1Z6MA

Structure of conserved protein of unknown function from enterococcus faecalis v583
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
175
structure length
175
Chain Sequence
SNAMDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELLAQSVKSGKVERIIKLFDKEKESLQRGNVMHHYIDYSAPEQALSALHKMFATQDEWGNLTLEEVATYAEKNLGLKEQKDATLVSAVIAEANAAHIQFVPTIIIGEYIFDESVTEEELRGYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
publication title Structure of a conserved hypothetical protein from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
total genus 57
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.90 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A DsbA-like domain 1z6mA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1z6mA01
3UARA 1KBNA 5EL8A 2DJ1A 1XW5A 1OC9B 1AW9A 2YCDA 2WGRA 4MABA 1M0UA 1QUWA 1TRWA 1IYHA 5D9WA 2JZTA 3GX8A 2LQOA 1UA5A 1K0BA 3V1WA 4POMA 4IQ1A 1V57A 1O81A 1NSWA 1F37A 2C3QA 3Q19A 4IELA 2GQLA 3P8WA 4RQXA 1O7UA 5INYA 4BVYA 3C8EA 5HFKA 2L4QA 4OFTA 4JU5A 2HZFA 19GSA 1OC3A 1OKDA 3APSA 1SYRA 4NV2A 1SK0A 4X43A 1TRVA 3LEFA 2MMNA 2TRCP 1ERUA 2VLTA 2YWOA 2XPEA 3TKSE 4TR4A 1IYIA 3GMFA 5IOXA 1GRXA 4HZ2A 3UOMA 1TI1A 1EGRA 5A4WA 1ZZYA 2R3XA 2H74A 4CDOA 2VCTA 1T3BA 1QXHA 2MMAA 5DQSA 1TRUA 1GUMA 4OMVA 2N5FA 2O89A 1ILOA 2MBTA 5JCUA 2IFQA 4O92A 4JZQA 6GSTA 3BCIA 2O87A 3DEXA 4I2TA 4IJ3A 4LL1B 5HFGA 3QDNA 1JHBA 4BL7A 5HR0A 1EOHA 4HI7A 5F0GA 1PKZA 1EP7A 5ECHB 4YQUA 2H0IA 3TKPA 2XC2A 1GSSA 1U3IA 2PUKC 3F4SA 3DYRA 3APOA 2YV7A 1TJDA 5DDLA 1MEKA 3L0HA 4I6XA 4IQAA 1GLQA 5IPHA 2GZYA 5B8AA 1THOA 16GSA 1OYJA 2GZPA 2O8VB 1NW2A 2F51A 6GSXA 3TJGA 3A2VA 2IMDA 5COHA 1Y6EA 3CSHA 5J41A 1GTAA 2VD1A 4ZILA 2WFCA 2VO4A 1V98A 4ILFA 2GTUA 5IQYA 3FEUA 4GLTA 5CREA 2H72A 4FYBA 1WP0A 3UL3A 1V40A 1U87A 5ECOB 3GKNA 3GL5A 3FKFA 3TOUA 3CSIA 3KEBA 3E0UA 4HJMA 2EIOA 3GKXA 4NHWA 2PERA 1JFUA 1U3AA 3FR6A 2AB6A 2IFQB 1FO5A 3KZQA 1AQVA 5EPFA 5C04A 1QMVA 2NVLA 3UMAA 2H75A 1ZOFA 3I69A 1SL0B 1GTIA 3F9UA 3K8NA 5J3RA 1AIUA 1VF1A 3IAS2 1ST9A 2LQQA 3HXSA 1TU7A 1TDIA 3I6AA 2H1DA 3N9JA 2FUG2 1GTUA 2E2MA 3PR8A 4K9ZA 5J9CA 1SD8A 3A2XA 2YWNA 3H8QA 2PGTA 1X9WB 3L9SA 5ELAA 3GV1A 4ZB8A 4JE1A 2DJ3A 3M3MA 1QK8A 1ZL9A 1BQ7A 4NHZA 5F05A 1XPVA 1HQOA 1VRSD 4POKA 1PL2A 5EY6A 2C0FA 4JR4A 4PGTA 2K9FA 4X0XA 2GSTA 5B6MA 3HZ4A 2XBQA 1W89A 2LTKA 3RDWA 4G9HA 5ECIB 1PGTA 2IL3A 5AGYA 2VL2C 3WT2A 3TRPA 6GSSA 3TJJA 20GSA 1A24A 1QQ2A 1WRYA 4F0BA 3LSZA 2JU5A 3FZ5A 5CRHA 2XPDA 3M8NA 2C0GA 5G5EA 2P0GA 1EZKA 2JZRA 4QL9A 1OE7A 1TXXA 5IO2A 1SK2A 2WULA 3DXBA 3GX0A 2IIYA 3WT1A 4JBBA 3CYNA 3IPZA 2HT9A 3EU3A 3TKSA 3EYTA 4OCEA 5JCGA 1MD4A 3G7IA 5C00A 1WOUA 3DMLA 4BA7A 1DBYA 1JLWA 1SD9A 4IW9A 1PMTA 3TB2A 3C1RA 4V2LA 4PNFA 2H6ZA 4PQ1A 2R6KA 4PUAA 3FK8A 4EE0A 2VLVA 4ULXA 5IMFA 1Z9HA 2DSAA 1EV4A 3KCMA 3MWHA 5A4VA 3US3A 4KCAA 2ON7A 2KLXA 3H79A 4PQHA 5B6NA 3KP9A 5KN2A 5ECMB 3TGZA 4BVXA 4HS1A 4XTSA 3TDGA 2RIIA 3UJ1A 14GSA 1F9MA 5ECQB 1XBSA 5IMAA 2YNXA 2CVDA 3GNJA 3F6FA 3M1GA 18GSA 3P90A 1ZMAA 2L57A 1X9MB 3CTGA 9GSSA 2B1KA 4YQVA 2KHPA 3EWLA 5CYYA 1XVWA 4HJ2A 3F3RA 1U6TA 4N0ZA 1WE0A 1PX6A 1KEBA 3ZMLA 2DBCA 4ECCA 1PKWA 1WMJA 5KEJA 2H8LA 2N5BA 4EXJA 2YZHA 3VI7A 2LRNA 3EC3A 3BBYA 4JEDA 4MZBA 2P5QA 2AUVA 2AYTA 2FGXA 3EMPA 1S3CA 1A2JA 2PPTA 1XVQA 4HZ4A 4NXIA 1TK8B 3L9UA 4V1Ag 1R5PA 4V2MA 4IVFA 1F3BA 2GLRA 1B9XC 3IK7A 2RLIA 2H1AA 3IC4A 2FWHA 4O7HA 1J0FA 2G0FA 1X9SB 2FWGA 2HSYA 2H6XA 3ZLPA 3QAVA 3O76A 1TK0B 3HJOA 3TJKA 1AQXA 2L5LA 4K7NA 3ME7A 3UEMA 3LYPA 3KP8A 4N30A 3HA9A 3GSSA 5IOWA 2C0EA 3BJ5A 3GKMA 1MDKA 5IMZA 2O7KA 1BJXA 2CVKA 2YWIA 3HCZA 4TXOA 2CZ2A 1G0TA 1ZYQB 2H76A 3VFIA 2VCWA 2VCXA 2LUSA 1TU8A 3KTLA 2FWEA 3WYWA 3ZTLA 3D0ZA 2LJAA 4ML6A 6GSWA 4K8MA 2C3NA 3H93A 4ID0A 2N5AA 4MH3A 1ZCPA 3P2AA 3DVXA 1KNGA 1SKWB 5DVBA 1LJRA 1HD2A 2FCHA 2QGVA 1V2AA 2LEGA 4L5LA 1HNCA 3UVTA 1A8LA 3TRXA 2HNLA 1YQ1A 1XZOA 4GSNA 3TJFA 3G7YA 1LU4A 1R7HA 2V2GA 3GKKA 5CRDA 3ERWA 4X1UA 4J56E 7GSSA 1T4ZA 5ECRB 2RM6A 3WGXA 3LG6A 2OE3A 5IPGA 3EMXA 3KIJA 1MDIA 4K7OA 2YWMA 1EP8A 2J23A 1ERWA 3IOSA 4EVMA 2C8UA 1YZXA 2I81A 1TRSA 5J4UA 5A5KA 4XRDA 1A0FA 2I1UA 4TXOB 3TCOA 3ZFLA 5DAKA 3ZIJA 4XS6A 1MTCA 5B8BA 1F3AA 2V1MA 1DE2A 1EWXA 4RUVA 4PQIA 2P5RA 2JSZA 4PURA 2YOIA 1S3DA 4OFNA 3LXZA 3HYPA 4XRAA 3GL3A 2H0GA 3J7Yb 5JCWA 2OA7A 1JZRA 2K8SA 4F9ZA 1XOBA 3SBCA 1SENA 4J2FA 1VGLA 4K7IA 2MMOA 1X5DA 3QPMA 3BD2A 3KD0A 2BMXA 3TKQA 3OR5A 3H1NA 2VD0A 10GSA 3CSJA 1AC1A 4KDYA 2ZNMA 1FHEA 2M46A 3TKSC 5FWGA 1SKSB 4N10A 2DMMA 1SJ6A 2IMIA 4V1Ap 4MF5A 2L6CA 4IBPA 3KMNA 2B1LA 3KH9A 2CZ3A 1J9BA 3FZ4A 4QQ7A 5D96A 5KN1A 4AF2A 2X99A 4MJEA 4F0CA 3IHQA 2K8VA 1M9BA 8GSSA 4KSMA 2V41A 4ECBA 3GYKA 1JZOA 5ECNB 3ZRDA 5ECPB 5CRGA 1QFNA 2GSQA 1B48A 4NMUA 2H66A 4MF7A 1CQGA 2Z9SA 4TR0A 4V2NA 5ECKB 1U88A 5E4WA 1B9YC 1SU9A 3E9JB 2DJJA 2IMFA 2V6KA 1TW9A 3A3TA 5DAKB 2ALBA 2H01A 3C1SA 5GZZB 1NHYA 2C4JA 3DKSA 3RPPA 2CQ9A 1MD3A 3VK9A 1ACVA 4TXVA 2OADA 4F2IA 4XIHA 4ZBAA 4Z7XA 1CQHA 4PUFC 2JL4A 1SJZA 4ZL9A 13GSA 2H1BA 2AHEA 2PMTA 4MZCA 4I8BA 4GWRA 3QOUA 4EC0A 1EV9A 2P31A 3E3EA 1FB6A 1V9WA 1VF2A 1UN2A 5E59A 5DALA 1AXDA 4MA9A 2GT5A 2CAQA 2LS5A 1EEJA 3C71A 1Q4JA 1O8WA 3LYKA 1GUKA 1XW9A 5A4UA 4WBJA 2ZCTA 4YAVA 2E0QA 2HLSA 4MPFA 4G2EA 2O85A 3F4TA 1PQNA 3CTFA 4K2DA 4KGIA 2B3SA 4N0VA 4ZB9A 2DMLA 4YAPA 1G6YA 4K6XA 3HVVA 2PVOC 4KCEA 1GWCA 1R26A 4ZL8A 3IAM2 4CW9A 1XIYA 1WIKA 1GNWA 2PU9C 4MDCA 3FR9A 4DSQA 5DJLA 1K0OA 1VF4A 3EE2A 1PRXA 2EC4A 4LLRA 4QL7A 3EINA 4IKHA 3H4KA 3QD9A 3ISOA 4ECJA 1YEPA 1XWAA 4L0UA 2B7JA 5L71A 2IJYA 2DJKA 1TOFA 1V58A 4TN8A 5HR1A 3G7JA 2YZUA 3I43A 2AJQB 2MZCA 5D73A 3FY7A 1XCCA 4WR5A 11GSA 3G9BA 1B8XA 5LNKe 3F6DA 4O5RA 3GTUA 4EO3A 1TTZA 5G5FA 2B6MA 2E2GA 1T1VA 1SL1B 2RUEA 5JWRB 2VUPA 5DALB 1XWCA 1DE1A 3KXOA 3ERFA 2QKEA 2C3TA 3Q74A 4IN0A 3LGCA 4D73A 1GLPA 3CRUA 1OVNA 3U6VA 1OKTA 4L5OA 2QSIA 1M2BA 3F63A 4HQZA 4LMWA 3BCKA 1NHOA 3DD3A 3QMXA 1GL8A 2GSRA 1YKCA 2IWTA 1FAAA 3M9JA 1FW1A 4TR1A 1MDJA 2LJKA 1C72A 2CX3A 3ZVJD 2VM2A 1SKRB 4KW6A 4FYUA 5AIXA 1BX9A 5ELGA 1UVZA 4JR6A 4WR4A 4TOPA 2LRCA 4DEJA 3VWVA 1TI3A 5CRWA 3HY2A 1ERTA 1ML6A 3FZ9A 3UAPA 2LKUA 1EEMA 3VWUA 3CMIA 1H4OA 2GT6A 1WJKA 2HI7A 2G2QA 5DCGA 1M7TA 1AUCA 4K1FA 2LRTA 4IGJA 5CO3A 5FT3A 4MH2A 4G19A 3F8UA 3J7Yk 4RI6A 2F8FA 3A2WA 2CA8A 2CT6A 4RQRA 3GIXA 1B4PA 2HYXA 4KX4A 2IPAA 2H6YA 2R5GA 1SYXA 5IO0A 1T4YA 3W8SA 1N8JA 2OJLA 2AV4A 2B7KA 4EDZA 2RUFA 1X5EA 2L5OA 5H5RA 2H73A 4IP6A 1DSBA 2HSHA 3LFLA 3TJBA 3KM6A 1O85A 1I9DA 2RM5A 5H5SA 5AN1A 5HFIA 1GSDA 4EF0A 1B4QA 3A5WA 1ZYEA 4WEYA 1SL2B 2M72A 5GSSA 1HYUA 5ABRA 1M2AA 3TOTA 2KUCA 3IDVA 2H71A 5JWQB 4XCSA 1OC9A 4TR1B 3O6TA 2BTOT 1Z5YE 2WS2A 4FYCA 4GSTA 2VAFA 3UBKA 2VM1A 4POLA 3IRAA 3HJMA 1YDKA 4I97A 2FNOA 1XWBA 1WWJA 1Z6MA 2H70A 1I5GA 2YV9A 1JZDA 5D9VA 3UVHA 5ID2A 4DSSA 2JSYA 3FYGA 4ECIA 1PX7A 4I5QA 1ERVA 3ME8A 4MCUA 3GA4A 3KGKA 5G1LA 3IXRA 1GTBA 2LJRA 3DVWA 2LV3A 3PGTA 3WGEA 3BOAA 3VPQA 1XXUA 1SJIA 3GUSA 3L4NA 1K0MA 1O8XA 2C0DA 1X5CA 4NWYA 3LXTA 5ENUA 1TKDB 1A2LA 2H19A 2DC5A 3EURA 3ZYWA 4KSOA 5HQPA 2GSSA 4Q5QA 1Q98A 1Y25A 4KNDA 3F4RA 3QCPA 2L4CA 4IJIA 1A0RP 1K3YA 4KAEA 3EU4A 1RK4A 3DGQA 1GSYA 4WBRD 3QFBC 3P7XA 12GSA 1WPIA 2WZ9A 3FR3A 1JZWA 3D4TA 2YJ7A 2QC7A 1N2AA 3TUEA 1XFLA 4F03A 3Q18A 2X64A 3CRTA 3DIEA 5GSTA 2X8CA 3LJRA 3NZNA 3S9FA 4JRRA 5CP1A 2OKAA 3ZL5A 4NV5A 5F07A 1PN9A 4ZBDA 2WCIA 3HHVA 1H75A 3FRCA 5ID2B 4DSSB 1K0CA 1EOGA 2IMKA 5DJMA 5KN3A 4TRXA 4ZL7A 1F2EA 1DUGA 1AQWA 3APQA 3D21A 3KJYA 1Z3EA 4ZBBA 2GQMA 3C7MA 4XS1A 1HNBA 2EIRA 4ML1A 3EVIA 5G1KA 4K0NA 5IMDA 2GQKA 5ECSA 2F9SA 5IIZA 2A2RA 4HUAA 2MYGA 5CNWA 17GSA 3GURA 4KDXA 3RBTA 1A23A 1EGOA 5J9BA 3IBHA 2I3YA 2XBIA 3IE3A 4MK3A 2FD3A 2JACA 2KOKA 1GP1A 1T00A 4ISDA 2IMEA 1GUHA 3D4MA 5LD0A 3UBLA 1KTEA 2OACA 2OBIA 3W8JA 2DLXA 2VCQA 2JADA 3L78A 1T8EB 2KP2A 1W4VA 4BWSA 4PXOA 2HXKA 4AJ6A 1FVJA 4BPYA 1M2DA 5GAND 1R5AA 4OFMA 4HU7A 2OE0A 3HVSA 2HRFA 3IV4A 4WF4A 3WGDA 1BYEA 3HVXA 3GFKA 1YF1A 4XS4A 3FZAA 4MP4A 3VWXA 2WDUA 4HQSA 3VPTA 2IN3A 4Q5NA 2YN1A 1G7EA 3WD6A 1THXA 2CVBA 4KUNA 4Q5RA 5G31A 1HNAA 2F3MA 3HJPA 3D6IA 1S3AA 1FVKA 3CXGA 6GSVA 1G6WA 2DJ2A 1XOAA 4FO5A 4WKWA 4YH2A 4GQCA 2FWFA 1YF0A 5AISA 4DSRA 2YPMA 2MBSA 2YANA 5CAXA 3ZFBA 4KA0A 5KN0A 4O32A 4TW5A 2HFDA 3ZREA 4GCIA 1GH2A 3KMOA 1RQMA 3C73A 3GN3A 2HRNA 4NAXA 2GGTA 3PH9A 2FHEA 4HEA2 2PN8A 1LBKA 4NPBA 2BJXA 2X8HA 2NDOA 3QR6A 2B5XA 2X8GA 4OO5A 3RAZA 4IP1A 3TKRA 1YEXA 4PNGA 1RW1A 5D9XA 3F3QA 4KB3A 4WETA 4IHUA 2DIZA 5F8BA 1R4WA 1USBA 2KP1A 3MSZA 4TR3A 4BWQA 4KDUA 3ZMKA 5DBQA 4I2UA 2YP6A 3IA1A 5IMCA 5DCHA 1JLVA 1GNEA 4GQFA 3RHBA 4XS4B 4WF5A 1OE8A 4CHSA 2GS3A 4MF6A 3N5OA 6GSUA 1Z7PA 2WJUA 1TP9A 2DIYA 2CX4A 4GXZA 1OC8A 3DWVA 5LCZA 1PA3A 4IS0A 4AJ7A 5F06A 2HZEA 5J5NA 3NIVA 1BG5A 5DQYA 2NBSA 3ED3A 2B5YA 1G7OA 1M99A 2J9HA 2ON5A 4EDYA 1XWKA 2GVPA 4GRFA 3UIWA 4RI7A 1ZGNA 4GTUA 2FLSA 1K3LA 2OE1A 4KE3A 2LNSA 3GRXA 5HR2A 2YJHA 3VLNA 1F6MC 4ZB6A 3ZITA 3MAKA 2HE3A 1K0DA 1K3OA 4OWYA 3RPNA 4H86A 3HDCA 3DRNA 1BEDA 1O73A 2K6VA 2PBJA 2FA4A 3D5JA 2E7PA 1SK1A 5AIVA 4HU9A 1PSQA 1ABAA 3ZIVA 1GSQA 4MJAA 3M9KA 4HDEA 3VI5A 3Q6OA 3F0IA 3MDKA 1T7PB 2K18A 4GSSA 4MJBA 3GHAA 2M80A 2A2SA 3I9V2 1OAZA 4LA1A 1VF3A 2VL9A 4MMMA 1YKAA 4POBA 6GSYA 2WB9A 1XW6A 5G2ZA 4XHMA 1X0RA 5FHIA 2L6DA 5B7CA 3U5RE 3SWLA 2VCZA 4WXTA 5D8IA 3VURA 4EUYA 3CBUA 4EKZA 3QAWA 4MJCA 3D22A 2V6OA 2LSTA 5D93A 2HZEB 4E8HA 3O3TA 3JCML 2ZUPA 2H1GA 1YJ6A 3VWWA 4N11A 2TRXA 1TK5B 4E8EA 3R2QA 1O6JA 3ERGA 2R2JA 2R4VA 2PWJA 2AAWA 2XHFA 3GTUB 5IM9A 1NM3A 4LL4B 1XWGA 3LQ7A 3GH9A 4G10A 4P3YB 4Q5FA 3TRQA 2B5EA 2LNTA 2D2ZA 3MNGA 3HZ8A 1PL1A 2REMA 1E6BA 2I9HA 4K0GA 4D73B 3KH7A 4L8EA 4GF0A 2H30A 2VL3A 2NPBA 3PINA 5HR3A 4OO4A 3GH6A 1GSFA 2DJ0A 4L0WA 1E2YA 1M9AA 3QFAC 2C80A 2CV4A 4AJ8A 5D9TA 2JZSA 3AY8A 3M0FA 2I4AA 2L59A 5JWOB 2FA8A 4OD7A 4KH7A 2EIQA 3QAGA 4YQMA 1PD21 1J08A 2VOCA 3ZZXA 4FH8A 1YY7A 3GSTA 4F82A 4MZWA 2VIMA 2TIRA 2NTOA 1A2MA 3FW2A 4ACSA 2F8AA 3KTBA 22GSA 2CAIA 2VCVA 4FIWA 2MMZA 4J57E 4TVEA 3W6GA 3IR4A 3LORA 1ON4A 2A4VA 1Z7RA 4ZXGA 2H0HA 2PVQA 4AGSA 1AAZA 1UC7A 3ZVJA 2V32A 1FB0A 1FOVA 1QGVA 1GSUA 1URMA 2FY6A 2OBKA 5IMVA 1BAYA 2VL2A 5GAPD 2R37A 5G30A 1FG4A 4DVCA 4ZIJA 2GDRA 2ES7A 1K0AA 4TKYA 3HKRA 3FHKA 2VLUA 4MPGA 1A8YA 5ECLB 1Z6NA 4PX1A 5H5QA 4OCFA 4LMVA 2GZZA 1GSEA 3RHCA 4EL1A 4HOJA 2C1YA 1K0NA 4MLYA 3NOFA 1GULA 2WRTA 3L9VA 3IK9A 5EVOA 3HD5A 3LWAA
chains in the Genus database with same CATH superfamily
3UARA 1KBNA 5EL8A 2DJ1A 1XW5A 1OC9B 1AW9A 2YCDA 2WGRA 2PEJA 4MABA 1M0UA 1QUWA 2XT1A 1TRWA 1IYHA 2EFJA 5D9WA 2JZTA 3GX8A 2LQOA 1UA5A 1K0BA 3V1WA 4POMA 4IQ1A 1V57A 1O81A 1NSWA 1F37A 2C3QA 3Q19A 1VQ8P 4IELA 2GQLA 3P8WA 4RQXA 1O7UA 5INYA 4BVYA 3C8EA 5HFKA 2L4QA 4OFTA 4JU5A 2HZFA 4H2YC 4XFYA 19GSA 1OC3A 1OKDA 2A2PA 3APSA 1SYRA 4NV2A 1SK0A 4X43A 2K92A 1ACPA 1TRVA 3LEFA 2MMNA 3MGEA 2TRCP 2KGCA 1ERUA 2VLTA 5F2NA 2YWOA 2XPEA 3TKSE 4TR4A 1IYIA 3GMFA 5IOXA 1GRXA 4HZ2A 3UOMA 1TI1A 1EGRA 1M3IA 5A4WA 1ZZYA 2R3XA 2H74A 4CDOA 4U0DA 2VCTA 1T3BA 1QXHA 2MMAA 5DQSA 1TRUA 1GUMA 2KGDA 4OMVA 2N5FA 2O89A 1ILOA 1KC8Q 2MBTA 5JCUA 2IFQA 4O92A 4JZQA 6GSTA 3BCIA 2O87A 3DEXA 4I2TA 4IJ3A 4LL1B 5HFGA 2KOOA 3QDNA 1JHBA 4BL7A 5HR0A 1EOHA 4HI7A 2FHSC 5JPAA 5F0GA 1PKZA 1EP7A 1ZMBA 5ECHB 4A5PA 4CA3A 4YQUA 2XXMA 2H0IA 3TKPA 2XC2A 1GSSA 1U3IA 2PUKC 3F4SA 3DYRA 3APOA 2YV7A 3HYBA 1A8OA 1TJDA 5DDLA 1MEKA 3L0HA 4I6XA 4IQAA 1GLQA 5IPHA 2GZYA 5B8AA 1THOA 16GSA 2QA1A 1OYJA 2GZPA 2O8VB 1NW2A 2F51A 6GSXA 4BVYB 3TJGA 3A2VA 3CCEP 2IMDA 3CE7A 5COHA 1Y6EA 3CSHA 2PY8A 5J41A 5KOXA 1GTAA 3H4EA 2VD1A 1K73Q 4ZILA 2WFCA 5HGLA 2VO4A 1V98A 2KG9A 4ILFA 1Q82Q 1CEIA 3G0VA 2GTUA 5IQYA 3FEUA 4GLTA 5CREA 2H72A 4FYBA 2K0XA 5EW5E 1WP0A 3UL3A 1V40A 1U87A 5ECOB 3CPWO 3GKNA 5KOWA 3GL5A 3G29A 3FKFA 3DS4A 3TOUA 3CSIA 3KEBA 3GKLC 2HSMA 3E0UA 4HJMA 2EG5A 2EIOA 3GKXA 1K9MQ 4NHWA 2PERA 4PH1A 5HGOA 1JFUA 1U3AA 3FR6A 2AB6A 2IFQB 1FO5A 3KZQA 1AQVA 5EPFA 5C04A 1QMVA 4BL7B 2NVLA 3G1IA 3UMAA 2H75A 1ZOFA 2CGQA 3I69A 1SL0B 1GTIA 2PEQA 2R0GA 3F9UA 3K8NA 5J3RA 1AIUA 1VF1A 3IAS2 1ST9A 2LQQA 3HXSA 1TU7A 1TDIA 3I6AA 2H1DA 3N9JA 2FUG2 1GTUA 2E2MA 3PR8A 4K9ZA 1Q7YQ 5J9CA 1SD8A 3A2XA 2YWNA 3H8QA 2PGTA 1X9WB 4YKGA 3L9SA 5ELAA 3GV1A 4ZB8A 4JE1A 2DJ3A 3M3MA 1QK8A 1ZL9A 1BQ7A 4NHZA 5F05A 1XPVA 1HQOA 1VRSD 2CQ8A 4POKA 2VLQA 1PL2A 2C0FA 5EY6A 3DPHA 4JR4A 4PGTA 2K9FA 2K93A 2MF4A 4X0XA 2GSTA 5B6MA 3HZ4A 2XBQA 1W89A 3HZQA 2LTKA 3RDWA 2K5XA 4G9HA 5ECIB 1PGTA 2IL3A 5AGYA 1ZNVA 2VL2C 3WT2A 4K5SA 4BPHA 2XZ1C 3TRPA 4FQUA 6GSSA 3TJJA 20GSA 1A24A 3CCQP 1QQ2A 1WRYA 4F0BA 3LSZA 2JU5A 3FZ5A 5CRHA 2XPDA 3M8NA 2C0GA 5G5EA 2P0GA 2JZRA 1EZKA 4QL9A 1OE7A 1TXXA 5IO2A 1SK2A 4CY8A 2WULA 3DXBA 1VKUA 1N8RQ 3GX0A 2IIYA 5BMUA 3WT1A 4JBBA 3CYNA 3IPZA 2HT9A 3EU3A 3TKSA 3G26A 3EYTA 4OCEA 5JCGA 1MD4A 3G7IA 5C00A 1WOUA 3DMLA 4BA7A 1DBYA 1JLWA 1SD9A 4IW9A 1PMTA 3TB2A 3C1RA 1PN0A 4BIKA 4V2LA 4PNFA 2H6ZA 4U0FA 3CC2P 4PQ1A 2R6KA 4PUAA 3FK8A 4HKGA 4EE0A 2VLVA 4ULXA 5IMFA 1Z9HA 2DSAA 3FMWA 1EV4A 3KCMA 3MWHA 1L0HA 5KP6B 1E6JP 5A4VA 4U0EA 3US3A 4KCAA 2GDYA 2ON7A 2KLXA 3H79A 4PQHA 5B6NA 3KP9A 5KN2A 5ECMB 3TGZA 1HQBA 4BVXA 4HS1A 3MYDA 4XTSA 3TDGA 2RIIA 3UJ1A 14GSA 1F9MA 5ECQB 1XBSA 5IMAA 2YNXA 2CVDA 3GNJA 3F6FA 3M1GA 18GSA 3P90A 1VQNP 1ZMAA 2L57A 1X9MB 2QA4P 3CTGA 2KOQA 9GSSA 3G21A 2B1KA 3RG6C 4YQVA 2KHPA 3EWLA 5CYYA 1XVWA 4HJ2A 2PEIA 3F3RA 4HSCX 1U6TA 4N0ZA 4BPGA 5DCKA 1PX6A 1WE0A 2UZ8A 1KEBA 3ZMLA 2DBCA 4ECCA 1PKWA 1WMJA 5KEJA 2H8LA 2N5BA 4EXJA 3G6EP 2QNWA 2YZHA 3VI7A 2LRNA 3EC3A 3BBYA 4JEDA 4MZBA 3M1MA 2P5QA 2AUVA 2AYTA 2FGXA 3EMPA 1S3CA 1A2JA 2PPTA 1KQSO 1XVQA 4HZ4A 1QRJA 4NXIA 1TK8B 3L9UA 1Q81Q 4V1Ag 1R5PA 2BHVA 4V2MA 4IVFA 1F3BA 2GLRA 1B9XC 3IK7A 2RLIA 2H1AA 3IC4A 2FWHA 4O7HA 1J0FA 2G0FA 1X9SB 2FWGA 2HSYA 2H6XA 3ZLPA 2DKIA 3QAVA 3O76A 1TK0B 3HJOA 3TJKA 1AQXA 2L5LA 4K7NA 3ME7A 4IPYA 3LYPA 3UEMA 3CCLP 3KP8A 4N30A 2PNGA 2PEKA 3HA9A 3GSSA 5IOWA 2C0EA 3BJ5A 3GKMA 1MDKA 5IMZA 2MVVA 2O7KA 1BJXA 2CVKA 2YWIA 3HCZA 4TXOA 2CZ2A 2N6YA 1G0TA 3CCVP 1ZYQB 3DS2A 2H76A 3VFIA 1ZYNA 2VCWA 2VCXA 2LUSA 1TU8A 3KTLA 4COPA 1MZ8A 2FWEA 3WYWA 3ZTLA 3D0ZA 2GZIA 2LJAA 4ML6A 6GSWA 4K8MA 3DS0A 2C3NA 1PFOA 1M6EX 3H93A 4ID0A 2AFEA 2N5AA 4MH3A 3LMOA 4COCA 1ZCPA 3H0DA 3Q20A 3P2AA 1RO2A 3DVXA 1KNGA 1SKWB 5DVBA 1LJRA 1HD2A 2FCHA 2QGVA 4XRQA 1V2AA 2LEGA 4L5LA 1HNCA 3UVTA 2WPTA 1A8LA 3TRXA 2HNLA 1YQ1A 1XZOA 2JGPA 4GSNA 3TJFA 3G7YA 1A43A 2MVUA 1VQ7P 1LU4A 1R7HA 2V2GA 3GKKA 5CRDA 3ERWA 4X1UA 4J56E 7GSSA 1T4ZA 1NQ4A 5ECRB 3CD6P 2RM6A 3WGXA 2GZEA 3LG6A 2OE3A 5IPGA 3EMXA 3CCUP 3KIJA 1MDIA 4K7OA 2YWMA 1EP8A 2J23A 1ERWA 3IOSA 4EVMA 2C8UA 1YZXA 2I81A 3CMAP 1TRSA 1VHNA 5J4UA 5A5KA 4XRDA 2JBGA 1A0FA 2I1UA 3LW9A 4TXOB 3TCOA 1JJ2O 5DAKA 3ZFLA 3ZIJA 4XS6A 1MTCA 5B8BA 1F3AA 2V1MA 1DE2A 1EWXA 4RUVA 4PQIA 2P5RA 4K5RA 2JSZA 4PURA 2YOIA 1S3DA 4OFNA 3LXZA 3HYPA 2NO8A 4XRAA 3GL3A 3IHGA 1T8KA 2H0GA 3J7Yb 5JCWA 4KF9A 2OA7A 2M8PA 1JZRA 2K8SA 4F9ZA 1XOBA 3SBCA 1SENA 4J2FA 1VGLA 4K7IA 2MMOA 1X5DA 4BPFA 3QPMA 3BD2A 3KD0A 2BMXA 2N98A 2K2QA 2PEMA 3TKQA 2ONTA 2EHTA 3OR5A 3H1NA 2DGYA 2VD0A 10GSA 3CSJA 1AC1A 4KDYA 2FQ0A 1AF8A 2ZNMA 1FHEA 2M46A 4PTSA 3TKSC 5FWGA 1SKSB 4N10A 2DMMA 1SJ6A 2IMIA 1F80D 4V1Ap 4MF5A 2L6CA 4IBPA 3KMNA 2B1LA 3G4SP 3KH9A 2CZ3A 1J9BA 1S72P 3FZ4A 4QQ7A 5D96A 5KN1A 4AF2A 2KWLA 1IMPA 2X99A 1E0HA 4MJEA 4F0CA 2QA2A 2GZFA 3IHQA 2K8VA 1M9BA 8GSSA 4KSMA 2V41A 4ECBA 3GYKA 1JZOA 5ECNB 2CNRA 3ZRDA 5ECPB 5CRGA 1QFNA 2GSQA 1B48A 4NMUA 2H66A 4MF7A 1CQGA 7CEIA 2Z9SA 4TR0A 4V2NA 5ECKB 1U88A 5E4WA 1B9YC 1SU9A 3E9JB 2VLPA 2DJJA 2IMFA 2V6KA 1M6NA 1TW9A 3A3TA 5DAKB 2ALBA 2H01A 5HGNA 3C1SA 5GZZB 1NHYA 2ERHA 2C4JA 3DKSA 3RPPA 1EMVA 2CQ9A 2N5HA 4F37A 1MD3A 3VK9A 1ACVA 4TXVA 2OADA 4F2IA 1Q86Q 4XIHA 4ZBAA 4Z7XA 1CQHA 5F2OA 4PUFC 2KODA 2JL4A 4WYMA 1SJZA 1VQ5P 13GSA 1VQ9P 2AHEA 2H1BA 4ZL9A 2VSQA 2PMTA 4MZCA 4I8BA 4GWRA 4XFXA 2FVEA 3EJEA 1OR5A 3QOUA 3DS3A 4EC0A 1EV9A 2P31A 3E3EA 1FB6A 2LOLA 1V9WA 1VF2A 1UN2A 5DALA 5E59A 1AXDA 4MA9A 4MRTC 3CXCO 2GT5A 2CAQA 2LS5A 1EEJA 3C71A 1Q4JA 1O8WA 3LYKA 1AUMA 1GUKA 1XW9A 5A4UA 4XROA 4WBJA 2ZCTA 4YAVA 2E0QA 2HLSA 3B5IA 4MPFA 3LWAA 4G2EA 1ZYPA 2O85A 3F4TA 1PQNA 3CTFA 4K2DA 4KGIA 2B3SA 4N0VA 4ZB9A 2DMLA 3EJDA 4YAPA 1G6YA 4K6XA 3HVVA 1W2BO 2PVOC 4KCEA 1VQLP 3IC8A 4M0IA 1GWCA 1R26A 4ZL8A 3IAM2 4CW9A 1XIYA 1WIKA 1GNWA 2PU9C 4MDCA 4R0MA 4YKFA 3A5IA 3FR9A 4DSQA 5DJLA 1K0OA 1VF4A 3EE2A 3EPTA 1PRXA 2EC4A 3I56P 4LLRA 4QL7A 3GJNA 2JU1A 3EINA 4IKHA 5HVCA 3H4KA 3QD9A 3ISOA 4ECJA 1YEPA 1XWAA 4L0UA 2B7JA 2X49A 1DV5A 5L71A 2IJYA 2DJKA 1TOFA 1V58A 4TN8A 5HR1A 3G7JA 1XG8A 2YZUA 3I43A 2AJQB 3CC7P 2MZCA 5D73A 3FY7A 1XCCA 2MR7A 4WR5A 11GSA 3G9BA 1B8XA 5LNKe 3F6DA 1EIAA 4O5RA 3GTUA 4EO3A 2XV6A 2LIUA 1TTZA 5G5FA 2B6MA 2E2GA 1M74A 1T1VA 1SL1B 2RUEA 5JWRB 2Z46A 2VUPA 5DALB 1XWCA 1DE1A 3KXOA 3E2DA 5EJDA 3ERFA 2QKEA 3RG2A 2C3TA 4H2XC 3Q74A 4IN0A 3LGCA 1VQMP 4D73A 1GLPA 3CRUA 4IZ6A 2FQ2A 1OVNA 3U6VA 1OKTA 4L5OA 2QSIA 1M2BA 3F63A 4MNNA 4HQZA 4LMWA 3BCKA 1NHOA 2KGEA 4DG9A 3DD3A 3QMXA 1GL8A 2GSRA 3CC4P 1YKCA 4PH0A 2IWTA 1HY8A 1FAAA 1FW1A 3M9JA 4TR1A 1MDJA 2LJKA 1C72A 2CX3A 3ZVJD 1KD1Q 2VM2A 1SKRB 4KW6A 1YJWP 4FYUA 5AIXA 4X4JA 1BX9A 5ELGA 1UVZA 4JR6A 4WR4A 4TOPA 2ROQA 2LRCA 4DEJA 3VWVA 1BAJA 1TI3A 5CRWA 2JB0A 3HY2A 1ERTA 1ML6A 3FZ9A 3UAPA 2LKUA 1EEMA 3VWUA 3CMIA 1H4OA 2GT6A 1WJKA 2HI7A 2G2QA 5DCGA 1M7TA 1AUCA 2HRAA 4K1FA 2LRTA 4IGJA 5CO3A 5FT3A 4MH2A 4G19A 3F8UA 2L6EA 3J7Yk 2AFDA 4RI6A 1YHQP 2F8FA 3A2WA 2CA8A 2CT6A 4RQRA 3GIXA 1B4PA 2CG5B 4G0LA 5KP8B 2HYXA 4KX4A 2IPAA 2H6YA 4Z2RA 2KORA 2R5GA 1SYXA 5IO0A 1T4YA 3W8SA 1N8JA 2X2BA 2AVAA 2OJLA 2AV4A 2B7KA 4EDZA 4K2XA 2RUFA 2GDWA 1X5EA 2L5OA 5H5RA 2H73A 4IP6A 1DSBA 2HSHA 3LFLA 3TJBA 3KM6A 1O85A 1I9DA 2RM5A 5H5SA 5AN1A 5HFIA 1GSDA 4EF0A 1B4QA 3A5WA 1ZYEA 4WEYA 1SL2B 2M72A 5GSSA 1HYUA 5ABRA 1M2AA 3TOTA 2KUCA 3IDVA 2N5IA 2JU2A 2H71A 2L9FA 5JWQB 4XCSA 1OC9A 2Z44A 4TR1B 3O6TA 2BTOT 2PEOA 2KGAA 1Z5YE 2CWOA 2WS2A 4FYCA 2K0DX 4GSTA 2VAFA 3UBKA 2VM1A 4POLA 3IRAA 3HJMA 1YDKA 4I97A 2FNOA 1XWBA 1WWJA 1Z6MA 2H70A 2A4HA 1I5GA 2YV9A 1JZDA 4BVXB 1DNYA 1M90Q 5D9VA 3UVHA 3I55P 5ID2A 4DSSA 2JSYA 3FYGA 4ECIA 1PX7A 4I5QA 1ERVA 3ME8A 4MCUA 3GA4A 1GPJA 3KGKA 3EJBA 4GR2A 2LPKA 3IXRA 5G1LA 1GTBA 2LJRA 3DVWA 1VQ4P 2LV3A 2M5RA 2KG8A 3DS1A 3PGTA 3WGEA 3BOAA 3VPQA 5F2KA 1XXUA 1SJIA 3GUSA 2OTLP 3L4NA 1K0MA 3U43A 3G71P 2LIWA 1VQKP 1O8XA 2C0DA 1UJZA 1X5CA 4NWYA 3LXTA 5ENUA 1VQ6P 1TKDB 1A2LA 2H19A 3CMEP 2X4AA 2JYLA 3NTEA 2DC5A 3EURA 3ZYWA 4KSOA 2PENA 5HQPA 2GSSA 4Q5QA 1Q98A 1Y25A 4KNDA 3F4RA 3QCPA 2L4CA 2MD9A 4IJIA 1A0RP 1K3YA 1EOQA 4KAEA 3EU4A 1RK4A 3DGQA 1GSYA 2BUOA 1NJIQ 4WBRD 3QFBC 3P7XA 12GSA 2AF8A 1WPIA 2WZ9A 3FR3A 1JZWA 3D4TA 1VQPP 2JO0A 2YJ7A 2QC7A 1N2AA 2MY5A 2R0CA 3TUEA 1XFLA 4F03A 3Q18A 2X64A 3CRTA 3DIEA 5GSTA 3DTJA 2X8CA 3LJRA 3NZNA 3B4QA 4H2WC 4JRRA 3S9FA 5CP1A 2OKAA 3ZL5A 4NV5A 5F07A 1PN9A 4ZBDA 2WCIA 3HHVA 1L0IA 4USSA 1H75A 3FRCA 5ID2B 4DSSB 1K0CA 1EOGA 2IMKA 5DJMA 5KN3A 4TRXA 4ZL7A 1F2EA 1DUGA 1AQWA 3APQA 3D21A 3KJYA 4O5QA 1Z3EA 4ZBBA 2GQMA 3C7MA 4XS1A 1HNBA 2EIRA 4ML1A 3CCJP 3EVIA 5G1KA 4K0NA 5IMDA 2GQKA 5ECSA 1K8AQ 2F9SA 5IIZA 2A2RA 4HUAA 2MYGA 5CNWA 17GSA 2FQ1A 3GURA 4KDXA 2EHSA 3RBTA 1A23A 1EGOA 5J9BA 3IBHA 2I3YA 1X3OA 2XBIA 3IE3A 4MK3A 2FD3A 2JACA 2KOKA 1GP1A 1T00A 4ISDA 5HGMA 2IMEA 1GUHA 3D4MA 5LD0A 3UBLA 2EIAA 1KTEA 2OACA 2OBIA 4ICYA 3W8JA 1K30A 2M8LA 2DLXA 3LRYA 2VCQA 5HV8A 2JADA 3L78A 1T8EB 2KP2A 1W4VA 4BWSA 4PXOA 2HXKA 4AJ6A 1FR2A 1FVJA 2K0YA 4BPYA 1M2DA 5GAND 1R5AA 4OFMA 4HU7A 2OE0A 3HVSA 2HRFA 2KOPA 2LTEA 3IV4A 4WF4A 3WGDA 1BXIA 1BYEA 3CCSP 3HVXA 3GFKA 1YF1A 4XS4A 3FZAA 4MP4A 2P9XA 3VWXA 2WDUA 2N6ZA 4EIPA 4HQSA 3VPTA 2IN3A 4Q5NA 2YN1A 1G7EA 3WD6A 3CCRP 1THXA 2CVBA 3MIXA 4KUNA 4Q5RA 5G31A 1HNAA 2F3MA 3HJPA 4Z2UA 3D6IA 1S3AA 1FVKA 2GYKA 3CXGA 2GZGA 6GSVA 1G6WA 2DJ2A 1XOAA 4FO5A 4WKWA 4YH2A 4GQCA 1FOHA 2FWFA 1YF0A 5AISA 4DSRA 2YPMA 2MBSA 2YANA 5CAXA 3ZFBA 4KA0A 2LKIA 4O32A 5KN0A 4TW5A 2HFDA 3ZREA 4GCIA 2KG6A 1GH2A 3KMOA 1RQMA 3C73A 3GN3A 2HRNA 4NAXA 2VLOA 2GGTA 4CY6A 3PH9A 2FHEA 2QEXP 4HEA2 2PN8A 1LBKA 4NPBA 2BJXA 2X8HA 2NDOA 3QR6A 2B5XA 2X8GA 4OO5A 4Z2TA 2DKHA 3RAZA 4IP1A 3TKRA 1YEXA 4PNGA 1RW1A 5D9XA 3NY7B 3F3QA 4KB3A 4WETA 1RO0A 4U0CA 4IHUA 2DIZA 5F8BA 1R4WA 1USBA 2KP1A 3MSZA 4TR3A 4BWQA 2L22A 4KDUA 3ZMKA 5DBQA 5BS1A 4I2UA 2YP6A 3IA1A 5IMCA 5DCHA 1JLVA 1GNEA 4GQFA 3RHBA 4G0KA 4PXHB 5BRTA 3GZLA 4XS4B 4WF5A 1OE8A 4CHSA 1YIJP 2GS3A 3G1GA 4MF6A 3N5OA 6GSUA 1Z7PA 2WJUA 1TP9A 3CCMP 2DIYA 2CX4A 4GXZA 1OC8A 3DWVA 5LCZA 1PA3A 4IS0A 4AJ7A 1IUQA 2DNWA 4U0AA 5F06A 2HZEA 5J5NA 2Z45A 3NIVA 1BG5A 5DQYA 2NBSA 2HRKA 3ED3A 1YITP 2B5YA 4U0BA 1G7OA 1M99A 2J9HA 2ON5A 1M1KQ 4EDYA 1XWKA 2GVPA 2MR8A 4GRFA 3UIWA 4RI7A 1ZGNA 3DS5A 4GTUA 2FLSA 1K3LA 1VQOP 2FADA 3H47A 2OE1A 4KE3A 2LNSA 3GRXA 2KOSA 5HR2A 2YJHA 3VLNA 1F6MC 4ZB6A 3ZITA 2LF4A 3MAKA 2HE3A 4PWVB 1K0DA 1K3OA 4OWYA 3RPNA 2LL8A 4H86A 3HDCA 3DRNA 1BEDA 1O73A 2K6VA 2PBJA 2FA4A 3D5JA 2E7PA 1SK1A 5AIVA 4HU9A 2VLNA 1PSQA 1QVGO 1ABAA 3ZIVA 1GSQA 4MJAA 1YJ9P 3M9KA 4HDEA 3VI5A 3Q6OA 2M8NA 3F0IA 3MDKA 4UHPB 1T7PB 2K18A 4GSSA 4MJBA 5CZDB 2M80A 2A2SA 3I9V2 1OAZA 4LA1A 1VF3A 3GZMA 2VL9A 4MMMA 1YKAA 4POBA 6GSYA 2WB9A 1XW6A 5G2ZA 4XHMA 1X0RA 5FHIA 3HVNA 2L6DA 5B7CA 3U5RE 3SWLA 2VCZA 3CQFA 4WXTA 5D8IA 4G0IA 3VURA 4EUYA 3CBUA 4EKZA 4QKOA 3QAWA 4MJCA 2GDXA 2V6OA 2LSTA 3D22A 5D93A 2HZEB 4E8HA 3O3TA 3JCML 2XZ0D 2ZUPA 2H1GA 1YJ6A 3VWWA 4N11A 2TRXA 1TK5B 4E8EA 3R2QA 1O6JA 5I4TG 2KW2A 3ERGA 2R2JA 2L0QA 2PWJA 2R4VA 2AAWA 3G28A 2XHFA 3GTUB 5IM9A 1NM3A 4LL4B 3WBHA 1XWGA 3LQ7A 3GH9A 1GXHA 4G10A 4P3YB 4Q5FA 3TRQA 2JYGA 1UNKA 2B5EA 2LNTA 2D2ZA 3MNGA 3HZ8A 1PL1A 2REMA 2E1MA 1E6BA 2I9HA 4K0GA 4D73B 5KP7B 3KH7A 4L8EA 4GF0A 2H30A 2LMLA 2VL3A 2NPBA 3PINA 1YJNP 5HR3A 1S3RA 4NEOA 4OO4A 3GH6A 1GSFA 1YI2P 2DJ0A 1E2YA 4L0WA 2OTJP 4EIQA 1M9AA 3QFAC 2C80A 2CV4A 4XFZA 4AJ8A 5D9TA 2JZSA 3AY8A 3M0FA 2I4AA 3OW2O 2L59A 5JWOB 2FA8A 1AYIA 4OD7A 4KH7A 2EIQA 3QAGA 4YQMA 1PD21 4QNBA 1J08A 2VOCA 3PPUA 3ZZXA 4FH8A 1YY7A 3GSTA 2R0PA 4F82A 4MZWA 2JQ4A 2FACA 2VIMA 2JAZA 5BS2A 1RNIA 2TIRA 1QVFO 2NTOA 1A2MA 3FW2A 4ACSA 2F8AA 3KTBA 22GSA 2CAIA 1D1DA 2VCVA 2K94A 4FIWA 2MMZA 2L4BA 4J57E 4TVEA 2OARA 3W6GA 3VRLC 3IR4A 3LORA 4O5UA 1ON4A 2A4VA 1Z7RA 4ZXGA 2FVFA 2H0HA 2PVQA 4AGSA 1AAZA 1UC7A 3ZVJA 2V32A 2FVAA 3P05A 1FB0A 1FOVA 1QGVA 1GSUA 1URMA 2FY6A 2OBKA 5IMVA 1BAYA 2VL2A 5GAPD 2R37A 5G30A 1FG4A 1IMQA 2N50A 4DVCA 1KLPA 4ZIJA 2GDRA 2ES7A 2FAEA 1K0AA 4TKYA 3HKRA 1GXGA 3FHKA 2VLUA 4MPGA 1A8YA 1M3JA 5ECLB 1Z6NA 4PX1A 5H5QA 3R3EA 4OCFA 4LMVA 2GZZA 1GSEA 3RHCA 4EL1A 4HOJA 2C1YA 1K0NA 4MLYA 3NOFA 1GULA 2WRTA 2GZJA 2KR5A 4GR6A 3L9VA 3IK9A 5EVOA 3HD5A 3GHAA
chains in the Genus database with same CATH topology
3UARA 1KBNA 5EL8A 2DJ1A 1XW5A 1OC9B 1AW9A 2YCDA 2WGRA 4MABA 1M0UA 1QUWA 1TRWA 1IYHA 5D9WA 2JZTA 3GX8A 2LQOA 1UA5A 1K0BA 3V1WA 4POMA 4IQ1A 1V57A 1O81A 1NSWA 1F37A 2C3QA 3Q19A 4IELA 2GQLA 3P8WA 4RQXA 1O7UA 5INYA 4BVYA 3C8EA 5HFKA 2L4QA 4OFTA 4JU5A 2HZFA 2A2PA 19GSA 1OC3A 1OKDA 3APSA 1SYRA 4NV2A 1SK0A 4X43A 1TRVA 3LEFA 2MMNA 2TRCP 1ERUA 2VLTA 2YWOA 2XPEA 3TKSE 4TR4A 1IYIA 3GMFA 5IOXA 1GRXA 4HZ2A 3UOMA 1TI1A 1EGRA 5A4WA 1ZZYA 2R3XA 2H74A 4CDOA 2VCTA 1T3BA 1QXHA 2MMAA 5DQSA 1TRUA 1GUMA 4OMVA 2N5FA 2O89A 1ILOA 2MBTA 5JCUA 2IFQA 4O92A 4JZQA 6GSTA 3BCIA 2O87A 3DEXA 4I2TA 4IJ3A 4LL1B 5HFGA 3QDNA 1JHBA 4BL7A 5HR0A 1EOHA 4HI7A 5F0GA 1PKZA 1EP7A 5ECHB 4A5PA 4YQUA 2H0IA 3TKPA 2XC2A 1GSSA 1U3IA 2PUKC 3F4SA 3DYRA 3APOA 2YV7A 1TJDA 5DDLA 1MEKA 3L0HA 4I6XA 4IQAA 1GLQA 5IPHA 2GZYA 5B8AA 1THOA 16GSA 2QA1A 1OYJA 2GZPA 2O8VB 1NW2A 2F51A 6GSXA 4BVYB 3TJGA 3A2VA 2IMDA 5COHA 1Y6EA 3CSHA 5J41A 5KOXA 1GTAA 2VD1A 4ZILA 2WFCA 2VO4A 1V98A 4ILFA 2GTUA 5IQYA 3FEUA 4GLTA 5CREA 2H72A 4FYBA 1WP0A 3UL3A 1V40A 1U87A 5ECOB 3GKNA 5KOWA 3GL5A 3FKFA 3TOUA 3CSIA 3KEBA 2HSMA 3E0UA 4HJMA 2EIOA 3GKXA 4NHWA 2PERA 1JFUA 1U3AA 3FR6A 2AB6A 2IFQB 1FO5A 3KZQA 1AQVA 5EPFA 5C04A 1QMVA 4BL7B 2NVLA 3UMAA 2H75A 1ZOFA 3I69A 1SL0B 1GTIA 2R0GA 3F9UA 3K8NA 5J3RA 1AIUA 1VF1A 3IAS2 1ST9A 2LQQA 3HXSA 1TU7A 1TDIA 3I6AA 2H1DA 3N9JA 2FUG2 1GTUA 2E2MA 3PR8A 4K9ZA 5J9CA 1SD8A 3A2XA 2YWNA 3H8QA 2PGTA 1X9WB 4YKGA 3L9SA 5ELAA 3GV1A 4ZB8A 4JE1A 2DJ3A 3M3MA 1QK8A 1ZL9A 1BQ7A 4NHZA 5F05A 1XPVA 1HQOA 1VRSD 4POKA 1PL2A 5EY6A 2C0FA 4JR4A 4PGTA 2K9FA 4X0XA 2GSTA 5B6MA 3HZ4A 2XBQA 1W89A 2LTKA 3RDWA 4G9HA 5ECIB 1PGTA 2IL3A 5AGYA 2VL2C 3WT2A 4K5SA 3TRPA 4FQUA 6GSSA 3TJJA 20GSA 1A24A 1QQ2A 1WRYA 4F0BA 3LSZA 2JU5A 3FZ5A 5CRHA 2XPDA 3M8NA 2C0GA 5G5EA 2P0GA 1EZKA 2JZRA 4QL9A 1OE7A 1TXXA 5IO2A 1SK2A 4CY8A 2WULA 3DXBA 3GX0A 2IIYA 5BMUA 3WT1A 4JBBA 3CYNA 3IPZA 2HT9A 3EU3A 3TKSA 3EYTA 4OCEA 5JCGA 1MD4A 3G7IA 5C00A 1WOUA 3DMLA 4BA7A 1DBYA 1JLWA 1SD9A 4IW9A 1PMTA 3TB2A 3C1RA 1PN0A 4V2LA 4PNFA 2H6ZA 4PQ1A 2R6KA 4PUAA 3FK8A 4EE0A 2VLVA 4ULXA 5IMFA 1Z9HA 2DSAA 3FMWA 1EV4A 3KCMA 3MWHA 5A4VA 3US3A 4KCAA 2ON7A 2KLXA 3H79A 4PQHA 5B6NA 3KP9A 5KN2A 5ECMB 3TGZA 4BVXA 4HS1A 3MYDA 4XTSA 3TDGA 2RIIA 3UJ1A 14GSA 1F9MA 5ECQB 1XBSA 5IMAA 2YNXA 2CVDA 3GNJA 3F6FA 3M1GA 18GSA 3P90A 1ZMAA 2L57A 1X9MB 3CTGA 9GSSA 2B1KA 4YQVA 2KHPA 3EWLA 5CYYA 1XVWA 4HJ2A 3F3RA 1U6TA 4N0ZA 1WE0A 1PX6A 2UZ8A 1KEBA 3ZMLA 2DBCA 4ECCA 1PKWA 1WMJA 5KEJA 2H8LA 2N5BA 4EXJA 2YZHA 3VI7A 2LRNA 3EC3A 3BBYA 4JEDA 4MZBA 2P5QA 2AUVA 2AYTA 2FGXA 3EMPA 1S3CA 1A2JA 2PPTA 1XVQA 4HZ4A 4NXIA 1TK8B 3L9UA 4V1Ag 1R5PA 4V2MA 4IVFA 1F3BA 2GLRA 1B9XC 3IK7A 2RLIA 2H1AA 3IC4A 2FWHA 4O7HA 1J0FA 2G0FA 1X9SB 2FWGA 2HSYA 2H6XA 3ZLPA 2DKIA 3QAVA 3O76A 1TK0B 3HJOA 3TJKA 1AQXA 2L5LA 4K7NA 3ME7A 3UEMA 3LYPA 3KP8A 4N30A 3HA9A 3GSSA 5IOWA 2C0EA 3BJ5A 3GKMA 1MDKA 5IMZA 2O7KA 1BJXA 2CVKA 2YWIA 3HCZA 4TXOA 2CZ2A 1G0TA 1ZYQB 2H76A 3VFIA 1ZYNA 2VCWA 2VCXA 2LUSA 1TU8A 3KTLA 2FWEA 3WYWA 3ZTLA 3D0ZA 2LJAA 4ML6A 6GSWA 4K8MA 2C3NA 3H93A 4ID0A 2N5AA 4MH3A 1ZCPA 3P2AA 3DVXA 1KNGA 1SKWB 5DVBA 1LJRA 1HD2A 2FCHA 2QGVA 1V2AA 2LEGA 4L5LA 1HNCA 3UVTA 1A8LA 3TRXA 2HNLA 1YQ1A 1XZOA 4GSNA 3TJFA 3G7YA 1LU4A 1R7HA 2V2GA 3GKKA 5CRDA 3ERWA 4X1UA 4J56E 7GSSA 1T4ZA 5ECRB 2RM6A 3WGXA 3LG6A 2OE3A 5IPGA 3EMXA 3KIJA 1MDIA 4K7OA 2YWMA 1EP8A 2J23A 1ERWA 3IOSA 4EVMA 2C8UA 1YZXA 2I81A 1TRSA 5J4UA 5A5KA 4XRDA 1A0FA 2I1UA 3LW9A 4TXOB 3TCOA 3ZFLA 5DAKA 3ZIJA 4XS6A 1MTCA 5B8BA 1F3AA 2V1MA 1DE2A 1EWXA 4RUVA 4PQIA 2P5RA 4K5RA 2JSZA 4PURA 2YOIA 1S3DA 4OFNA 3LXZA 3HYPA 4XRAA 3GL3A 3IHGA 2H0GA 3J7Yb 5JCWA 4KF9A 2OA7A 1JZRA 2K8SA 4F9ZA 1XOBA 3SBCA 1SENA 4J2FA 1VGLA 4K7IA 2MMOA 1X5DA 3QPMA 3BD2A 3KD0A 2BMXA 3TKQA 3OR5A 3H1NA 2VD0A 10GSA 3CSJA 1AC1A 4KDYA 2ZNMA 1FHEA 2M46A 4PTSA 3TKSC 5FWGA 1SKSB 4N10A 2DMMA 1SJ6A 2IMIA 4V1Ap 4MF5A 2L6CA 4IBPA 3KMNA 2B1LA 3KH9A 2CZ3A 1J9BA 3FZ4A 4QQ7A 5D96A 5KN1A 4AF2A 2X99A 4MJEA 4F0CA 2QA2A 3IHQA 2K8VA 1M9BA 8GSSA 4KSMA 2V41A 4ECBA 3GYKA 1JZOA 5ECNB 3ZRDA 5ECPB 5CRGA 1QFNA 2GSQA 1B48A 4NMUA 2H66A 4MF7A 1CQGA 2Z9SA 4TR0A 4V2NA 5ECKB 1U88A 5E4WA 1B9YC 1SU9A 3E9JB 2DJJA 2IMFA 2V6KA 1TW9A 3A3TA 5DAKB 2ALBA 2H01A 3C1SA 5GZZB 1NHYA 2C4JA 3DKSA 3RPPA 2CQ9A 1MD3A 3VK9A 1ACVA 4TXVA 2OADA 4F2IA 4XIHA 4ZBAA 4Z7XA 1CQHA 4PUFC 2JL4A 1SJZA 4ZL9A 13GSA 2H1BA 2AHEA 2PMTA 4MZCA 4I8BA 4GWRA 3QOUA 4EC0A 1EV9A 2P31A 3E3EA 1FB6A 1V9WA 1VF2A 1UN2A 5DALA 5E59A 1AXDA 4MA9A 2GT5A 2CAQA 2LS5A 1EEJA 3C71A 1Q4JA 1O8WA 3LYKA 1GUKA 1XW9A 5A4UA 4WBJA 2ZCTA 4YAVA 2E0QA 2HLSA 4MPFA 4G2EA 1ZYPA 2O85A 3F4TA 1PQNA 3CTFA 4K2DA 4KGIA 2B3SA 4N0VA 4ZB9A 2DMLA 4YAPA 1G6YA 4K6XA 3HVVA 2PVOC 4KCEA 3IC8A 1GWCA 1R26A 4ZL8A 3IAM2 4CW9A 1XIYA 1WIKA 1GNWA 2PU9C 4MDCA 4YKFA 3A5IA 3FR9A 4DSQA 5DJLA 1K0OA 1VF4A 3EE2A 3EPTA 1PRXA 2EC4A 4LLRA 4QL7A 3EINA 4IKHA 3H4KA 3QD9A 3ISOA 4ECJA 1YEPA 1XWAA 4L0UA 2B7JA 2X49A 5L71A 2IJYA 2DJKA 1TOFA 1V58A 4TN8A 5HR1A 3G7JA 2YZUA 3I43A 2AJQB 2MZCA 5D73A 3FY7A 1XCCA 4WR5A 11GSA 3G9BA 1B8XA 5LNKe 3F6DA 4O5RA 3GTUA 4EO3A 1TTZA 5G5FA 2B6MA 2E2GA 1T1VA 1SL1B 2RUEA 5JWRB 2VUPA 5DALB 1XWCA 1DE1A 3KXOA 3ERFA 2QKEA 2C3TA 3Q74A 4IN0A 3LGCA 4D73A 1GLPA 3CRUA 1OVNA 3U6VA 1OKTA 4L5OA 2QSIA 1M2BA 3F63A 4MNNA 4HQZA 4LMWA 3BCKA 1NHOA 3DD3A 3QMXA 1GL8A 2GSRA 1YKCA 2IWTA 1FAAA 3M9JA 1FW1A 4TR1A 1MDJA 2LJKA 1C72A 2CX3A 3ZVJD 2VM2A 1SKRB 4KW6A 4FYUA 5AIXA 4X4JA 1BX9A 5ELGA 1UVZA 4JR6A 4WR4A 4TOPA 2LRCA 4DEJA 3VWVA 1TI3A 5CRWA 3HY2A 1ERTA 1ML6A 3FZ9A 3UAPA 2LKUA 1EEMA 3VWUA 3CMIA 1H4OA 2GT6A 1WJKA 2HI7A 2G2QA 5DCGA 1M7TA 1AUCA 2HRAA 4K1FA 2LRTA 4IGJA 5CO3A 5FT3A 4MH2A 4G19A 3F8UA 3J7Yk 4RI6A 2F8FA 3A2WA 2CA8A 2CT6A 4RQRA 3GIXA 1B4PA 4G0LA 2HYXA 4KX4A 2IPAA 2H6YA 4Z2RA 2R5GA 1SYXA 5IO0A 1T4YA 3W8SA 1N8JA 2OJLA 2AV4A 2B7KA 4EDZA 4K2XA 2RUFA 1X5EA 2L5OA 5H5RA 2H73A 4IP6A 1DSBA 2HSHA 3LFLA 3TJBA 3KM6A 1O85A 1I9DA 2RM5A 5H5SA 5AN1A 5HFIA 1GSDA 4EF0A 1B4QA 3A5WA 1ZYEA 4WEYA 1SL2B 2M72A 5GSSA 1HYUA 5ABRA 1M2AA 3TOTA 2KUCA 3IDVA 2H71A 5JWQB 4XCSA 1OC9A 4TR1B 3O6TA 2BTOT 1Z5YE 2WS2A 4FYCA 4GSTA 2VAFA 3UBKA 2VM1A 4POLA 3IRAA 3HJMA 1YDKA 4I97A 2FNOA 1XWBA 1WWJA 1Z6MA 2H70A 2A4HA 1I5GA 2YV9A 1JZDA 4BVXB 5D9VA 3UVHA 5ID2A 4DSSA 2JSYA 3FYGA 4ECIA 1PX7A 4I5QA 1ERVA 3ME8A 4MCUA 3GA4A 3KGKA 5G1LA 3IXRA 1GTBA 2LJRA 3DVWA 2LV3A 3PGTA 3WGEA 3BOAA 3VPQA 1XXUA 1SJIA 3GUSA 3L4NA 1K0MA 1O8XA 2C0DA 1X5CA 4NWYA 3LXTA 5ENUA 1TKDB 1A2LA 2H19A 2X4AA 2DC5A 3EURA 3ZYWA 4KSOA 5HQPA 2GSSA 4Q5QA 1Q98A 1Y25A 4KNDA 3F4RA 3QCPA 2L4CA 4IJIA 1A0RP 1K3YA 4KAEA 3EU4A 1RK4A 3DGQA 1GSYA 4WBRD 3QFBC 3P7XA 12GSA 1WPIA 2WZ9A 3FR3A 1JZWA 3D4TA 2YJ7A 2QC7A 1N2AA 2R0CA 3TUEA 1XFLA 4F03A 3Q18A 2X64A 3CRTA 3DIEA 5GSTA 2X8CA 3LJRA 3NZNA 3S9FA 4JRRA 5CP1A 2OKAA 3ZL5A 4NV5A 5F07A 1PN9A 4ZBDA 2WCIA 3HHVA 4USSA 1H75A 3FRCA 5ID2B 4DSSB 1K0CA 1EOGA 2IMKA 5DJMA 5KN3A 4TRXA 4ZL7A 1F2EA 1DUGA 1AQWA 3APQA 3D21A 3KJYA 4O5QA 1Z3EA 4ZBBA 2GQMA 3C7MA 4XS1A 1HNBA 2EIRA 4ML1A 3EVIA 5G1KA 4K0NA 5IMDA 2GQKA 5ECSA 2F9SA 5IIZA 2A2RA 4HUAA 2MYGA 5CNWA 17GSA 3GURA 4KDXA 3RBTA 1A23A 1EGOA 5J9BA 3IBHA 2I3YA 2XBIA 3IE3A 4MK3A 2FD3A 2JACA 2KOKA 1GP1A 1T00A 4ISDA 2IMEA 1GUHA 3D4MA 5LD0A 3UBLA 1KTEA 2OACA 2OBIA 4ICYA 3W8JA 2DLXA 2VCQA 2JADA 3L78A 1T8EB 2KP2A 1W4VA 4BWSA 4PXOA 2HXKA 4AJ6A 1FVJA 4BPYA 1M2DA 5GAND 1R5AA 4OFMA 4HU7A 2OE0A 3HVSA 2HRFA 3IV4A 4WF4A 3WGDA 1BYEA 3HVXA 3GFKA 1YF1A 4XS4A 3FZAA 4MP4A 3VWXA 2WDUA 4EIPA 4HQSA 3VPTA 2IN3A 4Q5NA 2YN1A 1G7EA 3WD6A 1THXA 2CVBA 3MIXA 4KUNA 4Q5RA 5G31A 1HNAA 2F3MA 3HJPA 4Z2UA 3D6IA 1S3AA 1FVKA 3CXGA 6GSVA 1G6WA 2DJ2A 1XOAA 4FO5A 4WKWA 4YH2A 4GQCA 1FOHA 2FWFA 1YF0A 5AISA 4DSRA 2YPMA 2MBSA 2YANA 5CAXA 3ZFBA 4KA0A 5KN0A 4O32A 4TW5A 2HFDA 3ZREA 4GCIA 1GH2A 3KMOA 1RQMA 3C73A 3GN3A 2HRNA 4NAXA 2GGTA 4CY6A 3PH9A 2FHEA 4HEA2 2PN8A 1LBKA 4NPBA 2BJXA 2X8HA 2NDOA 3QR6A 2B5XA 2X8GA 4OO5A 4Z2TA 2DKHA 3RAZA 4IP1A 3TKRA 1YEXA 4PNGA 1RW1A 5D9XA 3F3QA 4KB3A 4WETA 4IHUA 2DIZA 5F8BA 1R4WA 1USBA 2KP1A 3MSZA 4TR3A 4BWQA 4KDUA 3ZMKA 5DBQA 4I2UA 2YP6A 3IA1A 5IMCA 5DCHA 1JLVA 1GNEA 4GQFA 3RHBA 4G0KA 5BRTA 4XS4B 4WF5A 1OE8A 4CHSA 2GS3A 4MF6A 3N5OA 6GSUA 1Z7PA 2WJUA 1TP9A 2DIYA 2CX4A 4GXZA 1OC8A 3DWVA 5LCZA 1PA3A 4IS0A 4AJ7A 5F06A 2HZEA 5J5NA 3NIVA 1BG5A 5DQYA 2NBSA 2HRKA 3ED3A 2B5YA 1G7OA 1M99A 2J9HA 2ON5A 4EDYA 1XWKA 2GVPA 4GRFA 3UIWA 4RI7A 1ZGNA 4GTUA 2FLSA 1K3LA 2OE1A 4KE3A 2LNSA 3GRXA 5HR2A 2YJHA 3VLNA 1F6MC 4ZB6A 3ZITA 3MAKA 2HE3A 1K0DA 1K3OA 4OWYA 3RPNA 4H86A 3HDCA 3DRNA 1BEDA 1O73A 2K6VA 2PBJA 2FA4A 3D5JA 2E7PA 1SK1A 5AIVA 4HU9A 1PSQA 1ABAA 3ZIVA 1GSQA 4MJAA 3M9KA 4HDEA 3VI5A 3Q6OA 3F0IA 3MDKA 1T7PB 2K18A 4GSSA 4MJBA 3GHAA 2M80A 2A2SA 3I9V2 1OAZA 4LA1A 1VF3A 2VL9A 4MMMA 1YKAA 4POBA 6GSYA 2WB9A 1XW6A 5G2ZA 4XHMA 1X0RA 5FHIA 2L6DA 5B7CA 3U5RE 3SWLA 2VCZA 4WXTA 5D8IA 4G0IA 3VURA 4EUYA 3CBUA 4EKZA 3QAWA 4MJCA 3D22A 2V6OA 2LSTA 5D93A 2HZEB 4E8HA 3O3TA 3JCML 2ZUPA 2H1GA 1YJ6A 3VWWA 4N11A 2TRXA 1TK5B 4E8EA 3R2QA 1O6JA 3ERGA 2R2JA 2R4VA 2PWJA 2AAWA 2XHFA 3GTUB 5IM9A 1NM3A 4LL4B 1XWGA 3LQ7A 3GH9A 4G10A 4P3YB 4Q5FA 3TRQA 2B5EA 2LNTA 2D2ZA 3MNGA 3HZ8A 1PL1A 2REMA 1E6BA 2I9HA 4K0GA 4D73B 3KH7A 4L8EA 4GF0A 2H30A 2VL3A 2NPBA 3PINA 5HR3A 4OO4A 3GH6A 1GSFA 2DJ0A 4L0WA 1E2YA 4EIQA 1M9AA 3QFAC 2C80A 2CV4A 4AJ8A 5D9TA 2JZSA 3AY8A 3M0FA 2I4AA 2L59A 5JWOB 2FA8A 4OD7A 4KH7A 2EIQA 3QAGA 4YQMA 1PD21 1J08A 2VOCA 3PPUA 3ZZXA 4FH8A 1YY7A 3GSTA 2R0PA 4F82A 4MZWA 2VIMA 2TIRA 2NTOA 1A2MA 3FW2A 4ACSA 2F8AA 3KTBA 22GSA 2CAIA 2VCVA 4FIWA 2MMZA 4J57E 4TVEA 3W6GA 3IR4A 3LORA 4O5UA 1ON4A 2A4VA 1Z7RA 4ZXGA 2H0HA 2PVQA 4AGSA 1AAZA 1UC7A 3ZVJA 2V32A 1FB0A 1FOVA 1QGVA 1GSUA 1URMA 2FY6A 2OBKA 5IMVA 1BAYA 2VL2A 5GAPD 2R37A 5G30A 1FG4A 4DVCA 4ZIJA 2GDRA 2ES7A 1K0AA 4TKYA 3HKRA 3FHKA 2VLUA 4MPGA 1A8YA 5ECLB 1Z6NA 4PX1A 5H5QA 3R3EA 4OCFA 4LMVA 2GZZA 1GSEA 3RHCA 4EL1A 4HOJA 2C1YA 1K0NA 4MLYA 3NOFA 1GULA 2WRTA 3L9VA 3IK9A 5EVOA 3HD5A 3LWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UAR A;  1KBN A;  5EL8 A;  2DJ1 A;  1XW5 A;  1OC9 B;  1AW9 A;  2YCD A;  2WGR A;  4MAB A;  1M0U A;  1QUW A;  1TRW A;  1IYH A;  5D9W A;  2JZT A;  3GX8 A;  2LQO A;  1UA5 A;  1K0B A;  3V1W A;  4POM A;  4IQ1 A;  1V57 A;  1O81 A;  1NSW A;  1F37 A;  2C3Q A;  3Q19 A;  4IEL A;  2GQL A;  3P8W A;  4RQX A;  1O7U A;  5INY A;  4BVY A;  3C8E A;  5HFK A;  2L4Q A;  4OFT A;  4JU5 A;  2HZF A;  19GS A;  1OC3 A;  1OKD A;  3APS A;  1SYR A;  4NV2 A;  1SK0 A;  4X43 A;  1TRV A;  3LEF A;  2MMN A;  2TRC P;  1ERU A;  2VLT A;  2YWO A;  2XPE A;  3TKS E;  4TR4 A;  1IYI A;  3GMF A;  5IOX A;  1GRX A;  4HZ2 A;  3UOM A;  1TI1 A;  1EGR A;  5A4W A;  1ZZY A;  2R3X A;  2H74 A;  4CDO A;  2VCT A;  1T3B A;  1QXH A;  2MMA A;  5DQS A;  1TRU A;  1GUM A;  4OMV A;  2N5F A;  2O89 A;  1ILO A;  2MBT A;  5JCU A;  2IFQ A;  4O92 A;  4JZQ A;  6GST A;  3BCI A;  2O87 A;  3DEX A;  4I2T A;  4IJ3 A;  4LL1 B;  5HFG A;  3QDN A;  1JHB A;  4BL7 A;  5HR0 A;  1EOH A;  4HI7 A;  5F0G A;  1PKZ A;  1EP7 A;  5ECH B;  4YQU A;  2H0I A;  3TKP A;  2XC2 A;  1GSS A;  1U3I A;  2PUK C;  3F4S A;  3DYR A;  3APO A;  2YV7 A;  1TJD A;  5DDL A;  1MEK A;  3L0H A;  4I6X A;  4IQA A;  1GLQ A;  5IPH A;  2GZY A;  5B8A A;  1THO A;  16GS A;  1OYJ A;  2GZP A;  2O8V B;  1NW2 A;  2F51 A;  6GSX A;  3TJG A;  3A2V A;  2IMD A;  5COH A;  1Y6E A;  3CSH A;  5J41 A;  1GTA A;  2VD1 A;  4ZIL A;  2WFC A;  2VO4 A;  1V98 A;  4ILF A;  2GTU A;  5IQY A;  3FEU A;  4GLT A;  5CRE A;  2H72 A;  4FYB A;  1WP0 A;  3UL3 A;  1V40 A;  1U87 A;  5ECO B;  3GKN A;  3GL5 A;  3FKF A;  3TOU A;  3CSI A;  3KEB A;  3E0U A;  4HJM A;  2EIO A;  3GKX A;  4NHW A;  2PER A;  1JFU A;  1U3A A;  3FR6 A;  2AB6 A;  2IFQ B;  1FO5 A;  3KZQ A;  1AQV A;  5EPF A;  5C04 A;  1QMV A;  2NVL A;  3UMA A;  2H75 A;  1ZOF A;  3I69 A;  1SL0 B;  1GTI A;  3F9U A;  3K8N A;  5J3R A;  1AIU A;  1VF1 A;  3IAS 2;  1ST9 A;  2LQQ A;  3HXS A;  1TU7 A;  1TDI A;  3I6A A;  2H1D A;  3N9J A;  2FUG 2;  1GTU A;  2E2M A;  3PR8 A;  4K9Z A;  5J9C A;  1SD8 A;  3A2X A;  2YWN A;  3H8Q A;  2PGT A;  1X9W B;  3L9S A;  5ELA A;  3GV1 A;  4ZB8 A;  4JE1 A;  2DJ3 A;  3M3M A;  1QK8 A;  1ZL9 A;  1BQ7 A;  4NHZ A;  5F05 A;  1XPV A;  1HQO A;  1VRS D;  4POK A;  1PL2 A;  5EY6 A;  2C0F A;  4JR4 A;  4PGT A;  2K9F A;  4X0X A;  2GST A;  5B6M A;  3HZ4 A;  2XBQ A;  1W89 A;  2LTK A;  3RDW A;  4G9H A;  5ECI B;  1PGT A;  2IL3 A;  5AGY A;  2VL2 C;  3WT2 A;  3TRP A;  6GSS A;  3TJJ A;  20GS A;  1A24 A;  1QQ2 A;  1WRY A;  4F0B A;  3LSZ A;  2JU5 A;  3FZ5 A;  5CRH A;  2XPD A;  3M8N A;  2C0G A;  5G5E A;  2P0G A;  1EZK A;  2JZR A;  4QL9 A;  1OE7 A;  1TXX A;  5IO2 A;  1SK2 A;  2WUL A;  3DXB A;  3GX0 A;  2IIY A;  3WT1 A;  4JBB A;  3CYN A;  3IPZ A;  2HT9 A;  3EU3 A;  3TKS A;  3EYT A;  4OCE A;  5JCG A;  1MD4 A;  3G7I A;  5C00 A;  1WOU A;  3DML A;  4BA7 A;  1DBY A;  1JLW A;  1SD9 A;  4IW9 A;  1PMT A;  3TB2 A;  3C1R A;  4V2L A;  4PNF A;  2H6Z A;  4PQ1 A;  2R6K A;  4PUA A;  3FK8 A;  4EE0 A;  2VLV A;  4ULX A;  5IMF A;  1Z9H A;  2DSA A;  1EV4 A;  3KCM A;  3MWH A;  5A4V A;  3US3 A;  4KCA A;  2ON7 A;  2KLX A;  3H79 A;  4PQH A;  5B6N A;  3KP9 A;  5KN2 A;  5ECM B;  3TGZ A;  4BVX A;  4HS1 A;  4XTS A;  3TDG A;  2RII A;  3UJ1 A;  14GS A;  1F9M A;  5ECQ B;  1XBS A;  5IMA A;  2YNX A;  2CVD A;  3GNJ A;  3F6F A;  3M1G A;  18GS A;  3P90 A;  1ZMA A;  2L57 A;  1X9M B;  3CTG A;  9GSS A;  2B1K A;  4YQV A;  2KHP A;  3EWL A;  5CYY A;  1XVW A;  4HJ2 A;  3F3R A;  1U6T A;  4N0Z A;  1WE0 A;  1PX6 A;  1KEB A;  3ZML A;  2DBC A;  4ECC A;  1PKW A;  1WMJ A;  5KEJ A;  2H8L A;  2N5B A;  4EXJ A;  2YZH A;  3VI7 A;  2LRN A;  3EC3 A;  3BBY A;  4JED A;  4MZB A;  2P5Q A;  2AUV A;  2AYT A;  2FGX A;  3EMP A;  1S3C A;  1A2J A;  2PPT A;  1XVQ A;  4HZ4 A;  4NXI A;  1TK8 B;  3L9U A;  4V1A g;  1R5P A;  4V2M A;  4IVF A;  1F3B A;  2GLR A;  1B9X C;  3IK7 A;  2RLI A;  2H1A A;  3IC4 A;  2FWH A;  4O7H A;  1J0F A;  2G0F A;  1X9S B;  2FWG A;  2HSY A;  2H6X A;  3ZLP A;  3QAV A;  3O76 A;  1TK0 B;  3HJO A;  3TJK A;  1AQX A;  2L5L A;  4K7N A;  3ME7 A;  3UEM A;  3LYP A;  3KP8 A;  4N30 A;  3HA9 A;  3GSS A;  5IOW A;  2C0E A;  3BJ5 A;  3GKM A;  1MDK A;  5IMZ A;  2O7K A;  1BJX A;  2CVK A;  2YWI A;  3HCZ A;  4TXO A;  2CZ2 A;  1G0T A;  1ZYQ B;  2H76 A;  3VFI A;  2VCW A;  2VCX A;  2LUS A;  1TU8 A;  3KTL A;  2FWE A;  3WYW A;  3ZTL A;  3D0Z A;  2LJA A;  4ML6 A;  6GSW A;  4K8M A;  2C3N A;  3H93 A;  4ID0 A;  2N5A A;  4MH3 A;  1ZCP A;  3P2A A;  3DVX A;  1KNG A;  1SKW B;  5DVB A;  1LJR A;  1HD2 A;  2FCH A;  2QGV A;  1V2A A;  2LEG A;  4L5L A;  1HNC A;  3UVT A;  1A8L A;  3TRX A;  2HNL A;  1YQ1 A;  1XZO A;  4GSN A;  3TJF A;  3G7Y A;  1LU4 A;  1R7H A;  2V2G A;  3GKK A;  5CRD A;  3ERW A;  4X1U A;  4J56 E;  7GSS A;  1T4Z A;  5ECR B;  2RM6 A;  3WGX A;  3LG6 A;  2OE3 A;  5IPG A;  3EMX A;  3KIJ A;  1MDI A;  4K7O A;  2YWM A;  1EP8 A;  2J23 A;  1ERW A;  3IOS A;  4EVM A;  2C8U A;  1YZX A;  2I81 A;  1TRS A;  5J4U A;  5A5K A;  4XRD A;  1A0F A;  2I1U A;  4TXO B;  3TCO A;  3ZFL A;  5DAK A;  3ZIJ A;  4XS6 A;  1MTC A;  5B8B A;  1F3A A;  2V1M A;  1DE2 A;  1EWX A;  4RUV A;  4PQI A;  2P5R A;  2JSZ A;  4PUR A;  2YOI A;  1S3D A;  4OFN A;  3LXZ A;  3HYP A;  4XRA A;  3GL3 A;  2H0G A;  3J7Y b;  5JCW A;  2OA7 A;  1JZR A;  2K8S A;  4F9Z A;  1XOB A;  3SBC A;  1SEN A;  4J2F A;  1VGL A;  4K7I A;  2MMO A;  1X5D A;  3QPM A;  3BD2 A;  3KD0 A;  2BMX A;  3TKQ A;  3OR5 A;  3H1N A;  2VD0 A;  10GS A;  3CSJ A;  1AC1 A;  4KDY A;  2ZNM A;  1FHE A;  2M46 A;  3TKS C;  5FWG A;  1SKS B;  4N10 A;  2DMM A;  1SJ6 A;  2IMI A;  4V1A p;  4MF5 A;  2L6C A;  4IBP A;  3KMN A;  2B1L A;  3KH9 A;  2CZ3 A;  1J9B A;  3FZ4 A;  4QQ7 A;  5D96 A;  5KN1 A;  4AF2 A;  2X99 A;  4MJE A;  4F0C A;  3IHQ A;  2K8V A;  1M9B A;  8GSS A;  4KSM A;  2V41 A;  4ECB A;  3GYK A;  1JZO A;  5ECN B;  3ZRD A;  5ECP B;  5CRG A;  1QFN A;  2GSQ A;  1B48 A;  4NMU A;  2H66 A;  4MF7 A;  1CQG A;  2Z9S A;  4TR0 A;  4V2N A;  5ECK B;  1U88 A;  5E4W A;  1B9Y C;  1SU9 A;  3E9J B;  2DJJ A;  2IMF A;  2V6K A;  1TW9 A;  3A3T A;  5DAK B;  2ALB A;  2H01 A;  3C1S A;  5GZZ B;  1NHY A;  2C4J A;  3DKS A;  3RPP A;  2CQ9 A;  1MD3 A;  3VK9 A;  1ACV A;  4TXV A;  2OAD A;  4F2I A;  4XIH A;  4ZBA A;  4Z7X A;  1CQH A;  4PUF C;  2JL4 A;  1SJZ A;  4ZL9 A;  13GS A;  2H1B A;  2AHE A;  2PMT A;  4MZC A;  4I8B A;  4GWR A;  3QOU A;  4EC0 A;  1EV9 A;  2P31 A;  3E3E A;  1FB6 A;  1V9W A;  1VF2 A;  1UN2 A;  5E59 A;  5DAL A;  1AXD A;  4MA9 A;  2GT5 A;  2CAQ A;  2LS5 A;  1EEJ A;  3C71 A;  1Q4J A;  1O8W A;  3LYK A;  1GUK A;  1XW9 A;  5A4U A;  4WBJ A;  2ZCT A;  4YAV A;  2E0Q A;  2HLS A;  4MPF A;  4G2E A;  2O85 A;  3F4T A;  1PQN A;  3CTF A;  4K2D A;  4KGI A;  2B3S A;  4N0V A;  4ZB9 A;  2DML A;  4YAP A;  1G6Y A;  4K6X A;  3HVV A;  2PVO C;  4KCE A;  1GWC A;  1R26 A;  4ZL8 A;  3IAM 2;  4CW9 A;  1XIY A;  1WIK A;  1GNW A;  2PU9 C;  4MDC A;  3FR9 A;  4DSQ A;  5DJL A;  1K0O A;  1VF4 A;  3EE2 A;  1PRX A;  2EC4 A;  4LLR A;  4QL7 A;  3EIN A;  4IKH A;  3H4K A;  3QD9 A;  3ISO A;  4ECJ A;  1YEP A;  1XWA A;  4L0U A;  2B7J A;  5L71 A;  2IJY A;  2DJK A;  1TOF A;  1V58 A;  4TN8 A;  5HR1 A;  3G7J A;  2YZU A;  3I43 A;  2AJQ B;  2MZC A;  5D73 A;  3FY7 A;  1XCC A;  4WR5 A;  11GS A;  3G9B A;  1B8X A;  5LNK e;  3F6D A;  4O5R A;  3GTU A;  4EO3 A;  1TTZ A;  5G5F A;  2B6M A;  2E2G A;  1T1V A;  1SL1 B;  2RUE A;  5JWR B;  2VUP A;  5DAL B;  1XWC A;  1DE1 A;  3KXO A;  3ERF A;  2QKE A;  2C3T A;  3Q74 A;  4IN0 A;  3LGC A;  4D73 A;  1GLP A;  3CRU A;  1OVN A;  3U6V A;  1OKT A;  4L5O A;  2QSI A;  1M2B A;  3F63 A;  4HQZ A;  4LMW A;  3BCK A;  1NHO A;  3DD3 A;  3QMX A;  1GL8 A;  2GSR A;  1YKC A;  2IWT A;  1FAA A;  3M9J A;  1FW1 A;  4TR1 A;  1MDJ A;  2LJK A;  1C72 A;  2CX3 A;  3ZVJ D;  2VM2 A;  1SKR B;  4KW6 A;  4FYU A;  5AIX A;  1BX9 A;  5ELG A;  1UVZ A;  4JR6 A;  4WR4 A;  4TOP A;  2LRC A;  4DEJ A;  3VWV A;  1TI3 A;  5CRW A;  3HY2 A;  1ERT A;  1ML6 A;  3FZ9 A;  3UAP A;  2LKU A;  1EEM A;  3VWU A;  3CMI A;  1H4O A;  2GT6 A;  1WJK A;  2HI7 A;  2G2Q A;  5DCG A;  1M7T A;  1AUC A;  4K1F A;  2LRT A;  4IGJ A;  5CO3 A;  5FT3 A;  4MH2 A;  4G19 A;  3F8U A;  3J7Y k;  4RI6 A;  2F8F A;  3A2W A;  2CA8 A;  2CT6 A;  4RQR A;  3GIX A;  1B4P A;  2HYX A;  4KX4 A;  2IPA A;  2H6Y A;  2R5G A;  1SYX A;  5IO0 A;  1T4Y A;  3W8S A;  1N8J A;  2OJL A;  2AV4 A;  2B7K A;  4EDZ A;  2RUF A;  1X5E A;  2L5O A;  5H5R A;  2H73 A;  4IP6 A;  1DSB A;  2HSH A;  3LFL A;  3TJB A;  3KM6 A;  1O85 A;  1I9D A;  2RM5 A;  5H5S A;  5AN1 A;  5HFI A;  1GSD A;  4EF0 A;  1B4Q A;  3A5W A;  1ZYE A;  4WEY A;  1SL2 B;  2M72 A;  5GSS A;  1HYU A;  5ABR A;  1M2A A;  3TOT A;  2KUC A;  3IDV A;  2H71 A;  5JWQ B;  4XCS A;  1OC9 A;  4TR1 B;  3O6T A;  2BTO T;  1Z5Y E;  2WS2 A;  4FYC A;  4GST A;  2VAF A;  3UBK A;  2VM1 A;  4POL A;  3IRA A;  3HJM A;  1YDK A;  4I97 A;  2FNO A;  1XWB A;  1WWJ A;  1Z6M A;  2H70 A;  1I5G A;  2YV9 A;  1JZD A;  5D9V A;  3UVH A;  5ID2 A;  4DSS A;  2JSY A;  3FYG A;  4ECI A;  1PX7 A;  4I5Q A;  1ERV A;  3ME8 A;  4MCU A;  3GA4 A;  3KGK A;  5G1L A;  3IXR A;  1GTB A;  2LJR A;  3DVW A;  2LV3 A;  3PGT A;  3WGE A;  3BOA A;  3VPQ A;  1XXU A;  1SJI A;  3GUS A;  3L4N A;  1K0M A;  1O8X A;  2C0D A;  1X5C A;  4NWY A;  3LXT A;  5ENU A;  1TKD B;  1A2L A;  2H19 A;  2DC5 A;  3EUR A;  3ZYW A;  4KSO A;  5HQP A;  2GSS A;  4Q5Q A;  1Q98 A;  1Y25 A;  4KND A;  3F4R A;  3QCP A;  2L4C A;  4IJI A;  1A0R P;  1K3Y A;  4KAE A;  3EU4 A;  1RK4 A;  3DGQ A;  1GSY A;  4WBR D;  3QFB C;  3P7X A;  12GS A;  1WPI A;  2WZ9 A;  3FR3 A;  1JZW A;  3D4T A;  2YJ7 A;  2QC7 A;  1N2A A;  3TUE A;  1XFL A;  4F03 A;  3Q18 A;  2X64 A;  3CRT A;  3DIE A;  5GST A;  2X8C A;  3LJR A;  3NZN A;  3S9F A;  4JRR A;  5CP1 A;  2OKA A;  3ZL5 A;  4NV5 A;  5F07 A;  1PN9 A;  4ZBD A;  2WCI A;  3HHV A;  1H75 A;  3FRC A;  5ID2 B;  4DSS B;  1K0C A;  1EOG A;  2IMK A;  5DJM A;  5KN3 A;  4TRX A;  4ZL7 A;  1F2E A;  1DUG A;  1AQW A;  3APQ A;  3D21 A;  3KJY A;  1Z3E A;  4ZBB A;  2GQM A;  3C7M A;  4XS1 A;  1HNB A;  2EIR A;  4ML1 A;  3EVI A;  5G1K A;  4K0N A;  5IMD A;  2GQK A;  5ECS A;  2F9S A;  5IIZ A;  2A2R A;  4HUA A;  2MYG A;  5CNW A;  17GS A;  3GUR A;  4KDX A;  3RBT A;  1A23 A;  1EGO A;  5J9B A;  3IBH A;  2I3Y A;  2XBI A;  3IE3 A;  4MK3 A;  2FD3 A;  2JAC A;  2KOK A;  1GP1 A;  1T00 A;  4ISD A;  2IME A;  1GUH A;  3D4M A;  5LD0 A;  3UBL A;  1KTE A;  2OAC A;  2OBI A;  3W8J A;  2DLX A;  2VCQ A;  2JAD A;  3L78 A;  1T8E B;  2KP2 A;  1W4V A;  4BWS A;  4PXO A;  2HXK A;  4AJ6 A;  1FVJ A;  4BPY A;  1M2D A;  5GAN D;  1R5A A;  4OFM A;  4HU7 A;  2OE0 A;  3HVS A;  2HRF A;  3IV4 A;  4WF4 A;  3WGD A;  1BYE A;  3HVX A;  3GFK A;  1YF1 A;  4XS4 A;  3FZA A;  4MP4 A;  3VWX A;  2WDU A;  4HQS A;  3VPT A;  2IN3 A;  4Q5N A;  2YN1 A;  1G7E A;  3WD6 A;  1THX A;  2CVB A;  4KUN A;  4Q5R A;  5G31 A;  1HNA A;  2F3M A;  3HJP A;  3D6I A;  1S3A A;  1FVK A;  3CXG A;  6GSV A;  1G6W A;  2DJ2 A;  1XOA A;  4FO5 A;  4WKW A;  4YH2 A;  4GQC A;  2FWF A;  1YF0 A;  5AIS A;  4DSR A;  2YPM A;  2MBS A;  2YAN A;  5CAX A;  3ZFB A;  4KA0 A;  5KN0 A;  4O32 A;  4TW5 A;  2HFD A;  3ZRE A;  4GCI A;  1GH2 A;  3KMO A;  1RQM A;  3C73 A;  3GN3 A;  2HRN A;  4NAX A;  2GGT A;  3PH9 A;  2FHE A;  4HEA 2;  2PN8 A;  1LBK A;  4NPB A;  2BJX A;  2X8H A;  2NDO A;  3QR6 A;  2B5X A;  2X8G A;  4OO5 A;  3RAZ A;  4IP1 A;  3TKR A;  1YEX A;  4PNG A;  1RW1 A;  5D9X A;  3F3Q A;  4KB3 A;  4WET A;  4IHU A;  2DIZ A;  5F8B A;  1R4W A;  1USB A;  2KP1 A;  3MSZ A;  4TR3 A;  4BWQ A;  4KDU A;  3ZMK A;  5DBQ A;  4I2U A;  2YP6 A;  3IA1 A;  5IMC A;  5DCH A;  1JLV A;  1GNE A;  4GQF A;  3RHB A;  4XS4 B;  4WF5 A;  1OE8 A;  4CHS A;  2GS3 A;  4MF6 A;  3N5O A;  6GSU A;  1Z7P A;  2WJU A;  1TP9 A;  2DIY A;  2CX4 A;  4GXZ A;  1OC8 A;  3DWV A;  5LCZ A;  1PA3 A;  4IS0 A;  4AJ7 A;  5F06 A;  2HZE A;  5J5N A;  3NIV A;  1BG5 A;  5DQY A;  2NBS A;  3ED3 A;  2B5Y A;  1G7O A;  1M99 A;  2J9H A;  2ON5 A;  4EDY A;  1XWK A;  2GVP A;  4GRF A;  3UIW A;  4RI7 A;  1ZGN A;  4GTU A;  2FLS A;  1K3L A;  2OE1 A;  4KE3 A;  2LNS A;  3GRX A;  5HR2 A;  2YJH A;  3VLN A;  1F6M C;  4ZB6 A;  3ZIT A;  3MAK A;  2HE3 A;  1K0D A;  1K3O A;  4OWY A;  3RPN A;  4H86 A;  3HDC A;  3DRN A;  1BED A;  1O73 A;  2K6V A;  2PBJ A;  2FA4 A;  3D5J A;  2E7P A;  1SK1 A;  5AIV A;  4HU9 A;  1PSQ A;  1ABA A;  3ZIV A;  1GSQ A;  4MJA A;  3M9K A;  4HDE A;  3VI5 A;  3Q6O A;  3F0I A;  3MDK A;  1T7P B;  2K18 A;  4GSS A;  4MJB A;  3GHA A;  2M80 A;  2A2S A;  3I9V 2;  1OAZ A;  4LA1 A;  1VF3 A;  2VL9 A;  4MMM A;  1YKA A;  4POB A;  6GSY A;  2WB9 A;  1XW6 A;  5G2Z A;  4XHM A;  1X0R A;  5FHI A;  2L6D A;  5B7C A;  3U5R E;  3SWL A;  2VCZ A;  4WXT A;  5D8I A;  3VUR A;  4EUY A;  3CBU A;  4EKZ A;  3QAW A;  4MJC A;  3D22 A;  2V6O A;  2LST A;  5D93 A;  2HZE B;  4E8H A;  3O3T A;  3JCM L;  2ZUP A;  2H1G A;  1YJ6 A;  3VWW A;  4N11 A;  2TRX A;  1TK5 B;  4E8E A;  3R2Q A;  1O6J A;  3ERG A;  2R2J A;  2R4V A;  2PWJ A;  2AAW A;  2XHF A;  3GTU B;  5IM9 A;  1NM3 A;  4LL4 B;  1XWG A;  3LQ7 A;  3GH9 A;  4G10 A;  4P3Y B;  4Q5F A;  3TRQ A;  2B5E A;  2LNT A;  2D2Z A;  3MNG A;  3HZ8 A;  1PL1 A;  2REM A;  1E6B A;  2I9H A;  4K0G A;  4D73 B;  3KH7 A;  4L8E A;  4GF0 A;  2H30 A;  2VL3 A;  2NPB A;  3PIN A;  5HR3 A;  4OO4 A;  3GH6 A;  1GSF A;  2DJ0 A;  4L0W A;  1E2Y A;  1M9A A;  3QFA C;  2C80 A;  2CV4 A;  4AJ8 A;  5D9T A;  2JZS A;  3AY8 A;  3M0F A;  2I4A A;  2L59 A;  5JWO B;  2FA8 A;  4OD7 A;  4KH7 A;  2EIQ A;  3QAG A;  4YQM A;  1PD2 1;  1J08 A;  2VOC A;  3ZZX A;  4FH8 A;  1YY7 A;  3GST A;  4F82 A;  4MZW A;  2VIM A;  2TIR A;  2NTO A;  1A2M A;  3FW2 A;  4ACS A;  2F8A A;  3KTB A;  22GS A;  2CAI A;  2VCV A;  4FIW A;  2MMZ A;  4J57 E;  4TVE A;  3W6G A;  3IR4 A;  3LOR A;  1ON4 A;  2A4V A;  1Z7R A;  4ZXG A;  2H0H A;  2PVQ A;  4AGS A;  1AAZ A;  1UC7 A;  3ZVJ A;  2V32 A;  1FB0 A;  1FOV A;  1QGV A;  1GSU A;  1URM A;  2FY6 A;  2OBK A;  5IMV A;  1BAY A;  2VL2 A;  5GAP D;  2R37 A;  5G30 A;  1FG4 A;  4DVC A;  4ZIJ A;  2GDR A;  2ES7 A;  1K0A A;  4TKY A;  3HKR A;  3FHK A;  2VLU A;  4MPG A;  1A8Y A;  5ECL B;  1Z6N A;  4PX1 A;  5H5Q A;  4OCF A;  4LMV A;  2GZZ A;  1GSE A;  3RHC A;  4EL1 A;  4HOJ A;  2C1Y A;  1K0N A;  4MLY A;  3NOF A;  1GUL A;  2WRT A;  3L9V A;  3IK9 A;  5EVO A;  3HD5 A;  3LWA A; 
#chains in the Genus database with same CATH topology
 3UAR A;  1KBN A;  5EL8 A;  2DJ1 A;  1XW5 A;  1OC9 B;  1AW9 A;  2YCD A;  2WGR A;  2PEJ A;  4MAB A;  1M0U A;  1QUW A;  2XT1 A;  1TRW A;  1IYH A;  2EFJ A;  5D9W A;  2JZT A;  3GX8 A;  2LQO A;  1UA5 A;  1K0B A;  3V1W A;  4POM A;  4IQ1 A;  1V57 A;  1O81 A;  1NSW A;  1F37 A;  2C3Q A;  3Q19 A;  1VQ8 P;  4IEL A;  2GQL A;  3P8W A;  4RQX A;  1O7U A;  5INY A;  4BVY A;  3C8E A;  5HFK A;  2L4Q A;  4OFT A;  4JU5 A;  2HZF A;  4H2Y C;  4XFY A;  19GS A;  1OC3 A;  1OKD A;  2A2P A;  3APS A;  1SYR A;  4NV2 A;  1SK0 A;  4X43 A;  2K92 A;  1ACP A;  1TRV A;  3LEF A;  2MMN A;  3MGE A;  2TRC P;  2KGC A;  1ERU A;  2VLT A;  5F2N A;  2YWO A;  2XPE A;  3TKS E;  4TR4 A;  1IYI A;  3GMF A;  5IOX A;  1GRX A;  4HZ2 A;  3UOM A;  1TI1 A;  1EGR A;  1M3I A;  5A4W A;  1ZZY A;  2R3X A;  2H74 A;  4CDO A;  4U0D A;  2VCT A;  1T3B A;  1QXH A;  2MMA A;  5DQS A;  1TRU A;  1GUM A;  2KGD A;  4OMV A;  2N5F A;  2O89 A;  1ILO A;  1KC8 Q;  2MBT A;  5JCU A;  2IFQ A;  4O92 A;  4JZQ A;  6GST A;  3BCI A;  2O87 A;  3DEX A;  4I2T A;  4IJ3 A;  4LL1 B;  5HFG A;  2KOO A;  3QDN A;  1JHB A;  4BL7 A;  5HR0 A;  1EOH A;  4HI7 A;  2FHS C;  5JPA A;  5F0G A;  1PKZ A;  1EP7 A;  1ZMB A;  5ECH B;  4A5P A;  4CA3 A;  4YQU A;  2XXM A;  2H0I A;  3TKP A;  2XC2 A;  1GSS A;  1U3I A;  2PUK C;  3F4S A;  3DYR A;  3APO A;  2YV7 A;  3HYB A;  1A8O A;  1TJD A;  5DDL A;  1MEK A;  3L0H A;  4I6X A;  4IQA A;  1GLQ A;  5IPH A;  2GZY A;  5B8A A;  1THO A;  16GS A;  2QA1 A;  1OYJ A;  2GZP A;  2O8V B;  1NW2 A;  2F51 A;  6GSX A;  4BVY B;  3TJG A;  3A2V A;  3CCE P;  2IMD A;  3CE7 A;  5COH A;  1Y6E A;  3CSH A;  2PY8 A;  5J41 A;  5KOX A;  1GTA A;  3H4E A;  2VD1 A;  1K73 Q;  4ZIL A;  2WFC A;  5HGL A;  2VO4 A;  1V98 A;  2KG9 A;  4ILF A;  1Q82 Q;  1CEI A;  3G0V A;  2GTU A;  5IQY A;  3FEU A;  4GLT A;  5CRE A;  2H72 A;  4FYB A;  2K0X A;  5EW5 E;  1WP0 A;  3UL3 A;  1V40 A;  1U87 A;  5ECO B;  3CPW O;  3GKN A;  5KOW A;  3GL5 A;  3G29 A;  3FKF A;  3DS4 A;  3TOU A;  3CSI A;  3KEB A;  3GKL C;  2HSM A;  3E0U A;  4HJM A;  2EG5 A;  2EIO A;  3GKX A;  1K9M Q;  4NHW A;  2PER A;  4PH1 A;  5HGO A;  1JFU A;  1U3A A;  3FR6 A;  2AB6 A;  2IFQ B;  1FO5 A;  3KZQ A;  1AQV A;  5EPF A;  5C04 A;  1QMV A;  4BL7 B;  2NVL A;  3G1I A;  3UMA A;  2H75 A;  1ZOF A;  2CGQ A;  3I69 A;  1SL0 B;  1GTI A;  2PEQ A;  2R0G A;  3F9U A;  3K8N A;  5J3R A;  1AIU A;  1VF1 A;  3IAS 2;  1ST9 A;  2LQQ A;  3HXS A;  1TU7 A;  1TDI A;  3I6A A;  2H1D A;  3N9J A;  2FUG 2;  1GTU A;  2E2M A;  3PR8 A;  4K9Z A;  1Q7Y Q;  5J9C A;  1SD8 A;  3A2X A;  2YWN A;  3H8Q A;  2PGT A;  1X9W B;  4YKG A;  3L9S A;  5ELA A;  3GV1 A;  4ZB8 A;  4JE1 A;  2DJ3 A;  3M3M A;  1QK8 A;  1ZL9 A;  1BQ7 A;  4NHZ A;  5F05 A;  1XPV A;  1HQO A;  1VRS D;  2CQ8 A;  4POK A;  2VLQ A;  1PL2 A;  2C0F A;  5EY6 A;  3DPH A;  4JR4 A;  4PGT A;  2K9F A;  2K93 A;  2MF4 A;  4X0X A;  2GST A;  5B6M A;  3HZ4 A;  2XBQ A;  1W89 A;  3HZQ A;  2LTK A;  3RDW A;  2K5X A;  4G9H A;  5ECI B;  1PGT A;  2IL3 A;  5AGY A;  1ZNV A;  2VL2 C;  3WT2 A;  4K5S A;  4BPH A;  2XZ1 C;  3TRP A;  4FQU A;  6GSS A;  3TJJ A;  20GS A;  1A24 A;  3CCQ P;  1QQ2 A;  1WRY A;  4F0B A;  3LSZ A;  2JU5 A;  3FZ5 A;  5CRH A;  2XPD A;  3M8N A;  2C0G A;  5G5E A;  2P0G A;  2JZR A;  1EZK A;  4QL9 A;  1OE7 A;  1TXX A;  5IO2 A;  1SK2 A;  4CY8 A;  2WUL A;  3DXB A;  1VKU A;  1N8R Q;  3GX0 A;  2IIY A;  5BMU A;  3WT1 A;  4JBB A;  3CYN A;  3IPZ A;  2HT9 A;  3EU3 A;  3TKS A;  3G26 A;  3EYT A;  4OCE A;  5JCG A;  1MD4 A;  3G7I A;  5C00 A;  1WOU A;  3DML A;  4BA7 A;  1DBY A;  1JLW A;  1SD9 A;  4IW9 A;  1PMT A;  3TB2 A;  3C1R A;  1PN0 A;  4BIK A;  4V2L A;  4PNF A;  2H6Z A;  4U0F A;  3CC2 P;  4PQ1 A;  2R6K A;  4PUA A;  3FK8 A;  4HKG A;  4EE0 A;  2VLV A;  4ULX A;  5IMF A;  1Z9H A;  2DSA A;  3FMW A;  1EV4 A;  3KCM A;  3MWH A;  1L0H A;  5KP6 B;  1E6J P;  5A4V A;  4U0E A;  3US3 A;  4KCA A;  2GDY A;  2ON7 A;  2KLX A;  3H79 A;  4PQH A;  5B6N A;  3KP9 A;  5KN2 A;  5ECM B;  3TGZ A;  1HQB A;  4BVX A;  4HS1 A;  3MYD A;  4XTS A;  3TDG A;  2RII A;  3UJ1 A;  14GS A;  1F9M A;  5ECQ B;  1XBS A;  5IMA A;  2YNX A;  2CVD A;  3GNJ A;  3F6F A;  3M1G A;  18GS A;  3P90 A;  1VQN P;  1ZMA A;  2L57 A;  1X9M B;  2QA4 P;  3CTG A;  2KOQ A;  9GSS A;  3G21 A;  2B1K A;  3RG6 C;  4YQV A;  2KHP A;  3EWL A;  5CYY A;  1XVW A;  4HJ2 A;  2PEI A;  3F3R A;  4HSC X;  1U6T A;  4N0Z A;  4BPG A;  5DCK A;  1PX6 A;  1WE0 A;  2UZ8 A;  1KEB A;  3ZML A;  2DBC A;  4ECC A;  1PKW A;  1WMJ A;  5KEJ A;  2H8L A;  2N5B A;  4EXJ A;  3G6E P;  2QNW A;  2YZH A;  3VI7 A;  2LRN A;  3EC3 A;  3BBY A;  4JED A;  4MZB A;  3M1M A;  2P5Q A;  2AUV A;  2AYT A;  2FGX A;  3EMP A;  1S3C A;  1A2J A;  2PPT A;  1KQS O;  1XVQ A;  4HZ4 A;  1QRJ A;  4NXI A;  1TK8 B;  3L9U A;  1Q81 Q;  4V1A g;  1R5P A;  2BHV A;  4V2M A;  4IVF A;  1F3B A;  2GLR A;  1B9X C;  3IK7 A;  2RLI A;  2H1A A;  3IC4 A;  2FWH A;  4O7H A;  1J0F A;  2G0F A;  1X9S B;  2FWG A;  2HSY A;  2H6X A;  3ZLP A;  2DKI A;  3QAV A;  3O76 A;  1TK0 B;  3HJO A;  3TJK A;  1AQX A;  2L5L A;  4K7N A;  3ME7 A;  4IPY A;  3LYP A;  3UEM A;  3CCL P;  3KP8 A;  4N30 A;  2PNG A;  2PEK A;  3HA9 A;  3GSS A;  5IOW A;  2C0E A;  3BJ5 A;  3GKM A;  1MDK A;  5IMZ A;  2MVV A;  2O7K A;  1BJX A;  2CVK A;  2YWI A;  3HCZ A;  4TXO A;  2CZ2 A;  2N6Y A;  1G0T A;  3CCV P;  1ZYQ B;  3DS2 A;  2H76 A;  3VFI A;  1ZYN A;  2VCW A;  2VCX A;  2LUS A;  1TU8 A;  3KTL A;  4COP A;  1MZ8 A;  2FWE A;  3WYW A;  3ZTL A;  3D0Z A;  2GZI A;  2LJA A;  4ML6 A;  6GSW A;  4K8M A;  3DS0 A;  2C3N A;  1PFO A;  1M6E X;  3H93 A;  4ID0 A;  2AFE A;  2N5A A;  4MH3 A;  3LMO A;  4COC A;  1ZCP A;  3H0D A;  3Q20 A;  3P2A A;  1RO2 A;  3DVX A;  1KNG A;  1SKW B;  5DVB A;  1LJR A;  1HD2 A;  2FCH A;  2QGV A;  4XRQ A;  1V2A A;  2LEG A;  4L5L A;  1HNC A;  3UVT A;  2WPT A;  1A8L A;  3TRX A;  2HNL A;  1YQ1 A;  1XZO A;  2JGP A;  4GSN A;  3TJF A;  3G7Y A;  1A43 A;  2MVU A;  1VQ7 P;  1LU4 A;  1R7H A;  2V2G A;  3GKK A;  5CRD A;  3ERW A;  4X1U A;  4J56 E;  7GSS A;  1T4Z A;  1NQ4 A;  5ECR B;  3CD6 P;  2RM6 A;  3WGX A;  2GZE A;  3LG6 A;  2OE3 A;  5IPG A;  3EMX A;  3CCU P;  3KIJ A;  1MDI A;  4K7O A;  2YWM A;  1EP8 A;  2J23 A;  1ERW A;  3IOS A;  4EVM A;  2C8U A;  1YZX A;  2I81 A;  3CMA P;  1TRS A;  1VHN A;  5J4U A;  5A5K A;  4XRD A;  2JBG A;  1A0F A;  2I1U A;  3LW9 A;  4TXO B;  3TCO A;  1JJ2 O;  5DAK A;  3ZFL A;  3ZIJ A;  4XS6 A;  1MTC A;  5B8B A;  1F3A A;  2V1M A;  1DE2 A;  1EWX A;  4RUV A;  4PQI A;  2P5R A;  4K5R A;  2JSZ A;  4PUR A;  2YOI A;  1S3D A;  4OFN A;  3LXZ A;  3HYP A;  2NO8 A;  4XRA A;  3GL3 A;  3IHG A;  1T8K A;  2H0G A;  3J7Y b;  5JCW A;  4KF9 A;  2OA7 A;  2M8P A;  1JZR A;  2K8S A;  4F9Z A;  1XOB A;  3SBC A;  1SEN A;  4J2F A;  1VGL A;  4K7I A;  2MMO A;  1X5D A;  4BPF A;  3QPM A;  3BD2 A;  3KD0 A;  2BMX A;  2N98 A;  2K2Q A;  2PEM A;  3TKQ A;  2ONT A;  2EHT A;  3OR5 A;  3H1N A;  2DGY A;  2VD0 A;  10GS A;  3CSJ A;  1AC1 A;  4KDY A;  2FQ0 A;  1AF8 A;  2ZNM A;  1FHE A;  2M46 A;  4PTS A;  3TKS C;  5FWG A;  1SKS B;  4N10 A;  2DMM A;  1SJ6 A;  2IMI A;  1F80 D;  4V1A p;  4MF5 A;  2L6C A;  4IBP A;  3KMN A;  2B1L A;  3G4S P;  3KH9 A;  2CZ3 A;  1J9B A;  1S72 P;  3FZ4 A;  4QQ7 A;  5D96 A;  5KN1 A;  4AF2 A;  2KWL A;  1IMP A;  2X99 A;  1E0H A;  4MJE A;  4F0C A;  2QA2 A;  2GZF A;  3IHQ A;  2K8V A;  1M9B A;  8GSS A;  4KSM A;  2V41 A;  4ECB A;  3GYK A;  1JZO A;  5ECN B;  2CNR A;  3ZRD A;  5ECP B;  5CRG A;  1QFN A;  2GSQ A;  1B48 A;  4NMU A;  2H66 A;  4MF7 A;  1CQG A;  7CEI A;  2Z9S A;  4TR0 A;  4V2N A;  5ECK B;  1U88 A;  5E4W A;  1B9Y C;  1SU9 A;  3E9J B;  2VLP A;  2DJJ A;  2IMF A;  2V6K A;  1M6N A;  1TW9 A;  3A3T A;  5DAK B;  2ALB A;  2H01 A;  5HGN A;  3C1S A;  5GZZ B;  1NHY A;  2ERH A;  2C4J A;  3DKS A;  3RPP A;  1EMV A;  2CQ9 A;  2N5H A;  4F37 A;  1MD3 A;  3VK9 A;  1ACV A;  4TXV A;  2OAD A;  4F2I A;  1Q86 Q;  4XIH A;  4ZBA A;  4Z7X A;  1CQH A;  5F2O A;  4PUF C;  2KOD A;  2JL4 A;  4WYM A;  1SJZ A;  1VQ5 P;  13GS A;  1VQ9 P;  2AHE A;  2H1B A;  4ZL9 A;  2VSQ A;  2PMT A;  4MZC A;  4I8B A;  4GWR A;  4XFX A;  2FVE A;  3EJE A;  1OR5 A;  3QOU A;  3DS3 A;  4EC0 A;  1EV9 A;  2P31 A;  3E3E A;  1FB6 A;  2LOL A;  1V9W A;  1VF2 A;  1UN2 A;  5DAL A;  5E59 A;  1AXD A;  4MA9 A;  4MRT C;  3CXC O;  2GT5 A;  2CAQ A;  2LS5 A;  1EEJ A;  3C71 A;  1Q4J A;  1O8W A;  3LYK A;  1AUM A;  1GUK A;  1XW9 A;  5A4U A;  4XRO A;  4WBJ A;  2ZCT A;  4YAV A;  2E0Q A;  2HLS A;  3B5I A;  4MPF A;  3LWA A;  4G2E A;  1ZYP A;  2O85 A;  3F4T A;  1PQN A;  3CTF A;  4K2D A;  4KGI A;  2B3S A;  4N0V A;  4ZB9 A;  2DML A;  3EJD A;  4YAP A;  1G6Y A;  4K6X A;  3HVV A;  1W2B O;  2PVO C;  4KCE A;  1VQL P;  3IC8 A;  4M0I A;  1GWC A;  1R26 A;  4ZL8 A;  3IAM 2;  4CW9 A;  1XIY A;  1WIK A;  1GNW A;  2PU9 C;  4MDC A;  4R0M A;  4YKF A;  3A5I A;  3FR9 A;  4DSQ A;  5DJL A;  1K0O A;  1VF4 A;  3EE2 A;  3EPT A;  1PRX A;  2EC4 A;  3I56 P;  4LLR A;  4QL7 A;  3GJN A;  2JU1 A;  3EIN A;  4IKH A;  5HVC A;  3H4K A;  3QD9 A;  3ISO A;  4ECJ A;  1YEP A;  1XWA A;  4L0U A;  2B7J A;  2X49 A;  1DV5 A;  5L71 A;  2IJY A;  2DJK A;  1TOF A;  1V58 A;  4TN8 A;  5HR1 A;  3G7J A;  1XG8 A;  2YZU A;  3I43 A;  2AJQ B;  3CC7 P;  2MZC A;  5D73 A;  3FY7 A;  1XCC A;  2MR7 A;  4WR5 A;  11GS A;  3G9B A;  1B8X A;  5LNK e;  3F6D A;  1EIA A;  4O5R A;  3GTU A;  4EO3 A;  2XV6 A;  2LIU A;  1TTZ A;  5G5F A;  2B6M A;  2E2G A;  1M74 A;  1T1V A;  1SL1 B;  2RUE A;  5JWR B;  2Z46 A;  2VUP A;  5DAL B;  1XWC A;  1DE1 A;  3KXO A;  3E2D A;  5EJD A;  3ERF A;  2QKE A;  3RG2 A;  2C3T A;  4H2X C;  3Q74 A;  4IN0 A;  3LGC A;  1VQM P;  4D73 A;  1GLP A;  3CRU A;  4IZ6 A;  2FQ2 A;  1OVN A;  3U6V A;  1OKT A;  4L5O A;  2QSI A;  1M2B A;  3F63 A;  4MNN A;  4HQZ A;  4LMW A;  3BCK A;  1NHO A;  2KGE A;  4DG9 A;  3DD3 A;  3QMX A;  1GL8 A;  2GSR A;  3CC4 P;  1YKC A;  4PH0 A;  2IWT A;  1HY8 A;  1FAA A;  1FW1 A;  3M9J A;  4TR1 A;  1MDJ A;  2LJK A;  1C72 A;  2CX3 A;  3ZVJ D;  1KD1 Q;  2VM2 A;  1SKR B;  4KW6 A;  1YJW P;  4FYU A;  5AIX A;  4X4J A;  1BX9 A;  5ELG A;  1UVZ A;  4JR6 A;  4WR4 A;  4TOP A;  2ROQ A;  2LRC A;  4DEJ A;  3VWV A;  1BAJ A;  1TI3 A;  5CRW A;  2JB0 A;  3HY2 A;  1ERT A;  1ML6 A;  3FZ9 A;  3UAP A;  2LKU A;  1EEM A;  3VWU A;  3CMI A;  1H4O A;  2GT6 A;  1WJK A;  2HI7 A;  2G2Q A;  5DCG A;  1M7T A;  1AUC A;  2HRA A;  4K1F A;  2LRT A;  4IGJ A;  5CO3 A;  5FT3 A;  4MH2 A;  4G19 A;  3F8U A;  2L6E A;  3J7Y k;  2AFD A;  4RI6 A;  1YHQ P;  2F8F A;  3A2W A;  2CA8 A;  2CT6 A;  4RQR A;  3GIX A;  1B4P A;  2CG5 B;  4G0L A;  5KP8 B;  2HYX A;  4KX4 A;  2IPA A;  2H6Y A;  4Z2R A;  2KOR A;  2R5G A;  1SYX A;  5IO0 A;  1T4Y A;  3W8S A;  1N8J A;  2X2B A;  2AVA A;  2OJL A;  2AV4 A;  2B7K A;  4EDZ A;  4K2X A;  2RUF A;  2GDW A;  1X5E A;  2L5O A;  5H5R A;  2H73 A;  4IP6 A;  1DSB A;  2HSH A;  3LFL A;  3TJB A;  3KM6 A;  1O85 A;  1I9D A;  2RM5 A;  5H5S A;  5AN1 A;  5HFI A;  1GSD A;  4EF0 A;  1B4Q A;  3A5W A;  1ZYE A;  4WEY A;  1SL2 B;  2M72 A;  5GSS A;  1HYU A;  5ABR A;  1M2A A;  3TOT A;  2KUC A;  3IDV A;  2N5I A;  2JU2 A;  2H71 A;  2L9F A;  5JWQ B;  4XCS A;  1OC9 A;  2Z44 A;  4TR1 B;  3O6T A;  2BTO T;  2PEO A;  2KGA A;  1Z5Y E;  2CWO A;  2WS2 A;  4FYC A;  2K0D X;  4GST A;  2VAF A;  3UBK A;  2VM1 A;  4POL A;  3IRA A;  3HJM A;  1YDK A;  4I97 A;  2FNO A;  1XWB A;  1WWJ A;  1Z6M A;  2H70 A;  2A4H A;  1I5G A;  2YV9 A;  1JZD A;  4BVX B;  1DNY A;  1M90 Q;  5D9V A;  3UVH A;  3I55 P;  5ID2 A;  4DSS A;  2JSY A;  3FYG A;  4ECI A;  1PX7 A;  4I5Q A;  1ERV A;  3ME8 A;  4MCU A;  3GA4 A;  1GPJ A;  3KGK A;  3EJB A;  4GR2 A;  2LPK A;  3IXR A;  5G1L A;  1GTB A;  2LJR A;  3DVW A;  1VQ4 P;  2LV3 A;  2M5R A;  2KG8 A;  3DS1 A;  3PGT A;  3WGE A;  3BOA A;  3VPQ A;  5F2K A;  1XXU A;  1SJI A;  3GUS A;  2OTL P;  3L4N A;  1K0M A;  3U43 A;  3G71 P;  2LIW A;  1VQK P;  1O8X A;  2C0D A;  1UJZ A;  1X5C A;  4NWY A;  3LXT A;  5ENU A;  1VQ6 P;  1TKD B;  1A2L A;  2H19 A;  3CME P;  2X4A A;  2JYL A;  3NTE A;  2DC5 A;  3EUR A;  3ZYW A;  4KSO A;  2PEN A;  5HQP A;  2GSS A;  4Q5Q A;  1Q98 A;  1Y25 A;  4KND A;  3F4R A;  3QCP A;  2L4C A;  2MD9 A;  4IJI A;  1A0R P;  1K3Y A;  1EOQ A;  4KAE A;  3EU4 A;  1RK4 A;  3DGQ A;  1GSY A;  2BUO A;  1NJI Q;  4WBR D;  3QFB C;  3P7X A;  12GS A;  2AF8 A;  1WPI A;  2WZ9 A;  3FR3 A;  1JZW A;  3D4T A;  1VQP P;  2JO0 A;  2YJ7 A;  2QC7 A;  1N2A A;  2MY5 A;  2R0C A;  3TUE A;  1XFL A;  4F03 A;  3Q18 A;  2X64 A;  3CRT A;  3DIE A;  5GST A;  3DTJ A;  2X8C A;  3LJR A;  3NZN A;  3B4Q A;  4H2W C;  4JRR A;  3S9F A;  5CP1 A;  2OKA A;  3ZL5 A;  4NV5 A;  5F07 A;  1PN9 A;  4ZBD A;  2WCI A;  3HHV A;  1L0I A;  4USS A;  1H75 A;  3FRC A;  5ID2 B;  4DSS B;  1K0C A;  1EOG A;  2IMK A;  5DJM A;  5KN3 A;  4TRX A;  4ZL7 A;  1F2E A;  1DUG A;  1AQW A;  3APQ A;  3D21 A;  3KJY A;  4O5Q A;  1Z3E A;  4ZBB A;  2GQM A;  3C7M A;  4XS1 A;  1HNB A;  2EIR A;  4ML1 A;  3CCJ P;  3EVI A;  5G1K A;  4K0N A;  5IMD A;  2GQK A;  5ECS A;  1K8A Q;  2F9S A;  5IIZ A;  2A2R A;  4HUA A;  2MYG A;  5CNW A;  17GS A;  2FQ1 A;  3GUR A;  4KDX A;  2EHS A;  3RBT A;  1A23 A;  1EGO A;  5J9B A;  3IBH A;  2I3Y A;  1X3O A;  2XBI A;  3IE3 A;  4MK3 A;  2FD3 A;  2JAC A;  2KOK A;  1GP1 A;  1T00 A;  4ISD A;  5HGM A;  2IME A;  1GUH A;  3D4M A;  5LD0 A;  3UBL A;  2EIA A;  1KTE A;  2OAC A;  2OBI A;  4ICY A;  3W8J A;  1K30 A;  2M8L A;  2DLX A;  3LRY A;  2VCQ A;  5HV8 A;  2JAD A;  3L78 A;  1T8E B;  2KP2 A;  1W4V A;  4BWS A;  4PXO A;  2HXK A;  4AJ6 A;  1FR2 A;  1FVJ A;  2K0Y A;  4BPY A;  1M2D A;  5GAN D;  1R5A A;  4OFM A;  4HU7 A;  2OE0 A;  3HVS A;  2HRF A;  2KOP A;  2LTE A;  3IV4 A;  4WF4 A;  3WGD A;  1BXI A;  1BYE A;  3CCS P;  3HVX A;  3GFK A;  1YF1 A;  4XS4 A;  3FZA A;  4MP4 A;  2P9X A;  3VWX A;  2WDU A;  2N6Z A;  4EIP A;  4HQS A;  3VPT A;  2IN3 A;  4Q5N A;  2YN1 A;  1G7E A;  3WD6 A;  3CCR P;  1THX A;  2CVB A;  3MIX A;  4KUN A;  4Q5R A;  5G31 A;  1HNA A;  2F3M A;  3HJP A;  4Z2U A;  3D6I A;  1S3A A;  1FVK A;  2GYK A;  3CXG A;  2GZG A;  6GSV A;  1G6W A;  2DJ2 A;  1XOA A;  4FO5 A;  4WKW A;  4YH2 A;  4GQC A;  1FOH A;  2FWF A;  1YF0 A;  5AIS A;  4DSR A;  2YPM A;  2MBS A;  2YAN A;  5CAX A;  3ZFB A;  4KA0 A;  2LKI A;  4O32 A;  5KN0 A;  4TW5 A;  2HFD A;  3ZRE A;  4GCI A;  2KG6 A;  1GH2 A;  3KMO A;  1RQM A;  3C73 A;  3GN3 A;  2HRN A;  4NAX A;  2VLO A;  2GGT A;  4CY6 A;  3PH9 A;  2FHE A;  2QEX P;  4HEA 2;  2PN8 A;  1LBK A;  4NPB A;  2BJX A;  2X8H A;  2NDO A;  3QR6 A;  2B5X A;  2X8G A;  4OO5 A;  4Z2T A;  2DKH A;  3RAZ A;  4IP1 A;  3TKR A;  1YEX A;  4PNG A;  1RW1 A;  5D9X A;  3NY7 B;  3F3Q A;  4KB3 A;  4WET A;  1RO0 A;  4U0C A;  4IHU A;  2DIZ A;  5F8B A;  1R4W A;  1USB A;  2KP1 A;  3MSZ A;  4TR3 A;  4BWQ A;  2L22 A;  4KDU A;  3ZMK A;  5DBQ A;  5BS1 A;  4I2U A;  2YP6 A;  3IA1 A;  5IMC A;  5DCH A;  1JLV A;  1GNE A;  4GQF A;  3RHB A;  4G0K A;  4PXH B;  5BRT A;  3GZL A;  4XS4 B;  4WF5 A;  1OE8 A;  4CHS A;  1YIJ P;  2GS3 A;  3G1G A;  4MF6 A;  3N5O A;  6GSU A;  1Z7P A;  2WJU A;  1TP9 A;  3CCM P;  2DIY A;  2CX4 A;  4GXZ A;  1OC8 A;  3DWV A;  5LCZ A;  1PA3 A;  4IS0 A;  4AJ7 A;  1IUQ A;  2DNW A;  4U0A A;  5F06 A;  2HZE A;  5J5N A;  2Z45 A;  3NIV A;  1BG5 A;  5DQY A;  2NBS A;  2HRK A;  3ED3 A;  1YIT P;  2B5Y A;  4U0B A;  1G7O A;  1M99 A;  2J9H A;  2ON5 A;  1M1K Q;  4EDY A;  1XWK A;  2GVP A;  2MR8 A;  4GRF A;  3UIW A;  4RI7 A;  1ZGN A;  3DS5 A;  4GTU A;  2FLS A;  1K3L A;  1VQO P;  2FAD A;  3H47 A;  2OE1 A;  4KE3 A;  2LNS A;  3GRX A;  2KOS A;  5HR2 A;  2YJH A;  3VLN A;  1F6M C;  4ZB6 A;  3ZIT A;  2LF4 A;  3MAK A;  2HE3 A;  4PWV B;  1K0D A;  1K3O A;  4OWY A;  3RPN A;  2LL8 A;  4H86 A;  3HDC A;  3DRN A;  1BED A;  1O73 A;  2K6V A;  2PBJ A;  2FA4 A;  3D5J A;  2E7P A;  1SK1 A;  5AIV A;  4HU9 A;  2VLN A;  1PSQ A;  1QVG O;  1ABA A;  3ZIV A;  1GSQ A;  4MJA A;  1YJ9 P;  3M9K A;  4HDE A;  3VI5 A;  3Q6O A;  2M8N A;  3F0I A;  3MDK A;  4UHP B;  1T7P B;  2K18 A;  4GSS A;  4MJB A;  5CZD B;  2M80 A;  2A2S A;  3I9V 2;  1OAZ A;  4LA1 A;  1VF3 A;  3GZM A;  2VL9 A;  4MMM A;  1YKA A;  4POB A;  6GSY A;  2WB9 A;  1XW6 A;  5G2Z A;  4XHM A;  1X0R A;  5FHI A;  3HVN A;  2L6D A;  5B7C A;  3U5R E;  3SWL A;  2VCZ A;  3CQF A;  4WXT A;  5D8I A;  4G0I A;  3VUR A;  4EUY A;  3CBU A;  4EKZ A;  4QKO A;  3QAW A;  4MJC A;  2GDX A;  2V6O A;  2LST A;  3D22 A;  5D93 A;  2HZE B;  4E8H A;  3O3T A;  3JCM L;  2XZ0 D;  2ZUP A;  2H1G A;  1YJ6 A;  3VWW A;  4N11 A;  2TRX A;  1TK5 B;  4E8E A;  3R2Q A;  1O6J A;  5I4T G;  2KW2 A;  3ERG A;  2R2J A;  2L0Q A;  2PWJ A;  2R4V A;  2AAW A;  3G28 A;  2XHF A;  3GTU B;  5IM9 A;  1NM3 A;  4LL4 B;  3WBH A;  1XWG A;  3LQ7 A;  3GH9 A;  1GXH A;  4G10 A;  4P3Y B;  4Q5F A;  3TRQ A;  2JYG A;  1UNK A;  2B5E A;  2LNT A;  2D2Z A;  3MNG A;  3HZ8 A;  1PL1 A;  2REM A;  2E1M A;  1E6B A;  2I9H A;  4K0G A;  4D73 B;  5KP7 B;  3KH7 A;  4L8E A;  4GF0 A;  2H30 A;  2LML A;  2VL3 A;  2NPB A;  3PIN A;  1YJN P;  5HR3 A;  1S3R A;  4NEO A;  4OO4 A;  3GH6 A;  1GSF A;  1YI2 P;  2DJ0 A;  1E2Y A;  4L0W A;  2OTJ P;  4EIQ A;  1M9A A;  3QFA C;  2C80 A;  2CV4 A;  4XFZ A;  4AJ8 A;  5D9T A;  2JZS A;  3AY8 A;  3M0F A;  2I4A A;  3OW2 O;  2L59 A;  5JWO B;  2FA8 A;  1AYI A;  4OD7 A;  4KH7 A;  2EIQ A;  3QAG A;  4YQM A;  1PD2 1;  4QNB A;  1J08 A;  2VOC A;  3PPU A;  3ZZX A;  4FH8 A;  1YY7 A;  3GST A;  2R0P A;  4F82 A;  4MZW A;  2JQ4 A;  2FAC A;  2VIM A;  2JAZ A;  5BS2 A;  1RNI A;  2TIR A;  1QVF O;  2NTO A;  1A2M A;  3FW2 A;  4ACS A;  2F8A A;  3KTB A;  22GS A;  2CAI A;  1D1D A;  2VCV A;  2K94 A;  4FIW A;  2MMZ A;  2L4B A;  4J57 E;  4TVE A;  2OAR A;  3W6G A;  3VRL C;  3IR4 A;  3LOR A;  4O5U A;  1ON4 A;  2A4V A;  1Z7R A;  4ZXG A;  2FVF A;  2H0H A;  2PVQ A;  4AGS A;  1AAZ A;  1UC7 A;  3ZVJ A;  2V32 A;  2FVA A;  3P05 A;  1FB0 A;  1FOV A;  1QGV A;  1GSU A;  1URM A;  2FY6 A;  2OBK A;  5IMV A;  1BAY A;  2VL2 A;  5GAP D;  2R37 A;  5G30 A;  1FG4 A;  1IMQ A;  2N50 A;  4DVC A;  1KLP A;  4ZIJ A;  2GDR A;  2ES7 A;  2FAE A;  1K0A A;  4TKY A;  3HKR A;  1GXG A;  3FHK A;  2VLU A;  4MPG A;  1A8Y A;  1M3J A;  5ECL B;  1Z6N A;  4PX1 A;  5H5Q A;  3R3E A;  4OCF A;  4LMV A;  2GZZ A;  1GSE A;  3RHC A;  4EL1 A;  4HOJ A;  2C1Y A;  1K0N A;  4MLY A;  3NOF A;  1GUL A;  2WRT A;  2GZJ A;  2KR5 A;  4GR6 A;  3L9V A;  3IK9 A;  5EVO A;  3HD5 A;  3GHA A; 
#chains in the Genus database with same CATH homology
 3UAR A;  1KBN A;  5EL8 A;  2DJ1 A;  1XW5 A;  1OC9 B;  1AW9 A;  2YCD A;  2WGR A;  4MAB A;  1M0U A;  1QUW A;  1TRW A;  1IYH A;  5D9W A;  2JZT A;  3GX8 A;  2LQO A;  1UA5 A;  1K0B A;  3V1W A;  4POM A;  4IQ1 A;  1V57 A;  1O81 A;  1NSW A;  1F37 A;  2C3Q A;  3Q19 A;  4IEL A;  2GQL A;  3P8W A;  4RQX A;  1O7U A;  5INY A;  4BVY A;  3C8E A;  5HFK A;  2L4Q A;  4OFT A;  4JU5 A;  2HZF A;  2A2P A;  19GS A;  1OC3 A;  1OKD A;  3APS A;  1SYR A;  4NV2 A;  1SK0 A;  4X43 A;  1TRV A;  3LEF A;  2MMN A;  2TRC P;  1ERU A;  2VLT A;  2YWO A;  2XPE A;  3TKS E;  4TR4 A;  1IYI A;  3GMF A;  5IOX A;  1GRX A;  4HZ2 A;  3UOM A;  1TI1 A;  1EGR A;  5A4W A;  1ZZY A;  2R3X A;  2H74 A;  4CDO A;  2VCT A;  1T3B A;  1QXH A;  2MMA A;  5DQS A;  1TRU A;  1GUM A;  4OMV A;  2N5F A;  2O89 A;  1ILO A;  2MBT A;  5JCU A;  2IFQ A;  4O92 A;  4JZQ A;  6GST A;  3BCI A;  2O87 A;  3DEX A;  4I2T A;  4IJ3 A;  4LL1 B;  5HFG A;  3QDN A;  1JHB A;  4BL7 A;  5HR0 A;  1EOH A;  4HI7 A;  5F0G A;  1PKZ A;  1EP7 A;  5ECH B;  4A5P A;  4YQU A;  2H0I A;  3TKP A;  2XC2 A;  1GSS A;  1U3I A;  2PUK C;  3F4S A;  3DYR A;  3APO A;  2YV7 A;  1TJD A;  5DDL A;  1MEK A;  3L0H A;  4I6X A;  4IQA A;  1GLQ A;  5IPH A;  2GZY A;  5B8A A;  1THO A;  16GS A;  2QA1 A;  1OYJ A;  2GZP A;  2O8V B;  1NW2 A;  2F51 A;  6GSX A;  4BVY B;  3TJG A;  3A2V A;  2IMD A;  5COH A;  1Y6E A;  3CSH A;  5J41 A;  5KOX A;  1GTA A;  2VD1 A;  4ZIL A;  2WFC A;  2VO4 A;  1V98 A;  4ILF A;  2GTU A;  5IQY A;  3FEU A;  4GLT A;  5CRE A;  2H72 A;  4FYB A;  1WP0 A;  3UL3 A;  1V40 A;  1U87 A;  5ECO B;  3GKN A;  5KOW A;  3GL5 A;  3FKF A;  3TOU A;  3CSI A;  3KEB A;  2HSM A;  3E0U A;  4HJM A;  2EIO A;  3GKX A;  4NHW A;  2PER A;  1JFU A;  1U3A A;  3FR6 A;  2AB6 A;  2IFQ B;  1FO5 A;  3KZQ A;  1AQV A;  5EPF A;  5C04 A;  1QMV A;  4BL7 B;  2NVL A;  3UMA A;  2H75 A;  1ZOF A;  3I69 A;  1SL0 B;  1GTI A;  2R0G A;  3F9U A;  3K8N A;  5J3R A;  1AIU A;  1VF1 A;  3IAS 2;  1ST9 A;  2LQQ A;  3HXS A;  1TU7 A;  1TDI A;  3I6A A;  2H1D A;  3N9J A;  2FUG 2;  1GTU A;  2E2M A;  3PR8 A;  4K9Z A;  5J9C A;  1SD8 A;  3A2X A;  2YWN A;  3H8Q A;  2PGT A;  1X9W B;  4YKG A;  3L9S A;  5ELA A;  3GV1 A;  4ZB8 A;  4JE1 A;  2DJ3 A;  3M3M A;  1QK8 A;  1ZL9 A;  1BQ7 A;  4NHZ A;  5F05 A;  1XPV A;  1HQO A;  1VRS D;  4POK A;  1PL2 A;  5EY6 A;  2C0F A;  4JR4 A;  4PGT A;  2K9F A;  4X0X A;  2GST A;  5B6M A;  3HZ4 A;  2XBQ A;  1W89 A;  2LTK A;  3RDW A;  4G9H A;  5ECI B;  1PGT A;  2IL3 A;  5AGY A;  2VL2 C;  3WT2 A;  4K5S A;  3TRP A;  4FQU A;  6GSS A;  3TJJ A;  20GS A;  1A24 A;  1QQ2 A;  1WRY A;  4F0B A;  3LSZ A;  2JU5 A;  3FZ5 A;  5CRH A;  2XPD A;  3M8N A;  2C0G A;  5G5E A;  2P0G A;  1EZK A;  2JZR A;  4QL9 A;  1OE7 A;  1TXX A;  5IO2 A;  1SK2 A;  4CY8 A;  2WUL A;  3DXB A;  3GX0 A;  2IIY A;  5BMU A;  3WT1 A;  4JBB A;  3CYN A;  3IPZ A;  2HT9 A;  3EU3 A;  3TKS A;  3EYT A;  4OCE A;  5JCG A;  1MD4 A;  3G7I A;  5C00 A;  1WOU A;  3DML A;  4BA7 A;  1DBY A;  1JLW A;  1SD9 A;  4IW9 A;  1PMT A;  3TB2 A;  3C1R A;  1PN0 A;  4V2L A;  4PNF A;  2H6Z A;  4PQ1 A;  2R6K A;  4PUA A;  3FK8 A;  4EE0 A;  2VLV A;  4ULX A;  5IMF A;  1Z9H A;  2DSA A;  3FMW A;  1EV4 A;  3KCM A;  3MWH A;  5A4V A;  3US3 A;  4KCA A;  2ON7 A;  2KLX A;  3H79 A;  4PQH A;  5B6N A;  3KP9 A;  5KN2 A;  5ECM B;  3TGZ A;  4BVX A;  4HS1 A;  3MYD A;  4XTS A;  3TDG A;  2RII A;  3UJ1 A;  14GS A;  1F9M A;  5ECQ B;  1XBS A;  5IMA A;  2YNX A;  2CVD A;  3GNJ A;  3F6F A;  3M1G A;  18GS A;  3P90 A;  1ZMA A;  2L57 A;  1X9M B;  3CTG A;  9GSS A;  2B1K A;  4YQV A;  2KHP A;  3EWL A;  5CYY A;  1XVW A;  4HJ2 A;  3F3R A;  1U6T A;  4N0Z A;  1WE0 A;  1PX6 A;  2UZ8 A;  1KEB A;  3ZML A;  2DBC A;  4ECC A;  1PKW A;  1WMJ A;  5KEJ A;  2H8L A;  2N5B A;  4EXJ A;  2YZH A;  3VI7 A;  2LRN A;  3EC3 A;  3BBY A;  4JED A;  4MZB A;  2P5Q A;  2AUV A;  2AYT A;  2FGX A;  3EMP A;  1S3C A;  1A2J A;  2PPT A;  1XVQ A;  4HZ4 A;  4NXI A;  1TK8 B;  3L9U A;  4V1A g;  1R5P A;  4V2M A;  4IVF A;  1F3B A;  2GLR A;  1B9X C;  3IK7 A;  2RLI A;  2H1A A;  3IC4 A;  2FWH A;  4O7H A;  1J0F A;  2G0F A;  1X9S B;  2FWG A;  2HSY A;  2H6X A;  3ZLP A;  2DKI A;  3QAV A;  3O76 A;  1TK0 B;  3HJO A;  3TJK A;  1AQX A;  2L5L A;  4K7N A;  3ME7 A;  3UEM A;  3LYP A;  3KP8 A;  4N30 A;  3HA9 A;  3GSS A;  5IOW A;  2C0E A;  3BJ5 A;  3GKM A;  1MDK A;  5IMZ A;  2O7K A;  1BJX A;  2CVK A;  2YWI A;  3HCZ A;  4TXO A;  2CZ2 A;  1G0T A;  1ZYQ B;  2H76 A;  3VFI A;  1ZYN A;  2VCW A;  2VCX A;  2LUS A;  1TU8 A;  3KTL A;  2FWE A;  3WYW A;  3ZTL A;  3D0Z A;  2LJA A;  4ML6 A;  6GSW A;  4K8M A;  2C3N A;  3H93 A;  4ID0 A;  2N5A A;  4MH3 A;  1ZCP A;  3P2A A;  3DVX A;  1KNG A;  1SKW B;  5DVB A;  1LJR A;  1HD2 A;  2FCH A;  2QGV A;  1V2A A;  2LEG A;  4L5L A;  1HNC A;  3UVT A;  1A8L A;  3TRX A;  2HNL A;  1YQ1 A;  1XZO A;  4GSN A;  3TJF A;  3G7Y A;  1LU4 A;  1R7H A;  2V2G A;  3GKK A;  5CRD A;  3ERW A;  4X1U A;  4J56 E;  7GSS A;  1T4Z A;  5ECR B;  2RM6 A;  3WGX A;  3LG6 A;  2OE3 A;  5IPG A;  3EMX A;  3KIJ A;  1MDI A;  4K7O A;  2YWM A;  1EP8 A;  2J23 A;  1ERW A;  3IOS A;  4EVM A;  2C8U A;  1YZX A;  2I81 A;  1TRS A;  5J4U A;  5A5K A;  4XRD A;  1A0F A;  2I1U A;  3LW9 A;  4TXO B;  3TCO A;  3ZFL A;  5DAK A;  3ZIJ A;  4XS6 A;  1MTC A;  5B8B A;  1F3A A;  2V1M A;  1DE2 A;  1EWX A;  4RUV A;  4PQI A;  2P5R A;  4K5R A;  2JSZ A;  4PUR A;  2YOI A;  1S3D A;  4OFN A;  3LXZ A;  3HYP A;  4XRA A;  3GL3 A;  3IHG A;  2H0G A;  3J7Y b;  5JCW A;  4KF9 A;  2OA7 A;  1JZR A;  2K8S A;  4F9Z A;  1XOB A;  3SBC A;  1SEN A;  4J2F A;  1VGL A;  4K7I A;  2MMO A;  1X5D A;  3QPM A;  3BD2 A;  3KD0 A;  2BMX A;  3TKQ A;  3OR5 A;  3H1N A;  2VD0 A;  10GS A;  3CSJ A;  1AC1 A;  4KDY A;  2ZNM A;  1FHE A;  2M46 A;  4PTS A;  3TKS C;  5FWG A;  1SKS B;  4N10 A;  2DMM A;  1SJ6 A;  2IMI A;  4V1A p;  4MF5 A;  2L6C A;  4IBP A;  3KMN A;  2B1L A;  3KH9 A;  2CZ3 A;  1J9B A;  3FZ4 A;  4QQ7 A;  5D96 A;  5KN1 A;  4AF2 A;  2X99 A;  4MJE A;  4F0C A;  2QA2 A;  3IHQ A;  2K8V A;  1M9B A;  8GSS A;  4KSM A;  2V41 A;  4ECB A;  3GYK A;  1JZO A;  5ECN B;  3ZRD A;  5ECP B;  5CRG A;  1QFN A;  2GSQ A;  1B48 A;  4NMU A;  2H66 A;  4MF7 A;  1CQG A;  2Z9S A;  4TR0 A;  4V2N A;  5ECK B;  1U88 A;  5E4W A;  1B9Y C;  1SU9 A;  3E9J B;  2DJJ A;  2IMF A;  2V6K A;  1TW9 A;  3A3T A;  5DAK B;  2ALB A;  2H01 A;  3C1S A;  5GZZ B;  1NHY A;  2C4J A;  3DKS A;  3RPP A;  2CQ9 A;  1MD3 A;  3VK9 A;  1ACV A;  4TXV A;  2OAD A;  4F2I A;  4XIH A;  4ZBA A;  4Z7X A;  1CQH A;  4PUF C;  2JL4 A;  1SJZ A;  4ZL9 A;  13GS A;  2H1B A;  2AHE A;  2PMT A;  4MZC A;  4I8B A;  4GWR A;  3QOU A;  4EC0 A;  1EV9 A;  2P31 A;  3E3E A;  1FB6 A;  1V9W A;  1VF2 A;  1UN2 A;  5DAL A;  5E59 A;  1AXD A;  4MA9 A;  2GT5 A;  2CAQ A;  2LS5 A;  1EEJ A;  3C71 A;  1Q4J A;  1O8W A;  3LYK A;  1GUK A;  1XW9 A;  5A4U A;  4WBJ A;  2ZCT A;  4YAV A;  2E0Q A;  2HLS A;  4MPF A;  4G2E A;  1ZYP A;  2O85 A;  3F4T A;  1PQN A;  3CTF A;  4K2D A;  4KGI A;  2B3S A;  4N0V A;  4ZB9 A;  2DML A;  4YAP A;  1G6Y A;  4K6X A;  3HVV A;  2PVO C;  4KCE A;  3IC8 A;  1GWC A;  1R26 A;  4ZL8 A;  3IAM 2;  4CW9 A;  1XIY A;  1WIK A;  1GNW A;  2PU9 C;  4MDC A;  4YKF A;  3A5I A;  3FR9 A;  4DSQ A;  5DJL A;  1K0O A;  1VF4 A;  3EE2 A;  3EPT A;  1PRX A;  2EC4 A;  4LLR A;  4QL7 A;  3EIN A;  4IKH A;  3H4K A;  3QD9 A;  3ISO A;  4ECJ A;  1YEP A;  1XWA A;  4L0U A;  2B7J A;  2X49 A;  5L71 A;  2IJY A;  2DJK A;  1TOF A;  1V58 A;  4TN8 A;  5HR1 A;  3G7J A;  2YZU A;  3I43 A;  2AJQ B;  2MZC A;  5D73 A;  3FY7 A;  1XCC A;  4WR5 A;  11GS A;  3G9B A;  1B8X A;  5LNK e;  3F6D A;  4O5R A;  3GTU A;  4EO3 A;  1TTZ A;  5G5F A;  2B6M A;  2E2G A;  1T1V A;  1SL1 B;  2RUE A;  5JWR B;  2VUP A;  5DAL B;  1XWC A;  1DE1 A;  3KXO A;  3ERF A;  2QKE A;  2C3T A;  3Q74 A;  4IN0 A;  3LGC A;  4D73 A;  1GLP A;  3CRU A;  1OVN A;  3U6V A;  1OKT A;  4L5O A;  2QSI A;  1M2B A;  3F63 A;  4MNN A;  4HQZ A;  4LMW A;  3BCK A;  1NHO A;  3DD3 A;  3QMX A;  1GL8 A;  2GSR A;  1YKC A;  2IWT A;  1FAA A;  3M9J A;  1FW1 A;  4TR1 A;  1MDJ A;  2LJK A;  1C72 A;  2CX3 A;  3ZVJ D;  2VM2 A;  1SKR B;  4KW6 A;  4FYU A;  5AIX A;  4X4J A;  1BX9 A;  5ELG A;  1UVZ A;  4JR6 A;  4WR4 A;  4TOP A;  2LRC A;  4DEJ A;  3VWV A;  1TI3 A;  5CRW A;  3HY2 A;  1ERT A;  1ML6 A;  3FZ9 A;  3UAP A;  2LKU A;  1EEM A;  3VWU A;  3CMI A;  1H4O A;  2GT6 A;  1WJK A;  2HI7 A;  2G2Q A;  5DCG A;  1M7T A;  1AUC A;  2HRA A;  4K1F A;  2LRT A;  4IGJ A;  5CO3 A;  5FT3 A;  4MH2 A;  4G19 A;  3F8U A;  3J7Y k;  4RI6 A;  2F8F A;  3A2W A;  2CA8 A;  2CT6 A;  4RQR A;  3GIX A;  1B4P A;  4G0L A;  2HYX A;  4KX4 A;  2IPA A;  2H6Y A;  4Z2R A;  2R5G A;  1SYX A;  5IO0 A;  1T4Y A;  3W8S A;  1N8J A;  2OJL A;  2AV4 A;  2B7K A;  4EDZ A;  4K2X A;  2RUF A;  1X5E A;  2L5O A;  5H5R A;  2H73 A;  4IP6 A;  1DSB A;  2HSH A;  3LFL A;  3TJB A;  3KM6 A;  1O85 A;  1I9D A;  2RM5 A;  5H5S A;  5AN1 A;  5HFI A;  1GSD A;  4EF0 A;  1B4Q A;  3A5W A;  1ZYE A;  4WEY A;  1SL2 B;  2M72 A;  5GSS A;  1HYU A;  5ABR A;  1M2A A;  3TOT A;  2KUC A;  3IDV A;  2H71 A;  5JWQ B;  4XCS A;  1OC9 A;  4TR1 B;  3O6T A;  2BTO T;  1Z5Y E;  2WS2 A;  4FYC A;  4GST A;  2VAF A;  3UBK A;  2VM1 A;  4POL A;  3IRA A;  3HJM A;  1YDK A;  4I97 A;  2FNO A;  1XWB A;  1WWJ A;  1Z6M A;  2H70 A;  2A4H A;  1I5G A;  2YV9 A;  1JZD A;  4BVX B;  5D9V A;  3UVH A;  5ID2 A;  4DSS A;  2JSY A;  3FYG A;  4ECI A;  1PX7 A;  4I5Q A;  1ERV A;  3ME8 A;  4MCU A;  3GA4 A;  3KGK A;  5G1L A;  3IXR A;  1GTB A;  2LJR A;  3DVW A;  2LV3 A;  3PGT A;  3WGE A;  3BOA A;  3VPQ A;  1XXU A;  1SJI A;  3GUS A;  3L4N A;  1K0M A;  1O8X A;  2C0D A;  1X5C A;  4NWY A;  3LXT A;  5ENU A;  1TKD B;  1A2L A;  2H19 A;  2X4A A;  2DC5 A;  3EUR A;  3ZYW A;  4KSO A;  5HQP A;  2GSS A;  4Q5Q A;  1Q98 A;  1Y25 A;  4KND A;  3F4R A;  3QCP A;  2L4C A;  4IJI A;  1A0R P;  1K3Y A;  4KAE A;  3EU4 A;  1RK4 A;  3DGQ A;  1GSY A;  4WBR D;  3QFB C;  3P7X A;  12GS A;  1WPI A;  2WZ9 A;  3FR3 A;  1JZW A;  3D4T A;  2YJ7 A;  2QC7 A;  1N2A A;  2R0C A;  3TUE A;  1XFL A;  4F03 A;  3Q18 A;  2X64 A;  3CRT A;  3DIE A;  5GST A;  2X8C A;  3LJR A;  3NZN A;  3S9F A;  4JRR A;  5CP1 A;  2OKA A;  3ZL5 A;  4NV5 A;  5F07 A;  1PN9 A;  4ZBD A;  2WCI A;  3HHV A;  4USS A;  1H75 A;  3FRC A;  5ID2 B;  4DSS B;  1K0C A;  1EOG A;  2IMK A;  5DJM A;  5KN3 A;  4TRX A;  4ZL7 A;  1F2E A;  1DUG A;  1AQW A;  3APQ A;  3D21 A;  3KJY A;  4O5Q A;  1Z3E A;  4ZBB A;  2GQM A;  3C7M A;  4XS1 A;  1HNB A;  2EIR A;  4ML1 A;  3EVI A;  5G1K A;  4K0N A;  5IMD A;  2GQK A;  5ECS A;  2F9S A;  5IIZ A;  2A2R A;  4HUA A;  2MYG A;  5CNW A;  17GS A;  3GUR A;  4KDX A;  3RBT A;  1A23 A;  1EGO A;  5J9B A;  3IBH A;  2I3Y A;  2XBI A;  3IE3 A;  4MK3 A;  2FD3 A;  2JAC A;  2KOK A;  1GP1 A;  1T00 A;  4ISD A;  2IME A;  1GUH A;  3D4M A;  5LD0 A;  3UBL A;  1KTE A;  2OAC A;  2OBI A;  4ICY A;  3W8J A;  2DLX A;  2VCQ A;  2JAD A;  3L78 A;  1T8E B;  2KP2 A;  1W4V A;  4BWS A;  4PXO A;  2HXK A;  4AJ6 A;  1FVJ A;  4BPY A;  1M2D A;  5GAN D;  1R5A A;  4OFM A;  4HU7 A;  2OE0 A;  3HVS A;  2HRF A;  3IV4 A;  4WF4 A;  3WGD A;  1BYE A;  3HVX A;  3GFK A;  1YF1 A;  4XS4 A;  3FZA A;  4MP4 A;  3VWX A;  2WDU A;  4EIP A;  4HQS A;  3VPT A;  2IN3 A;  4Q5N A;  2YN1 A;  1G7E A;  3WD6 A;  1THX A;  2CVB A;  3MIX A;  4KUN A;  4Q5R A;  5G31 A;  1HNA A;  2F3M A;  3HJP A;  4Z2U A;  3D6I A;  1S3A A;  1FVK A;  3CXG A;  6GSV A;  1G6W A;  2DJ2 A;  1XOA A;  4FO5 A;  4WKW A;  4YH2 A;  4GQC A;  1FOH A;  2FWF A;  1YF0 A;  5AIS A;  4DSR A;  2YPM A;  2MBS A;  2YAN A;  5CAX A;  3ZFB A;  4KA0 A;  5KN0 A;  4O32 A;  4TW5 A;  2HFD A;  3ZRE A;  4GCI A;  1GH2 A;  3KMO A;  1RQM A;  3C73 A;  3GN3 A;  2HRN A;  4NAX A;  2GGT A;  4CY6 A;  3PH9 A;  2FHE A;  4HEA 2;  2PN8 A;  1LBK A;  4NPB A;  2BJX A;  2X8H A;  2NDO A;  3QR6 A;  2B5X A;  2X8G A;  4OO5 A;  4Z2T A;  2DKH A;  3RAZ A;  4IP1 A;  3TKR A;  1YEX A;  4PNG A;  1RW1 A;  5D9X A;  3F3Q A;  4KB3 A;  4WET A;  4IHU A;  2DIZ A;  5F8B A;  1R4W A;  1USB A;  2KP1 A;  3MSZ A;  4TR3 A;  4BWQ A;  4KDU A;  3ZMK A;  5DBQ A;  4I2U A;  2YP6 A;  3IA1 A;  5IMC A;  5DCH A;  1JLV A;  1GNE A;  4GQF A;  3RHB A;  4G0K A;  5BRT A;  4XS4 B;  4WF5 A;  1OE8 A;  4CHS A;  2GS3 A;  4MF6 A;  3N5O A;  6GSU A;  1Z7P A;  2WJU A;  1TP9 A;  2DIY A;  2CX4 A;  4GXZ A;  1OC8 A;  3DWV A;  5LCZ A;  1PA3 A;  4IS0 A;  4AJ7 A;  5F06 A;  2HZE A;  5J5N A;  3NIV A;  1BG5 A;  5DQY A;  2NBS A;  2HRK A;  3ED3 A;  2B5Y A;  1G7O A;  1M99 A;  2J9H A;  2ON5 A;  4EDY A;  1XWK A;  2GVP A;  4GRF A;  3UIW A;  4RI7 A;  1ZGN A;  4GTU A;  2FLS A;  1K3L A;  2OE1 A;  4KE3 A;  2LNS A;  3GRX A;  5HR2 A;  2YJH A;  3VLN A;  1F6M C;  4ZB6 A;  3ZIT A;  3MAK A;  2HE3 A;  1K0D A;  1K3O A;  4OWY A;  3RPN A;  4H86 A;  3HDC A;  3DRN A;  1BED A;  1O73 A;  2K6V A;  2PBJ A;  2FA4 A;  3D5J A;  2E7P A;  1SK1 A;  5AIV A;  4HU9 A;  1PSQ A;  1ABA A;  3ZIV A;  1GSQ A;  4MJA A;  3M9K A;  4HDE A;  3VI5 A;  3Q6O A;  3F0I A;  3MDK A;  1T7P B;  2K18 A;  4GSS A;  4MJB A;  3GHA A;  2M80 A;  2A2S A;  3I9V 2;  1OAZ A;  4LA1 A;  1VF3 A;  2VL9 A;  4MMM A;  1YKA A;  4POB A;  6GSY A;  2WB9 A;  1XW6 A;  5G2Z A;  4XHM A;  1X0R A;  5FHI A;  2L6D A;  5B7C A;  3U5R E;  3SWL A;  2VCZ A;  4WXT A;  5D8I A;  4G0I A;  3VUR A;  4EUY A;  3CBU A;  4EKZ A;  3QAW A;  4MJC A;  3D22 A;  2V6O A;  2LST A;  5D93 A;  2HZE B;  4E8H A;  3O3T A;  3JCM L;  2ZUP A;  2H1G A;  1YJ6 A;  3VWW A;  4N11 A;  2TRX A;  1TK5 B;  4E8E A;  3R2Q A;  1O6J A;  3ERG A;  2R2J A;  2R4V A;  2PWJ A;  2AAW A;  2XHF A;  3GTU B;  5IM9 A;  1NM3 A;  4LL4 B;  1XWG A;  3LQ7 A;  3GH9 A;  4G10 A;  4P3Y B;  4Q5F A;  3TRQ A;  2B5E A;  2LNT A;  2D2Z A;  3MNG A;  3HZ8 A;  1PL1 A;  2REM A;  1E6B A;  2I9H A;  4K0G A;  4D73 B;  3KH7 A;  4L8E A;  4GF0 A;  2H30 A;  2VL3 A;  2NPB A;  3PIN A;  5HR3 A;  4OO4 A;  3GH6 A;  1GSF A;  2DJ0 A;  4L0W A;  1E2Y A;  4EIQ A;  1M9A A;  3QFA C;  2C80 A;  2CV4 A;  4AJ8 A;  5D9T A;  2JZS A;  3AY8 A;  3M0F A;  2I4A A;  2L59 A;  5JWO B;  2FA8 A;  4OD7 A;  4KH7 A;  2EIQ A;  3QAG A;  4YQM A;  1PD2 1;  1J08 A;  2VOC A;  3PPU A;  3ZZX A;  4FH8 A;  1YY7 A;  3GST A;  2R0P A;  4F82 A;  4MZW A;  2VIM A;  2TIR A;  2NTO A;  1A2M A;  3FW2 A;  4ACS A;  2F8A A;  3KTB A;  22GS A;  2CAI A;  2VCV A;  4FIW A;  2MMZ A;  4J57 E;  4TVE A;  3W6G A;  3IR4 A;  3LOR A;  4O5U A;  1ON4 A;  2A4V A;  1Z7R A;  4ZXG A;  2H0H A;  2PVQ A;  4AGS A;  1AAZ A;  1UC7 A;  3ZVJ A;  2V32 A;  1FB0 A;  1FOV A;  1QGV A;  1GSU A;  1URM A;  2FY6 A;  2OBK A;  5IMV A;  1BAY A;  2VL2 A;  5GAP D;  2R37 A;  5G30 A;  1FG4 A;  4DVC A;  4ZIJ A;  2GDR A;  2ES7 A;  1K0A A;  4TKY A;  3HKR A;  3FHK A;  2VLU A;  4MPG A;  1A8Y A;  5ECL B;  1Z6N A;  4PX1 A;  5H5Q A;  3R3E A;  4OCF A;  4LMV A;  2GZZ A;  1GSE A;  3RHC A;  4EL1 A;  4HOJ A;  2C1Y A;  1K0N A;  4MLY A;  3NOF A;  1GUL A;  2WRT A;  3L9V A;  3IK9 A;  5EVO A;  3HD5 A;  3LWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...