX7 A;  3ZVJ A;  3LJR A;  3TOU A;  5D93 A;  1DBY A;  4OCF A;  4BWS A;  4GQF A;  4N10 A;  1W4V A;  4U0C A;  5KP8 B;  1SYR A;  2CVK A;  2LJR A;  1XW6 A;  1MDJ A;  1ERT A;  3D22 A;  4BL7 B;  3FR9 A;  4ZBD A;  2KP1 A;  2PUK C;  2DBC A;  1GPJ A;  5INY A;  1X9S B;  2CWO A;  1K3L A;  1YKC A;  3ZFB A;  1EV4 A;  3L9U A;  1EIA A;  2L0Q A;  1YJW P;  1VHN A;  2M8P A;  3FEU A;  2HSY A;  1IMP A;  3HKR A;  2JAD A;  1JLV A;  4EXJ A;  1YJ6 A;  1FW1 A;  2L6E A;  3EE2 A;  4BA7 A;  2HNL A;  4KA0 A;  2PGT A;  3GRX A;  2VLQ A;  2N98 A;  4CDO A;  1Z3E A;  3IOS A;  2CGQ A;  1JFU A;  1QK8 A;  1XPV A;  4GSS A;  4FH8 A;  2A4H A;  2B7K A;  1DV5 A;  4ACS A;  2YCD A;  3DS2 A;  3C73 A;  2DGY A;  4GCI A;  4D73 A;  2H71 A;  4V2L A;  3DS1 A;  3B5I A;  3D4T A;  5G31 A;  3NZN A;  4BPF A;  1ZZY A;  1O85 A;  3KMN A;  2P5Q A;  3DD3 A;  3TUE A;  4TW5 A;  4AJ7 A;  11GS A;  2PN8 A;  4PH0 A;  5ABR A;  1T8K A;  4IPY A;  1OC8 A;  4ZL7 A;  1SKS B;  1M99 A;  6GSU A;  1K0D A;  2JU5 A;  16GS A;  2K18 A;  3HVN A;  4IBP A;  4L5L A;  2MMN A;  5FT3 A;  2VLU A;  2M80 A;  2R3X A;  2CAI A;  4L0U A;  4G0L A;  5EW5 E;  3TKQ A;  6GSW A;  2MMA A;  1PSQ A;  2XHF A;  2G0F A;  3IHQ A;  4BVX B;  4F82 A;  2OA7 A;  2FAD A;  1VF3 A;  4ZL8 A;  2RII A;  2QNW A;  2GLR A;  4KAE A;  3EVI A;  3G4S P;  4XS1 A;  2K0D X;  1PRX A;  3G7I A;  1ZL9 A;  3R2Q A;  2B3S A;  4WXT A;  1RO0 A;  4LLR A;  5KEJ A;  4EUY A;  2KW2 A;  5F0G A;  5LNK e;  3CPW O;  1JZD A;  1PKW A;  2KHP A;  2NDO A;  1FOV A;  4OFM A;  3RBT A;  2LUS A;  1J0F A;  4TXO B;  1S3A A;  1K0N A;  1X3O A;  1F3B A;  3VWW A;  3FY7 A;  3GZM A;  2FY6 A;  2GZY A;  4MK3 A;  5D9W A;  3FZ5 A;  5ECH B;  4YQV A;  1SJI A;  4ULX A;  1M74 A;  2HSM A;  3DRN A;  3RHB A;  5A4V A;  3P05 A;  5F2K A;  2P31 A;  3DS4 A;  3FRC A;  3LW9 A;  4QKO A;  1VQK P;  5IO2 A;  1GRX A;  3BJ5 A;  5F2O A;  2DJK A;  2NBS A;  3VRL C;  2TIR A;  3IAS 2;  3EMX A;  1YY7 A;  3ZFL A;  4POL A;  1IYI A;  5ID2 B;  3K8N A;  5HR3 A;  2B1L A;  2HRN A;  2LNS A;  5A5K A;  3CCL P;  1TI1 A;  3KD0 A;  4BVY B;  1X0R A;  1GUM A;  1WWJ A;  4O5Q A;  2FQ2 A;  2A4V A;  5D8I A;  4IQ1 A;  4LL1 B;  5EPF A;  3F3R A;  1KQS O;  2H74 A;  1A2J A; 
#chains in the Genus database with same CATH homology
 4K0G A;  4PTS A;  4MF5 A;  1SK0 A;  2LQO A;  4MMM A;  1UVZ A;  1PN9 A;  5CYY A;  3F63 A;  4ZB8 A;  3HCZ A;  3GTU B;  1EEM A;  1OKD A;  3LYK A;  1XFL A;  4X4J A;  4Z7X A;  2ES7 A;  2DC5 A;  4JED A;  2HZE B;  5ELG A;  2X8C A;  1NSW A;  1XW5 A;  3HVX A;  3PGT A;  4K9Z A;  4X43 A;  3BOA A;  2DIZ A;  1MTC A;  1SL2 B;  3L4N A;  1U6T A;  1M0U A;  5IO0 A;  4HDE A;  2VOC A;  4KDU A;  2L4Q A;  5G5E A;  1EV9 A;  4I6X A;  3QMX A;  1TP9 A;  4XS6 A;  1BJX A;  4XHM A;  3CRU A;  2C0F A;  2O8V B;  5JWQ B;  2QA2 A;  1GSF A;  3N9J A;  2KUC A;  1GLQ A;  5C00 A;  1WRY A;  2X8G A;  1DSB A;  1F37 A;  2FGX A;  4CY8 A;  5IIZ A;  3UMA A;  1FB6 A;  5EVO A;  5DCG A;  4PQI A;  2GQK A;  1Z6M A;  2OJL A;  3QPM A;  2H0G A;  3TJK A;  4XTS A;  3GFK A;  3FMW A;  2J9H A;  1XVW A;  2EIQ A;  2E2M A;  5F05 A;  3W6G A;  1XWG A;  3QAG A;  2LNT A;  1THX A;  2ON7 A;  4ICY A;  4I2T A;  2WS2 A;  1O8X A;  2CQ9 A;  3OR5 A;  1XZO A;  2N5F A;  1LJR A;  2WJU A;  4WR4 A;  3W8J A;  3QCP A;  4ZIL A;  5HR0 A;  4FQU A;  4TOP A;  2DIY A;  4YQM A;  2LRC A;  4PNG A;  2PVQ A;  2FD3 A;  1EOH A;  3ED3 A;  3PIN A;  4EVM A;  4GLT A;  2XC2 A;  3KM6 A;  5IOW A;  3G7J A;  5DJL A;  1VF1 A;  2NPB A;  2L5O A;  2H73 A;  1ACV A;  2DSA A;  1BG5 A;  1Z9H A;  4KE3 A;  5LD0 A;  2P0G A;  1SYX A;  2ZCT A;  2CT6 A;  1WPI A;  1GNW A;  3HYP A;  3ZVJ D;  2Z9S A;  2PVO C;  1NHO A;  2EC4 A;  2PPT A;  2VCT A;  1WJK A;  2MZC A;  3DGQ A;  4YQU A;  3MNG A;  17GS A;  2NVL A;  5AIX A;  2HFD A;  2X49 A;  3LEF A;  4BL7 A;  3BD2 A;  3UBK A;  5F8B A;  3GUS A;  4DSQ A;  4XRA A;  4F2I A;  4LA1 A;  2V1M A;  5CO3 A;  3HHV A;  1OC9 A;  2H30 A;  2VD0 A;  5IMD A;  2KP2 A;  5J5N A;  1M2A A;  2N5B A;  4G0I A;  2C3Q A;  1A23 A;  3DML A;  2FWG A;  1JLW A;  1U88 A;  3D0Z A;  4GRF A;  1A8Y A;  3WD6 A;  2GST A;  3IR4 A;  4OD7 A;  2X4A A;  4JR4 A;  2MBT A;  2RLI A;  1SL0 B;  1RW1 A;  5A4W A;  5CRE A;  1A0F A;  2BTO T;  1F6M C;  1LU4 A;  1AUC A;  4KCA A;  2CV4 A;  4MPG A;  3WGD A;  2GT5 A;  3DXB A;  3LYP A;  2ON5 A;  3HZ8 A;  3RDW A;  10GS A;  2XPD A;  1O6J A;  4ML1 A;  3TDG A;  3RPP A;  5IPG A;  2VAF A;  4KX4 A;  1NHY A;  2TRX A;  2JL4 A;  1ERW A;  4O5U A;  4Q5Q A;  4V1A g;  2MMZ A;  18GS A;  2EIO A;  5FHI A;  3KP9 A;  3MSZ A;  4PUR A;  3MIX A;  2PMT A;  4HJ2 A;  1DE1 A;  3DIE A;  1EOG A;  3F8U A;  1XXU A;  4DSS B;  2GDR A;  4E8E A;  2A2S A;  3VWX A;  1JZR A;  4IKH A;  1M7T A;  4USS A;  3APS A;  4EC0 A;  4EO3 A;  3CSH A;  1Z7P A;  2CX3 A;  5HQP A;  1XWC A;  3ZMK A;  4MAB A;  5DAK A;  2ZUP A;  1WMJ A;  4HS1 A;  1PQN A;  4TXV A;  1S3C A;  2C3N A;  4RQX A;  3FHK A;  3QOU A;  3GX0 A;  5D96 A;  3D6I A;  4F0B A;  3I6A A;  3A5W A;  4AGS A;  2QA1 A;  2C0E A;  1VRS D;  3GUR A;  4NWY A;  1A2M A;  2I1U A;  1TU8 A;  4PX1 A;  5DCH A;  4ZL9 A;  1EEJ A;  2VLV A;  3MAK A;  3US3 A;  4G10 A;  2H66 A;  2P5R A;  3HVS A;  3EIN A;  2C0G A;  4ZB6 A;  1B48 A;  19GS A;  4V2M A;  3IC4 A;  2B5E A;  4BPY A;  2JSZ A;  1XWB A;  1TK0 B;  2VO4 A;  3G9B A;  5F06 A;  2C4J A;  2LST A;  3IE3 A;  2PWJ A;  1B4P A;  2OE1 A;  1OAZ A;  2B1K A;  3L78 A;  4FO5 A;  4HU9 A;  3FYG A;  3BBY A;  5GAN D;  1AC1 A;  1XVQ A;  1QGV A;  4TKY A;  4DEJ A;  1QQ2 A;  3E3E A;  1K0O A;  4O32 A;  3DYR A;  4ISD A;  3IRA A;  1FOH A;  3U6V A;  1G6Y A;  4DVC A;  3DKS A;  2PER A;  1NM3 A;  5AIS A;  2PBJ A;  3GN3 A;  3JCM L;  1X5D A;  1U3A A;  4MP4 A;  2V32 A;  1H4O A;  3LOR A;  2F3M A;  5J3R A;  1PD2 1;  1SJ6 A;  4MJB A;  1K0B A;  1USB A;  1QUW A;  3GV1 A;  5D9X A;  1V57 A;  3I9V 2;  2DMM A;  3ZIJ A;  4MJC A;  3KXO A;  4JU5 A;  1G0T A;  1DUG A;  1A2L A;  3CRT A;  3TRX A;  13GS A;  2PU9 C;  1K0C A;  2HYX A;  1Z7R A;  3KMO A;  4MF7 A;  1TU7 A;  3FZ4 A;  4NHW A;  3F4T A;  4E8H A;  2IFQ B;  4TR0 A;  1M2D A;  3N5O A;  4RQR A;  1SKR B;  3VLN A;  2HRK A;  1ZGN A;  4QL9 A;  2YWO A;  2XBQ A;  4HZ2 A;  1OKT A;  5AIV A;  2VIM A;  3Q18 A;  4N30 A;  1G7O A;  5CP1 A;  4KSO A;  3V1W A;  5E59 A;  4GWR A;  4XS4 A;  2V6O A;  4F0C A;  4JBB A;  1OC3 A;  4ZBA A;  3P2A A;  4OWY A;  6GSS A;  2AJQ B;  1PX6 A;  3GMF A;  4HEA 2;  1T1V A;  1PGT A;  3ZIT A;  5CRW A;  4IGJ A;  2YZU A;  4MJA A;  3L0H A;  3VI7 A;  4DSR A;  3LWA A;  4I5Q A;  2F8F A;  6GSY A;  4G0K A;  3LQ7 A;  4ECC A;  5L71 A;  3GH6 A;  2VCW A;  4F03 A;  3TKP A;  3GX8 A;  3KZQ A;  2K6V A;  1KNG A;  1U3I A;  2YWI A;  3QR6 A;  3TJG A;  2HXK A;  2KLX A;  3GH9 A;  2OBK A;  1KBN A;  2H19 A;  22GS A;  1XWA A;  2QGV A;  2YPM A;  5DDL A;  1BED A;  3HY2 A;  3APO A;  2C3T A;  3F6D A;  1WIK A;  2IJY A;  3KH9 A;  1XOA A;  3U5R E;  2RM6 A;  5DQY A;  1K0A A;  2RUE A;  3WT1 A;  1GL8 A;  3DVW A;  9GSS A;  2H1D A;  1E2Y A;  1FVJ A;  2NTO A;  4K1F A;  1HYU A;  4I97 A;  4ML6 A;  2VLT A;  4ILF A;  5G30 A;  3M9K A;  4KF9 A;  1A8L A;  5J9B A;  1GTB A;  3TKR A;  5DAL B;  4EE0 A;  1SD8 A;  3GST A;  5AN1 A;  4Q5F A;  4IP1 A;  4LMV A;  3KGK A;  1FVK A;  1EGO A;  4HOJ A;  3KP8 A;  1T3B A;  1EGR A;  5JWO B;  2BMX A;  3GHA A;  2FNO A;  1GWC A;  2JAC A;  4P3Y B;  3TCO A;  4EIP A;  3HD5 A;  5CRG A;  3A5I A;  3GKK A;  3ZZX A;  1QXH A;  4MLY A;  1ZOF A;  2CX4 A;  4Q5R A;  1TXX A;  3ZL5 A;  2HE3 A;  2OAD A;  4PQ1 A;  3APQ A;  2B7J A;  1A0R P;  3IV4 A;  5B8B A;  3QAV A;  3H4K A;  1XBS A;  1NW2 A;  5G5F A;  1TTZ A;  2R37 A;  5IMZ A;  3RHC A;  1FAA A;  2H1G A;  1ILO A;  1ABA A;  1Y25 A;  1PKZ A;  3FR6 A;  4O7H A;  2H76 A;  3SBC A;  3HJM A;  3KEB A;  1MDI A;  2X64 A;  2WFC A;  1B4Q A;  1XOB A;  2LJK A;  4IW9 A;  1GUH A;  5ECL B;  4K2X A;  4MJE A;  4EL1 A;  3PR8 A;  2DKI A;  4K7O A;  1GUK A;  2F9S A;  3O76 A;  3F9U A;  1TRV A;  2IMI A;  3FZA A;  4POB A;  3L9S A;  1B9X C;  5H5R A;  2WB9 A;  1FB0 A;  4V1A p;  2J23 A;  2VL2 C;  5CAX A;  3P90 A;  3TJF A;  3P8W A;  1OYJ A;  3EC3 A;  3KIJ A;  4HQS A;  4D73 B;  1MD4 A;  2YV7 A;  1T8E B;  4Z2U A;  1KEB A;  1UC7 A;  1URM A;  3F4S A;  3UL3 A;  4ECJ A;  1GSE A;  1PN0 A;  1X9W B;  4K6X A;  5ECO B;  1ZYE A;  1SU9 A;  3EU3 A;  2CZ2 A;  4NXI A;  2QSI A;  4OFT A;  1YKA A;  2AAW A;  2GGT A;  2HSH A;  2L6C A;  4YAP A;  1R4W A;  1S3D A;  2OAC A;  1TRS A;  3C7M A;  2M72 A;  1AQW A;  4F9Z A;  4J2F A;  1XWK A;  3UVH A;  3F0I A;  3GYK A;  1GTA A;  1T4Z A;  2YV9 A;  4ZBB A;  3TKS C;  4OMV A;  3G7Y A;  4PUA A;  2L59 A;  3QAW A;  4O92 A;  5IQY A;  2JZT A;  2MMO A;  1AXD A;  2GSR A;  4MF6 A;  4ZXG A;  5B6N A;  8GSS A;  2X8H A;  4IQA A;  1YF0 A;  3BCK A;  4KDY A;  1T00 A;  4Z2T A;  5J41 A;  2GT6 A;  4KGI A;  3W8S A;  5H5S A;  5KOW A;  3H1N A;  4PGT A;  4NPB A;  4YAV A;  3VPQ A;  1HQO A;  3D4M A;  3O6T A;  5D73 A;  2O7K A;  2C80 A;  1Z5Y E;  5LCZ A;  1FHE A;  1F9M A;  1RK4 A;  3LG6 A;  2L57 A;  3WT2 A;  2A2R A;  1V2A A;  6GSV A;  1R7H A;  5IMV A;  5IPH A;  4MPF A;  3FK8 A;  2VD1 A;  5KN3 A;  3VWV A;  4TVE A;  2H1B A;  2F8A A;  2H1A A;  2WZ9 A;  4CY6 A;  4EKZ A;  2GSS A;  3EYT A;  1GH2 A;  3EUR A;  3QD9 A;  2HLS A;  5G1L A;  1WE0 A;  3H8Q A;  5EY6 A;  2GQM A;  2LS5 A;  5GSS A;  2VCQ A;  3E0U A;  2IFQ A;  1UA5 A;  3GL5 A;  4NAX A;  2LTK A;  2IME A;  6GSX A;  3J7Y k;  3VI5 A;  12GS A;  3CXG A;  2MBS A;  1VF4 A;  1VGL A;  3IDV A;  1ZYN A;  2FLS A;  5H5Q A;  4PNF A;  2R5G A;  5ECK B;  1ZCP A;  1QMV A;  2QKE A;  4K0N A;  1V40 A;  4MNN A;  3H79 A;  4NV5 A;  2JSY A;  1TI3 A;  1K3O A;  2FCH A;  1K0M A;  4BVX A;  2R2J A;  5AGY A;  4PXO A;  4WR5 A;  4K8M A;  4BWQ A;  5ENU A;  2F51 A;  5COH A;  2OE0 A;  4MZB A;  3TOT A;  4IN0 A;  1M2B A;  3PH9 A;  4J57 E;  1RQM A;  1ML6 A;  4LL4 B;  5ECR B;  1AQV A;  1FG4 A;  2K8S A;  3TKS E;  4N0Z A;  4TXO A;  4HUA A;  3Q19 A;  3UEM A;  3HDC A;  1EZK A;  3AY8 A;  1HNA A;  4PUF C;  1I9D A;  5GST A;  3VFI A;  4GXZ A;  4TR4 A;  2R4V A;  5JCW A;  4WET A;  1BAY A;  4QL7 A;  1XCC A;  5J4U A;  3CBU A;  3DEX A;  2H01 A;  1GNE A;  1M9A A;  4HU7 A;  2VCZ A;  2AB6 A;  1GSU A;  3IK9 A;  4EDY A;  4FIW A;  2YJ7 A;  5ID2 A;  3UAP A;  4EF0 A;  1BX9 A;  1V9W A;  3MDK A;  4FYC A;  4BVY A;  5IMA A;  2H72 A;  5IM9 A;  2AV4 A;  2B5Y A;  1AIU A;  1TK5 B;  2JZS A;  2VL3 A;  3CMI A;  3F3Q A;  4HI7 A;  2AUV A;  1WP0 A;  3VWU A;  4G9H A;  4NMU A;  4Q5N A;  3C1R A;  2L4C A;  4KH7 A;  4L5O A;  4GF0 A;  1ON4 A;  2KOK A;  3WGX A;  2DML A;  5HFI A;  5D9T A;  2FHE A;  1HNB A;  2HRF A;  3IA1 A;  2DJ2 A;  2O85 A;  1E6B A;  3GTU A;  5ECI B;  5C04 A;  1XW9 A;  1GP1 A;  2H70 A;  2XBI A;  5DVB A;  1AW9 A;  4MA9 A;  4POM A;  2LQQ A;  2HZE A;  4GST A;  1MD3 A;  2FA8 A;  3S9F A;  2OBI A;  2QC7 A;  3I43 A;  2VM2 A;  4MH2 A;  2GVP A;  2DLX A;  2HI7 A;  2GSQ A;  1JZW A;  3H93 A;  4G2E A;  4WKW A;  2FWE A;  3GSS A;  3BCI A;  2H0I A;  5J9C A;  1OVN A;  1OC9 B;  2C1Y A;  5DQS A;  5IMC A;  2L5L A;  2R0G A;  3RPN A;  2JZR A;  2GZP A;  3UVT A;  5ELA A;  2I4A A;  4LMW A;  2B5X A;  4JR6 A;  4HQZ A;  2YNX A;  1ST9 A;  5B6M A;  6GST A;  2DJ1 A;  1PA3 A;  1Y6E A;  2FWH A;  2GTU A;  3A3T A;  3QFA C;  1OE7 A;  3CSJ A;  1VF2 A;  4K7I A;  3NIV A;  5ECP B;  1YF1 A;  1YEX A;  1HNC A;  3LGC A;  4QQ7 A;  3HJP A;  5CRD A;  3KJY A;  1SL1 B;  4G19 A;  2AHE A;  2YN1 A;  1CQH A;  3GKX A;  4XCS A;  4JZQ A;  2K9F A;  4EDZ A;  4KW6 A;  2GS3 A;  5IMF A;  1CQG A;  2GQL A;  3SWL A;  1ZYQ B;  3UBL A;  3FR3 A;  3ME8 A;  1XIY A;  2IIY A;  5HR1 A;  2UZ8 A;  1DE2 A;  4RI7 A;  2HZF A;  4NV2 A;  3E9J B;  5DJM A;  4XRD A;  2LRN A;  5FWG A;  4J56 E;  3GA4 A;  1SJZ A;  1GSQ A;  1N2A A;  1O73 A;  1G6W A;  4X0X A;  4JE1 A;  5G1K A;  3CSI A;  2AYT A;  4KDX A;  5DAK B;  3IPZ A;  4TRX A;  3HXS A;  4JRR A;  5B8A A;  2IL3 A;  4GQC A;  3EWL A;  1O7U A;  1GUL A;  4OO5 A;  2B6M A;  3ZML A;  3I69 A;  4K5R A;  2C0D A;  1HD2 A;  2I9H A;  4AJ6 A;  3IHG A;  3KTB A;  3UJ1 A;  1H75 A;  4MCU A;  2E7P A;  4GTU A;  1O81 A;  4IEL A;  4K2D A;  3GKN A;  1N8J A;  1PL1 A;  4KUN A;  4TR1 B;  1MEK A;  1F3A A;  2R6K A;  5HFK A;  2VCX A;  1TJD A;  2YAN A;  4K5S A;  3NOF A;  2IPA A;  4KB3 A;  5KN1 A;  1YZX A;  4OFN A;  3ZYW A;  5B7C A;  1GSD A;  5ECQ B;  3GL3 A;  2YP6 A;  1AQX A;  2V2G A;  1ZYP A;  5JWR B;  3F6F A;  3KCM A;  3ERG A;  3GIX A;  3IC8 A;  3KTL A;  3QDN A;  4WBR D;  4ZB9 A;  1IYH A;  2R0P A;  1PMT A;  3ISO A;  1B8X A;  5HFG A;  3TB2 A;  3DWV A;  1ERU A;  5BRT A;  1TKD B;  3ZIV A;  1GSS A;  1W89 A;  2H6Z A;  3CYN A;  5G2Z A;  3TGZ A;  2DJJ A;  3C71 A;  5A4U A;  3HJO A;  2BJX A;  1K3Y A;  2WGR A;  5IOX A;  5BMU A;  3FKF A;  4TN8 A;  4L0W A;  2YWN A;  2CA8 A;  4IVF A;  2YOI A;  4FYU A;  3CTF A;  2YZH A;  4RUV A;  1GSY A;  4O5R A;  4KSM A;  2ZNM A;  1JZO A;  1UN2 A;  2X99 A;  4DSS A;  3M3M A;  3ERF A;  2IN3 A;  1BQ7 A;  4V2N A;  4FYB A;  3UOM A;  2V41 A;  1TW9 A;  2CVB A;  4WEY A;  1TRW A;  1GTI A;  4WBJ A;  1JHB A;  2DJ0 A;  5D9V A;  2EIR A;  4IP6 A;  2I3Y A;  4KCE A;  3R3E A;  5ECS A;  3EMP A;  2H75 A;  3A2V A;  1R5P A;  1G7E A;  1A24 A;  1R26 A;  5CRH A;  1I5G A;  2C8U A;  2OKA A;  4L8E A;  2TRC P;  3P7X A;  3LXZ A;  1SK2 A;  2VL9 A;  3O3T A;  1QFN A;  5GZZ B;  3Q6O A;  4K7N A;  1C72 A;  1TOF A;  1FO5 A;  3ME7 A;  4MZW A;  1EP8 A;  2WUL A;  2L6D A;  2ALB A;  1MDK A;  2XPE A;  4XS4 B;  3M9J A;  3L9V A;  1U87 A;  1ZMA A;  4HJM A;  2IMF A;  3J7Y b;  2HRA A;  4WF4 A;  1LBK A;  4Z2R A;  4NHZ A;  4IJ3 A;  1V58 A;  4H86 A;  2I81 A;  2VUP A;  4IHU A;  3TRP A;  3GNJ A;  2LJA A;  3TJJ A;  5DBQ A;  4I8B A;  2WCI A;  5HR2 A;  2FUG 2;  4POK A;  2IMK A;  3M8N A;  4YH2 A;  3Q74 A;  1Q4J A;  4ID0 A;  3ZLP A;  2E0Q A;  5KN2 A;  4MDC A;  3EPT A;  4X1U A;  2YJH A;  3ZRE A;  4KND A;  2LV3 A;  2R0C A;  1AAZ A;  1SD9 A;  5KN0 A;  3MWH A;  5F07 A;  1THO A;  1F2E A;  2N5A A;  3IK7 A;  3A2W A;  3IXR A;  2GZZ A;  2CAQ A;  3MYD A;  1PL2 A;  5JCG A;  5ECN B;  3D5J A;  3ZRD A;  4HZ4 A;  2HT9 A;  1T4Y A;  2H6Y A;  2O87 A;  3HVV A;  3RAZ A;  2VL2 A;  1SKW B;  7GSS A;  2REM A;  5CNW A;  2IMD A;  4GSN A;  4AJ8 A;  3TJB A;  1YEP A;  3VUR A;  2CVD A;  4IS0 A;  1TDI A;  1ERV A;  4MH3 A;  4AF2 A;  5KOX A;  3KH7 A;  3UAR A;  2M46 A;  3FW2 A;  2LKU A;  3VK9 A;  4ECB A;  2O89 A;  4PQH A;  2A2P A;  3CTG A;  2E2G A;  4XIH A;  5EL8 A;  2VCV A;  2WRT A;  4RI6 A;  3PPU A;  1V98 A;  4N11 A;  3ZTL A;  4TR3 A;  2V6K A;  1KTE A;  4WF5 A;  1EP7 A;  1J9B A;  2LRT A;  3HZ4 A;  1TRU A;  3IAM 2;  2D2Z A;  1O8W A;  1SK1 A;  1J08 A;  14GS A;  3LSZ A;  3DVX A;  3A2X A;  1Z6N A;  3TKS A;  2OE3 A;  2YWM A;  3M1G A;  2RM5 A;  4ZIJ A;  3C8E A;  3HA9 A;  2H6X A;  1X5C A;  4OO4 A;  3F4R A;  3QFB C;  1Q98 A;  1EWX A;  3LFL A;  4OCE A;  4CW9 A;  2CZ3 A;  2RUF A;  4EIQ A;  5E4W A;  2VM1 A;  1YQ1 A;  5GAP D;  1GTU A;  3FZ9 A;  2G2Q A;  4ECI A;  20GS A;  2DKH A;  2WDU A;  2IWT A;  3GKM A;  1OE8 A;  3VPT A;  3IBH A;  3UIW A;  1BYE A;  1T7P B;  2K8V A;  4YKG A;  1X9M B;  5ECM B;  2LEG A;  3M0F A;  1WOU A;  1B9Y C;  3D21 A;  5DAL A;  4YKF A;  4I2U A;  1R5A A;  4IJI A;  1SEN A;  5JCU A;  3C1S A;  3WGE A;  4A5P A;  4N0V A;  1GLP A;  3EU4 A;  2H0H A;  2MYG A;  4TR1 A;  3ERW A;  2FA4 A;  4CHS A;  2FWF A;  2H8L A;  1X5E A;  1YDK A;  3LXT A;  3WYW A;  1M9B A;  1TK8 B;  4MZC A;  2DJ3 A;  3TRQ A;  1PX7 A;  3ZVJ A;  3LJR A;  3TOU A;  5D93 A;  1DBY A;  4OCF A;  4BWS A;  4GQF A;  4N10 A;  1W4V A;  1SYR A;  2CVK A;  2LJR A;  1XW6 A;  1MDJ A;  1ERT A;  3D22 A;  4BL7 B;  3FR9 A;  4ZBD A;  2KP1 A;  2PUK C;  2DBC A;  5INY A;  1X9S B;  1K3L A;  1YKC A;  3ZFB A;  1EV4 A;  3L9U A;  3FEU A;  2HSY A;  3HKR A;  2JAD A;  1JLV A;  4EXJ A;  1YJ6 A;  1FW1 A;  3EE2 A;  4BA7 A;  2HNL A;  4KA0 A;  2PGT A;  3GRX A;  4CDO A;  1Z3E A;  3IOS A;  1JFU A;  1QK8 A;  1XPV A;  4GSS A;  4FH8 A;  2A4H A;  2B7K A;  4ACS A;  2YCD A;  3C73 A;  4GCI A;  4D73 A;  2H71 A;  4V2L A;  3D4T A;  5G31 A;  3NZN A;  1ZZY A;  1O85 A;  3KMN A;  2P5Q A;  3DD3 A;  3TUE A;  4TW5 A;  4AJ7 A;  11GS A;  2PN8 A;  5ABR A;  1OC8 A;  4ZL7 A;  1SKS B;  1M99 A;  6GSU A;  1K0D A;  2JU5 A;  16GS A;  2K18 A;  4IBP A;  4L5L A;  2MMN A;  5FT3 A;  2VLU A;  2M80 A;  2R3X A;  2CAI A;  4L0U A;  4G0L A;  3TKQ A;  6GSW A;  2MMA A;  1PSQ A;  2XHF A;  2G0F A;  3IHQ A;  4BVX B;  4F82 A;  2OA7 A;  4ZL8 A;  1VF3 A;  2RII A;  2GLR A;  4KAE A;  3EVI A;  4XS1 A;  1PRX A;  3G7I A;  1ZL9 A;  3R2Q A;  2B3S A;  4WXT A;  4LLR A;  5KEJ A;  4EUY A;  5F0G A;  5LNK e;  1JZD A;  1PKW A;  2KHP A;  2NDO A;  1FOV A;  4OFM A;  3RBT A;  2LUS A;  1J0F A;  4TXO B;  1S3A A;  1K0N A;  1F3B A;  3VWW A;  3FY7 A;  2FY6 A;  2GZY A;  4MK3 A;  5D9W A;  3FZ5 A;  5ECH B;  4YQV A;  1SJI A;  4ULX A;  2HSM A;  3DRN A;  3RHB A;  5A4V A;  2P31 A;  3FRC A;  3LW9 A;  5IO2 A;  1GRX A;  3BJ5 A;  2DJK A;  2NBS A;  2TIR A;  3IAS 2;  3EMX A;  1YY7 A;  3ZFL A;  4POL A;  1IYI A;  5ID2 B;  3K8N A;  5HR3 A;  2B1L A;  2HRN A;  2LNS A;  5A5K A;  1TI1 A;  3KD0 A;  4BVY B;  1X0R A;  1GUM A;  1WWJ A;  4O5Q A;  2A4V A;  5D8I A;  4IQ1 A;  4LL1 B;  5EPF A;  3F3R A;  2H74 A;  1A2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...