1Z6MA

Structure of conserved protein of unknown function from enterococcus faecalis v583
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
175
structure length
175
Chain Sequence
SNAMDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELLAQSVKSGKVERIIKLFDKEKESLQRGNVMHHYIDYSAPEQALSALHKMFATQDEWGNLTLEEVATYAEKNLGLKEQKDATLVSAVIAEANAAHIQFVPTIIIGEYIFDESVTEEELRGYIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a conserved hypothetical protein from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
molecule keywords conserved hypothetical protein
total genus 57
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.90 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A DsbA-like domain 1z6mA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1z6mA01
2JZRA 5KN1A 1SJ6A 3LXTA 3UARA 3G7IA 1GNWA 2L57A 3LSZA 4NPBA 1LJRA 1CQGA 2V1MA 3H4KA 2B5XA 1X9WB 2DJ2A 3ME7A 5IMVA 3IDVA 1I9DA 3EINA 4NMUA 5D9VA 5KEJA 2DMLA 5C00A 3CSJA 4H86A 5CRHA 2F51A 3VPQA 2JZTA 2L5LA 2LSTA 2AYTA 3VFIA 5HFIA 1RQMA 4OO5A 2VCVA 4MA9A 1SJIA 4L5LA 4IKHA 4MH3A 2F9SA 3TJBA 2L59A 4MF5A 4FH8A 2GSTA 3GHAA 1Y6EA 5G5FA 5ECHB 1FOVA 1X9SB 4J56E 2H8LA 2D2ZA 1C72A 3APOA 1ERUA 4TXOB 4K9ZA 3TKSA 5A4WA 1G7EA 5G5EA 2FWEA 1PX7A 3DMLA 3UMAA 2CAQA 3A5WA 5HR1A 3G7YA 1A0RP 2VL9A 4MK3A 4V1Ag 1FW1A 2HRNA 3EMXA 1DBYA 3FEUA 1GRXA 1TK5B 1XPVA 2NBSA 3WGDA 4L0WA 1V2AA 1B4QA 3IK9A 4ZBBA 1DUGA 1BAYA 2QKEA 2I1UA 2MMAA 4YAPA 3D4TA 3KM6A 2KUCA 3L78A 3P90A 1M2AA 4KUNA 1PA3A 2IWTA 2R6KA 4JBBA 5DALB 5D9TA 3GKKA 3Q18A 2HFDA 5IOXA 2TIRA 2FWHA 2H0IA 2LJAA 4F0CA 2H6YA 1FAAA 5FHIA 3KIJA 3RAZA 3F6DA 2EIQA 2BJXA 1GTAA 3IE3A 2VL2A 1K0MA 3ED3A 2V41A 1TRUA 2FY6A 4V1Ap 2MMNA 3KMOA 4MH2A 5CRGA 1YQ1A 4O92A 4IP1A 1WJKA 4DSSB 3HZ4A 4Q5QA 4JEDA 2JADA 2J23A 4FYCA 3QFBC 4N30A 1QFNA 1JFUA 1SKRB 4J57E 4ID0A 2CAIA 4FO5A 3DWVA 2HE3A 4F82A 1O73A 4K1FA 4IGJA 2EIRA 4F9ZA 4HQSA 2DMMA 2VCTA 5IMZA 5D8IA 3L9SA 2HT9A 2ON7A 1WP0A 1A0FA 10GSA 5AN1A 3SBCA 1A8LA 5B6NA 1JLVA 3FR3A 3GIXA 3R2QA 4MJAA 1SKWB 5JWQB 2XPDA 4YH2A 4GWRA 1ERTA 3LQ7A 3QPMA 4MPFA 1G7OA 5IM9A 3ISOA 2YWIA 2OKAA 3GTUB 3VURA 2B1LA 1YJ6A 1X5DA 1Q4JA 1TRSA 2TRXA 1ST9A 1EGOA 3IR4A 1X9MB 1S3AA 5IQYA 2R4VA 3GN3A 5FWGA 2WZ9A 1T7PB 2VCXA 4HS1A 5KN2A 3GL3A 4OFNA 2PU9C 2RM6A 5ENUA 2DJ0A 3AY8A 2EC4A 2M72A 22GSA 4NWYA 2CZ2A 5ECPB 4GF0A 1PN9A 1GTIA 1MDJA 2XPEA 2C8UA 1XCCA 13GSA 1GP1A 3ME8A 1EV9A 5IOWA 4WF5A 2FA4A 1E2YA 3O76A 2FCHA 5HFKA 1VF3A 5KN3A 4K0GA 5ELGA 1DE1A 3BCKA 1NM3A 2H76A 1XZOA 3CTGA 1HD2A 4BPYA 1RK4A 4FYBA 2K18A 2VLUA 2H71A 1KEBA 1M2DA 4F03A 2GSQA 2N5BA 3FZ4A 3UBLA 3HKRA 1EEJA 1V40A 2R37A 4IQAA 2JACA 4MZWA 4QQ7A 5LNKe 1GTUA 5DJLA 2YV9A 3DEXA 3ZZXA 1PL1A 2C80A 5IPGA 4MCUA 1SL0B 2GZZA 2XHFA 2LRTA 3IPZA 2A2SA 4GSSA 4MJBA 3MDKA 3ZFLA 2O87A 4N11A 3TB2A 3P7XA 4EKZA 1UVZA 3KP9A 1TDIA 3KJYA 6GSWA 4GLTA 5DCHA 2DIZA 2H0HA 5CYYA 4PXOA 4BVXA 2LJRA 3UVHA 4I2TA 4PX1A 2H74A 2WFCA 3KH9A 2B5YA 3TGZA 2HNLA 3VK9A 2VCWA 2RLIA 2VOCA 3QOUA 1GUKA 4XCSA 2FHEA 1UA5A 2IFQB 4HDEA 4WETA 6GSTA 3KTLA 1S3DA 1KBNA 4OMVA 3WYWA 3GFKA 3TKRA 2GQMA 1YF0A 1MTCA 1WWJA 1SKSB 3BJ5A 1QK8A 1SENA 2H73A 4ZIJA 3LXZA 3IAS2 4TR1B 3PGTA 1JZRA 1AC1A 4GQFA 3A3TA 3QCPA 3KXOA 1G6WA 3GKXA 1Z3EA 1TXXA 2FA8A 3H1NA 1G0TA 4TR1A 3RPPA 4BL7A 2AAWA 1JLWA 2GT6A 1V9WA 5INYA 2YWOA 3GMFA 3F4RA 3GYKA 3UIWA 4Q5RA 3I9V2 3EE2A 3KMNA 1V57A 1AQVA 1XOAA 2VL2C 3QAVA 3ZIVA 16GSA 3KGKA 4DVCA 1XVQA 5F8BA 3E9JB 5IO0A 4F2IA 2IMEA 2IMKA 5CRDA 5JCGA 2H70A 2X64A 2BMXA 1YEXA 2REMA 3HJMA 3CYNA 4ZBAA 3FYGA 1OYJA 5IMFA 5A5KA 3TDGA 2XBQA 3WD6A 4IW9A 3LG6A 5EPFA 4KDUA 1K0AA 2C3TA 1M7TA 4LMVA 4ZB6A 3VPTA 1TP9A 1TKDB 4OWYA 2YWNA 2YOIA 1GLQA 2HYXA 1GULA 1DSBA 1TU8A 1HNCA 4DEJA 2XC2A 3RDWA 2C0FA 3GH6A 1EOHA 3VLNA 4I6XA 3GA4A 1PX6A 2JSYA 5IMCA 2X8GA 4K7NA 4F0BA 4V2LA 3F9UA 3GKMA 1SU9A 3IHQA 4LL4B 1EP7A 1K3YA 1GTBA 3PR8A 5DAKB 3KCMA 2GT5A 3LWAA 1XXUA 1SL1B 1DE2A 2B1KA 4HUAA 1T4ZA 4RUVA 2H1DA 1SD9A 2KP1A 4ZB8A 3US3A 1BYEA 1THXA 1EZKA 1K0DA 2X8HA 2RM5A 2YJ7A 1SYXA 3G9BA 1ZL9A 5G1LA 3ERGA 3L9VA 4XS6A 1GSFA 3JCML 2LRCA 4BVYA 4NHZA 3RPNA 4KCEA 1VRSD 1GUHA 2AUVA 3MNGA 2G0FA 2H01A 3GRXA 3GSSA 5COHA 5AGYA 3KD0A 3C71A 5J5NA 2QGVA 1ZYQB 2H1GA 1PQNA 4JU5A 1OE8A 3ZFBA 2PVQA 4KA0A 1ACVA 2Z9SA 4FIWA 5HFGA 4D73A 2C3NA 3TRQA 2VIMA 1GSSA 4GSNA 3GSTA 1Z7PA 3HJOA 2C3QA 1GNEA 2LEGA 1TRVA 3QMXA 1V58A 3ZMLA 2P5QA 2ZCTA 18GSA 4POKA 3ZVJA 2YN1A 2ES7A 14GSA 17GSA 2ZUPA 3TCOA 2LS5A 3MSZA 3EURA 3TUEA 2WDUA 2A4VA 3VWXA 1QMVA 3D4MA 5D9WA 2MBSA 4MP4A 4G9HA 3HHVA 1OC8A 3FR9A 3TOUA 2LNTA 4E8EA 4TOPA 3CSIA 5L71A 3ZRDA 2LTKA 4HI7A 1QQ2A 1RW1A 2DC5A 5F06A 3TJKA 4N0ZA 5A4UA 4TR3A 1U6TA 3G7JA 3LEFA 3KP8A 20GSA 4EO3A 2WRTA 3ERWA 1ZOFA 1J08A 2B5EA 5ECMB 1Z7RA 3EWLA 1FHEA 2OE0A 2R5GA 5C04A 4D73B 1TJDA 4MZCA 2FWGA 2PGTA 4HJMA 2GQKA 4ZL8A 3M8NA 1YF1A 2B3SA 1XWAA 3IXRA 1K0OA 5DAKA 1J0FA 1CQHA 1F9MA 2MZCA 2YPMA 1AXDA 1SK2A 1UC7A 1USBA 4Z7XA 1VF2A 2GS3A 3TKSC 1TOFA 2OADA 4OFTA 1O8WA 4POMA 4MF7A 5EY6A 1QGVA 4GSTA 4KDXA 1B48A 2GTUA 3L4NA 1TU7A 2YV7A 3EU4A 1H4OA 2DSAA 2PMTA 1FO5A 1ERVA 3TKSE 2C0EA 5ECSA 2DJ3A 2J9HA 1ERWA 2WGRA 3UVTA 5GSSA 3CSHA 2IMDA 1AQWA 3NOFA 3RHBA 1F37A 1M99A 4L5OA 1PRXA 1VF1A 4RQXA 1SJZA 2OBIA 1EV4A 5G31A 2IPAA 1SL2B 1Y25A 2K8VA 2R3XA 3F63A 4LA1A 1QXHA 4WF4A 3BCIA 4G10A 5GSTA 4HU7A 2L6DA 1OKDA 4TVEA 1XWKA 1QUWA 2OA7A 3HXSA 4KGIA 4XTSA 2IFQA 2H6ZA 4GQCA 3GX8A 1A2MA 4DSSA 5ECLB 5GAPD 4QL9A 4PGTA 1G6YA 4P3YB 3IA1A 1TRWA 2VL3A 3GV1A 1Q98A 2CQ9A 1YDKA 3J7Yb 3QAGA 4G2EA 3EC3A 3DKSA 2GQLA 1XW5A 3HDCA 3W6GA 3ZVJD 5B8BA 2OE3A 4XS4A 2PPTA 4ACSA 4EF0A 2DJ1A 4IELA 2DIYA 5AISA 1A23A 2A2RA 2VO4A 3D21A 5ECRB 1R5AA 1XWBA 2NTOA 2GDRA 5J4UA 4KX4A 2I81A 1O7UA 3LGCA 1B8XA 1IYIA 2FGXA 3HJPA 1PD21 2C0DA 4OCEA 1AUCA 2HZEA 5B8AA 5J9CA 4TXOA 3N9JA 1WOUA 3VI5A 4Q5NA 1GL8A 4MJCA 4WKWA 1NSWA 3CTFA 3WGEA 2EIOA 1HYUA 5B7CA 1F3BA 4ZL9A 3DVXA 3WGXA 1B9XC 2C0GA 1OC9B 3D22A 4ECBA 2WS2A 3FRCA 4KE3A 4TW5A 1O81A 4JR4A 2R2JA 3H93A 5HQPA 1KTEA 3GL5A 3V1WA 5D93A 1T8EB 2K8SA 1EWXA 4AJ6A 4WR4A 1JZDA 1XWCA 5D73A 4ECCA 4XHMA 3EYTA 3TJFA 1MD3A 3GX0A 2H1AA 2L4CA 2YANA 2IL3A 2FD3A 2YCDA 1U88A 6GSXA 3BBYA 4CW9A 3L9UA 4I97A 4J2FA 1EGRA 2CVDA 5A4VA 1IYHA 4K2DA 1FB6A 5LD0A 3TKPA 4O7HA 2HSHA 1BEDA 1UN2A 1MEKA 4X43A 4EVMA 4XS1A 2OJLA 4NAXA 1GSYA 3GUSA 2CZ3A 3TOTA 1ILOA 1NW2A 4NV5A 1KNGA 3APQA 5E4WA 1X5EA 2LUSA 5CNWA 3IAM2 4WBJA 3C7MA 1O6JA 4KSOA 3BOAA 2DLXA 4O5RA 5LCZA 2PBJA 5ECNB 2M46A 3FHKA 2LV3A 4N0VA 5F0GA 4ISDA 3BD2A 4NV2A 3A2VA 4KSMA 3TJJA 2YNXA 3M1GA 1GLPA 3GURA 2VAFA 1F3AA 9GSSA 4IQ1A 3IV4A 4PQHA 2JL4A 2AJQB 3TRPA 2HLSA 3HCZA 3N5OA 3TKQA 2MBTA 4Q5FA 2CA8A 1BJXA 4JZQA 1N2AA 3GH9A 3Q74A 3M9JA 2ON5A 4V2MA 1AIUA 5DALA 3HY2A 3EU3A 3F8UA 3GNJA 2VM1A 1LBKA 3HD5A 4N10A 3H8QA 3ZTLA 1HNAA 4NXIA 3FW2A 5ELAA 3CMIA 2P5RA 5IPHA 5JWOB 2JSZA 4KAEA 1GWCA 2AHEA 3KH7A 5ID2B 1M9BA 3IBHA 4CHSA 1OAZA 4DSQA 2VCZA 2FWFA 5KN0A 4PNFA 3IC4A 4MPGA 2B7JA 5JCWA 2JZSA 1LU4A 1H75A 1K0CA 4IHUA 1YKCA 4IJIA 1SK1A 3F6FA 5E59A 2CT6A 4TN8A 1ZYEA 3ZMKA 1Z5YE 1OE7A 3QD9A 3CRUA 1ZZYA 1MDKA 2HZEB 1T4YA 4WBRD 3M0FA 1HQOA 4MF6A 5HR0A 2VCQA 3HVSA 4JE1A 3SWLA 1PSQA 2DJJA 3UEMA 1K3LA 1T1VA 5DQSA 1M2BA 4GCIA 2NVLA 2I9HA 4OCFA 2HI7A 4V2NA 2C4JA 4OFMA 4PUAA 1ZMAA 3E0UA 2E2MA 4ULXA 2YP6A 2F8FA 3VWWA 1X5CA 2H0GA 1GSUA 1A24A 4PQIA 2WULA 3ZLPA 1AAZA 3O6TA 4YAVA 4HEA2 1W89A 3WT2A 3U5RE 4MABA 2OE1A 1YZXA 2O7KA 1K0BA 3TRXA 5IIZA 1SD8A 3HA9A 2CVKA 4LMWA 2V2GA 3QAWA 2IJYA 2GVPA 2WB9A 3FY7A 3F4SA 1A2JA 1OVNA 3E3EA 3QR6A 4K6XA 3APSA 4BA7A 3LORA 4TXVA 1BG5A 2AV4A 2WCIA 2OACA 1WPIA 4K7OA 4KDYA 5DDLA 1ML6A 2RUEA 2VD0A 12GSA 2VLTA 4L8EA 2TRCP 3F4TA 3ZL5A 3C1SA 3U6VA 3UBKA 1HNBA 5ECQB 2VLVA 4GXZA 4RQRA 2O89A 2CVBA 1THOA 3VWUA 3S9FA 4KH7A 1M0UA 5HR2A 4EDYA 3DVWA 4L0UA 4ILFA 6GSSA 4TRXA 1OKTA 3Q19A 5F05A 1XVWA 3O3TA 1A2LA 4PNGA 4JR6A 2QSIA 1R7HA 1S3CA 5IMDA 1GSEA 1W4VA 3IOSA 3I69A 5D96A 2IMIA 4HOJA 3DRNA 1ON4A 5ABRA 5EVOA 2F3MA 3FZ9A 4MDCA 2H72A 4RI6A 3CBUA 2KP2A 2AB6A 5G2ZA 2CX3A 3ZIJA 1TK8B 2PN8A 1J9BA 2H30A 2G2QA 4PUFC 1FG4A 4IBPA 3PINA 4XRDA 5FT3A 3M9KA 4WEYA 1XW6A 4HZ4A 3NIVA 1JHBA 2LJKA 2E2GA 3UJ1A 3C1RA 2GGTA 3D0ZA 3C8EA 3WT1A 3EMPA 4XRAA 4DSRA 2KOKA 4HQZA 1N8JA 2HRFA 5AIVA 1GH2A 3UL3A 4YQMA 5HR3A 3F3QA 3Q6OA 4O32A 3FZ5A 4XS4B 4ECIA 4ML6A 3HVVA 1VGLA 1YKAA 3I43A 3ZYWA 2YWMA 4IJ3A 2QC7A 3TJGA 4QL7A 4NHWA 1F2EA 4BWSA 4I2UA 2DBCA 5IMAA 4IN0A 3LFLA 1XBSA 2IMFA 1I5GA 2OBKA 2VUPA 2HSYA 1R4WA 5CP1A 5H5RA 2LRNA 2KLXA 4KNDA 2LQOA 1Z6NA 4X0XA 5DCGA 3D6IA 2GSSA 1SYRA 2GZYA 3DXBA 4AJ8A 4MMMA 2YZUA 1BX9A 1WRYA 2V32A 3LYKA 19GSA 3QDNA 1A8YA 2M80A 4IVFA 1ZGNA 1TTZA 1Z6MA 2LQQA 2N5FA 5G30A 4OD7A 4GTUA 3RHCA 2KHPA 3LYPA 5F07A 5IO2A 3DIEA 1BQ7A 4ZL7A 1U3IA 4OO4A 1VF4A 3FK8A 1NHOA 4EDZA 3FZAA 1GUMA 3H79A 2MMOA 2L4QA 2V6KA 2XBIA 3A2WA 2YZHA 3L0HA 1JZOA 1SK0A 6GSYA 4ML1A 1FVJA 5JWRB 4HJ2A 1V98A 3LJRA 5DBQA 4AGSA 2IN3A 3RBTA 2LKUA 4EC0A 3D5JA 4MLYA 4EUYA 1XWGA 5H5QA 4LLRA 4POBA 2CV4A 1ZCPA 1YY7A 2K9FA 3A2XA 4ZB9A 2YJHA 4JRRA 2I3YA 4CDOA 3OR5A 2FLSA 3F3RA 3P8WA 3F0IA 2CX4A 1U3AA 1ABAA 1TK0B 1M9AA 2H6XA 3J7Yk 1XIYA 2P0GA 2RIIA 4EXJA 2GZPA 3CRTA 1FB0A 4K0NA 1GSQA 2PWJA 1PMTA 2FNOA 2PVOC 2LNSA 2O85A 2V6OA 6GSVA 2DJKA 2HXKA 5ECIB 5EL8A 2IIYA 1MDIA 3IK7A 5DQYA 2RUFA 4MZBA 2N5AA 5AIXA 3MAKA 3I6AA 7GSSA 2P31A 5CO3A 2VM2A 8GSSA 1MD4A 2VD1A 2O8VB 3VWVA 1EOGA 5JCUA 3QFAC 3W8JA 5GZZB 4ECJA 5D9XA 1PL2A 3PH9A 1NHYA 4HU9A 1U87A 3FKFA 2GSRA 4PQ1A 3ZREA 2ZNMA 4KCAA 3KTBA 5J9BA 2WJUA 2H66A 3P2AA 2X99A 1WMJA 1EEMA 4PURA 1WE0A 5ID2A 4FYUA 3IRAA 11GSA 3DYRA 2K6VA 2I4AA 1FVKA 3MWHA 3GKNA 1WIKA 1XOBA 1AW9A 5J41A 1PKZA 1B4PA 4YQUA 1F6MC 4AJ7A 1URMA 2X8CA 1X0RA 2BTOT 4I5QA 2PERA 2F8AA 1Z9HA 4GRFA 1R26A 2JU5A 4AF2A 4KB3A 4K7IA 3C73A 5ECOB 2ALBA 5CRWA 3GTUA 2B6MA 3K8NA 1TI1A 4IP6A 2C1YA 1O85A 4HZ2A 2PUKC 3W8SA 5CAXA 2B7KA 6GSUA 4TKYA 4X1UA 2GLRA 3HVXA 5B6MA 5CREA 3KZQA 4E8HA 2H75A 1EP8A 1E6BA 4WR5A 4POLA 4G19A 4KW6A 3DD3A 2L5OA 4ZILA 1T00A 2E7PA 3VI7A 5H5SA 2NPBA 4EL1A 1JZWA 2H19A 4ZXGA 2HZFA 3DGQA 4EE0A 1TI3A 2FUG2 4ZBDA 3UOMA 5J3RA 4K8MA 5G1KA 4RI7A 4I8BA 2L6CA 3UAPA 3ZITA 1OC9A 1YEPA 5ECKB 3NZNA 2E0QA 3HYPA 4WXTA 2NDOA 1PGTA 2MYGA 1R5PA 1T3BA 4TR0A 3HZ8A 3M3MA 2H1BA 1OC3A 1B9YC 1XW9A 3KEBA 5GAND 2MMZA 3ERFA 4MJEA 3CXGA 1K0NA 1K3OA 4IS0A 1TW9A 1XFLA 3FR6A 4XIHA 4TR4A 1O8XA 1AQXA 1GSDA 1PKWA 4LL1B 5DJMA 4BWQA 4YQVA 5DVBA 3EVIA
chains in the Genus database with same CATH superfamily
2JZRA 2QA2A 2JGPA 5KN1A 1SJ6A 3LXTA 3UARA 3G7IA 1GNWA 4U0AA 2L57A 3LSZA 2EHSA 4NPBA 1LJRA 1CQGA 2V1MA 3H4KA 2B5XA 1X9WB 2DJ2A 2GYKA 3ME7A 5IMVA 3G71P 3IDVA 1I9DA 3EINA 3CCSP 2FAEA 1QVGO 4NMUA 5D9VA 5KEJA 2DMLA 5C00A 3CSJA 4H86A 5CRHA 2F51A 3VPQA 2JZTA 2L5LA 2LSTA 2AYTA 3VFIA 5HFIA 1RQMA 4OO5A 2R0CA 2VCVA 4MA9A 1SJIA 4L5LA 4IKHA 1M6NA 4MH3A 3G6EP 3GKLC 2F9SA 3TJBA 2L59A 4MF5A 4FH8A 2GSTA 2K0XA 3GHAA 1Y6EA 5G5FA 5ECHB 1FOVA 1X9SB 2KOPA 3WBHA 3LMOA 4J56E 2H8LA 4QNBA 2D2ZA 1C72A 3APOA 1ERUA 4TXOB 4K9ZA 3TKSA 2GDWA 5A4WA 1G7EA 2KOSA 5G5EA 3R3EA 2FWEA 1PX7A 3DMLA 3UMAA 2CAQA 3A5WA 3RG2A 5HR1A 3G7YA 1A0RP 2VL9A 4MK3A 4V1Ag 1FW1A 2HRNA 3EMXA 1DBYA 3FEUA 1GRXA 1TK5B 1XPVA 2NBSA 1N8RQ 5EW5E 5BS1A 3WGDA 4L0WA 1V2AA 1B4QA 3IK9A 4ZBBA 1DUGA 1BAYA 2QKEA 2KGAA 2I1UA 2MMAA 1S3RA 2N5IA 4YAPA 3D4TA 5KOWA 3KM6A 1K73Q 2KUCA 1S72P 3L78A 3P90A 1M2AA 4KUNA 1PA3A 2IWTA 2R6KA 3MGEA 4JBBA 5DALB 5D9TA 3GKKA 3Q18A 2HFDA 5IOXA 2TIRA 2FWHA 2H0IA 2LJAA 2VLPA 4F0CA 2H6YA 1FAAA 5FHIA 3KIJA 3RAZA 3F6DA 2EIQA 2BJXA 1GTAA 2Z46A 3IE3A 4O5QA 5HVCA 1K30A 2VL2A 1K0MA 3ED3A 2V41A 2JU2A 1TRUA 2HSMA 2FY6A 4V1Ap 3MIXA 2MMNA 3NTEA 3KMOA 2N6ZA 4MH2A 5CRGA 1YQ1A 4O92A 4U0DA 4IP1A 1WJKA 4DSSB 2K5XA 3HZ4A 4Q5QA 4JEDA 2JADA 2J23A 4FYCA 3QFBC 4ICYA 2KOOA 2CQ8A 4N30A 1QFNA 1JFUA 1SKRB 4J57E 4ID0A 2CAIA 1BXIA 4FO5A 2XXMA 1VKUA 3DWVA 2HE3A 4F82A 1O73A 4K1FA 1AUMA 4IGJA 2EIRA 4F9ZA 4HQSA 2DMMA 2VCTA 5IMZA 5D8IA 3L9SA 2HT9A 2X2BA 2ON7A 1WP0A 1A0FA 10GSA 1VQ9P 5AN1A 3SBCA 1A8LA 5B6NA 1JLVA 3FR3A 3GIXA 3R2QA 4MJAA 1SKWB 5JWQB 4XFZA 3CCMP 2XPDA 4YH2A 2R0GA 3G29A 4GWRA 4HSCX 1ERTA 3G1IA 1M90Q 3LQ7A 3QPMA 4MPFA 1G7OA 5IM9A 3ISOA 2KGCA 2YWIA 2OKAA 3GTUB 3VURA 2B1LA 1YJ6A 2LIUA 1X5DA 1Q4JA 2K93A 1TRSA 2TRXA 1ST9A 1EGOA 3IR4A 4IPYA 1X9MB 1S3AA 4MNNA 5IQYA 2R4VA 3GN3A 5FWGA 2WZ9A 4PH0A 1T7PB 2VCXA 4HS1A 2LTEA 5KN2A 5HGLA 3GL3A 4CY8A 4OFNA 1E6JP 2PU9C 2RM6A 2DJ0A 5ENUA 3AY8A 2EC4A 2M72A 22GSA 4NWYA 2CZ2A 2EG5A 2MR7A 5ECPB 2GZEA 4GF0A 1K9MQ 1PN9A 1GTIA 5BS2A 1MDJA 2M8NA 2XPEA 2C8UA 4QKOA 1XCCA 13GSA 1GP1A 4BVXB 3ME8A 1EV9A 2XT1A 5IOWA 4WF5A 2FA4A 1E2YA 3O76A 4XFXA 2FCHA 1RO0A 5HFKA 1VF3A 5KN3A 4K0GA 5ELGA 1DE1A 3BCKA 1NM3A 2H76A 1XZOA 5EJDA 3CTGA 4F37A 1HD2A 4BPYA 1RK4A 4FYBA 4BPHA 2K18A 1JJ2O 4U0EA 2VLUA 2H71A 1KEBA 1M2DA 4F03A 2GSQA 2E1MA 2N5BA 3FZ4A 1L0HA 3UBLA 3HKRA 1EEJA 1V40A 2R37A 4IQAA 2JACA 4MZWA 4QQ7A 2CGQA 5JPAA 5LNKe 1K8AQ 1GTUA 5DJLA 2GDXA 2YV9A 3DEXA 3ZZXA 1PL1A 2C80A 5IPGA 4MCUA 1SL0B 2GZZA 2XHFA 2LRTA 3IPZA 2A2SA 4GSSA 4MJBA 3MDKA 3ZFLA 2O87A 4N11A 3DPHA 3TB2A 3P7XA 1F80D 4EKZA 1UVZA 3KP9A 1TDIA 3KJYA 6GSWA 4GLTA 5DCHA 2DIZA 2H0HA 5CYYA 4PXOA 4BVXA 2LJRA 3UVHA 4I2TA 4PX1A 2H74A 2WFCA 1PFOA 3KH9A 2B5YA 3TGZA 2KWLA 2HNLA 3VK9A 2PNGA 2VCWA 2RLIA 3G21A 2VOCA 3QOUA 1GUKA 4XCSA 2FHEA 1UA5A 3HVNA 2IFQB 4HDEA 4WETA 6GSTA 3KTLA 1S3DA 1KBNA 4OMVA 3WYWA 4EIPA 3GFKA 3TKRA 2GQMA 1YF0A 1MTCA 1WWJA 1SKSB 3BJ5A 1QK8A 1SENA 2H73A 1PN0A 4ZIJA 1AF8A 3LXZA 3IAS2 2GZIA 4TR1B 3PGTA 1JZRA 1AC1A 3VRLC 4GQFA 3A3TA 3B4QA 3QCPA 3KXOA 1G6WA 3GKXA 1Z3EA 1TXXA 2FA8A 3H1NA 1G0TA 4TR1A 3RPPA 4BL7A 2AAWA 1JLWA 2GT6A 1V9WA 2XZ1C 1VQLP 5INYA 2YWOA 3GMFA 2VLNA 3CXCO 3F4RA 3GYKA 3UIWA 4XROA 3I9V2 4Q5RA 3EE2A 3KMNA 1VQOP 1V57A 1AQVA 1IUQA 1XOAA 2MD9A 2VL2C 3QAVA 4G0KA 3ZIVA 16GSA 2PEOA 3CMEP 3KGKA 4DVCA 1XVQA 2VLOA 5F8BA 3E9JB 4XFYA 5IO0A 4F2IA 1FOHA 2IMEA 2IMKA 5CRDA 5JCGA 2QNWA 1VQ5P 2H70A 2X64A 2BMXA 1YEXA 2REMA 3HJMA 2MF4A 2K0YA 3CYNA 4ZBAA 3FYGA 5HGNA 1OYJA 5IMFA 2PENA 4BPFA 5A5KA 3TDGA 2XBQA 3WD6A 3M1MA 4X4JA 4IW9A 3LG6A 5EPFA 4KDUA 1K0AA 2C3TA 1M7TA 4LMVA 4ZB6A 3VPTA 1TP9A 1TKDB 2L6EA 4OWYA 2YWNA 2YOIA 1GLQA 2HYXA 1GULA 2A4HA 2K92A 1DSBA 1KD1Q 1TU8A 1HNCA 4DEJA 2XC2A 3RDWA 2C0FA 3GH6A 1EOHA 2WPTA 3VLNA 4I6XA 3GA4A 1PX6A 2JSYA 5IMCA 2BUOA 2X8GA 4K7NA 4F0BA 4V2LA 3F9UA 3GKMA 4USSA 3EJBA 1SU9A 3IHQA 4LL4B 1EP7A 1K3YA 1GTBA 3PR8A 2ROQA 4YKFA 5DAKB 2JO0A 2KGEA 3KCMA 2KG9A 1GXHA 2AF8A 2GT5A 3LWAA 1XXUA 2JYLA 1SL1B 1DE2A 2B1KA 4HUAA 4Z2TA 1T4ZA 3CC4P 4RUVA 1EMVA 1KLPA 2H1DA 1Q81Q 1SD9A 2KP1A 4ZB8A 3US3A 1BYEA 1THXA 2FVAA 4GR6A 1EZKA 1K0DA 2X8HA 2RM5A 2YJ7A 2KR5A 3CMAP 1SYXA 3G9BA 1ZL9A 5G1LA 1UNKA 3ERGA 3L9VA 4XS6A 1GSFA 3JCML 1HY8A 4Z2RA 2LRCA 4BVYA 4NHZA 3RPNA 4KCEA 1VRSD 1GUHA 2AUVA 3MNGA 2G0FA 2H01A 3GRXA 3GSSA 5COHA 5AGYA 3KD0A 3C71A 5J5NA 2QGVA 2M8LA 1ZYQB 2H1GA 1PQNA 4JU5A 1OE8A 3ZFBA 1HQBA 2PVQA 4KA0A 1ACVA 2Z9SA 4FIWA 4BVYB 5HFGA 4D73A 2OARA 2C3NA 3TRQA 2VIMA 1GSSA 4GSNA 3GSTA 1Z7PA 3HJOA 2C3QA 1GNEA 2LEGA 1TRVA 1NJIQ 3QMXA 1V58A 3ZMLA 2P5QA 2ZCTA 18GSA 4POKA 3ZVJA 3HYBA 2YN1A 1KQSO 2ES7A 14GSA 3U43A 17GSA 2ZUPA 2LS5A 3MSZA 3TCOA 3EURA 3TUEA 2WDUA 2A4VA 3VWXA 1QMVA 3D4MA 5KP6B 2QEXP 5D9WA 2MBSA 4MP4A 4G9HA 3HHVA 1OC8A 1VQKP 3FR9A 3TOUA 2LNTA 4E8EA 4TOPA 3CSIA 5L71A 3ZRDA 4EIQA 4BPGA 2LTKA 4CY6A 4HI7A 1QQ2A 1VQ8P 4COCA 1RW1A 2DC5A 5F06A 2NO8A 3TJKA 4BL7B 4N0ZA 4K5SA 5A4UA 4TR3A 2HRKA 1U6TA 3G7JA 4PH1A 3LEFA 3KP8A 20GSA 1A8OA 4EO3A 2WRTA 3ERWA 1ZOFA 1J08A 2B5EA 5ECMB 1Z7RA 1ZYPA 3EWLA 1FHEA 2OE0A 2R5GA 5C04A 4D73B 1TJDA 4MZCA 2FWGA 2PGTA 4HJMA 2GQKA 2FADA 4ZL8A 3M8NA 4H2WC 1YF1A 2B3SA 1XWAA 3IXRA 1K0OA 5DAKA 1J0FA 1CQHA 1F9MA 2MZCA 2YPMA 1AXDA 1SK2A 4DG9A 1UC7A 1USBA 4Z7XA 1FR2A 1VF2A 2GS3A 3TKSC 1TOFA 2FQ0A 2OADA 4OFTA 1O8WA 4POMA 4MF7A 5EY6A 4G0LA 1QGVA 2AVAA 4GSTA 4KDXA 1D1DA 1B48A 2GTUA 3L4NA 1TU7A 2YV7A 4MRTC 3EU4A 1H4OA 2DSAA 2PMTA 1FO5A 1ERVA 3TKSE 2C0EA 5ECSA 2DJ3A 2LL8A 1ERWA 2J9HA 2WGRA 3UVTA 5GSSA 3CSHA 2IMDA 1AQWA 3NOFA 3RHBA 1XG8A 1F37A 1M99A 4L5OA 1PRXA 1VF1A 4RQXA 1SJZA 2OBIA 1EV4A 5G31A 2IPAA 1SL2B 1VQMP 1Y25A 2K8VA 2R3XA 3F63A 4LA1A 1QXHA 4WF4A 1M3JA 2N6YA 1YJWP 3BCIA 4G10A 5GSTA 4HU7A 1YHQP 2L6DA 2EIAA 1OKDA 4TVEA 4U0CA 1XWKA 1QUWA 2OA7A 3HXSA 4KGIA 4XTSA 2FVFA 2IFQA 2H6ZA 4GQCA 3GX8A 1A2MA 4DSSA 5ECLB 5GAPD 4QL9A 4PGTA 1G6YA 2M8PA 4P3YB 3IA1A 1TRWA 1UJZA 3GV1A 2VL3A 1ZMBA 5F2NA 1Q98A 2CQ9A 1YI2P 1YDKA 3J7Yb 3QAGA 4G2EA 3EC3A 3DKSA 2GQLA 1XW5A 3HDCA 3W6GA 5DCKA 3ZVJD 5B8BA 2OE3A 4XS4A 2PPTA 4ACSA 5CZDB 4EF0A 2DJ1A 2PEMA 2DIYA 4IELA 1A23A 5AISA 1M3IA 2A2RA 2VO4A 3D21A 5ECRB 1R5AA 2CG5B 1XWBA 2NTOA 2GDRA 5J4UA 4KX4A 4U0BA 2I81A 1O7UA 3LGCA 1B8XA 1IYIA 3P05A 2FGXA 3Q20A 3HJPA 1PD21 3NY7B 2C0DA 4OCEA 1AUCA 2HZEA 1EOQA 5B8AA 5J9CA 3B5IA 4TXOA 1X3OA 2AFEA 3N9JA 1WOUA 3VI5A 2JB0A 4Q5NA 1GL8A 4MJCA 4WKWA 1NSWA 3CTFA 3WGEA 2EIOA 1HYUA 2N98A 5B7CA 1F3BA 4ZL9A 3DVXA 1GPJA 3WGXA 1B9XC 2C0GA 1OC9B 3D22A 2K2QA 4ECBA 2WS2A 3FRCA 1M1KQ 4KE3A 5KP8B 1O81A 4TW5A 4JR4A 2GDYA 2R2JA 3H93A 5HQPA 1KTEA 3GL5A 3V1WA 5D93A 1T8EB 4XRQA 2K8SA 1EWXA 4AJ6A 4WR4A 1JZDA 1XWCA 5D73A 4ECCA 3I56P 4XHMA 3EYTA 3TJFA 1MD3A 3GX0A 2H1AA 2L4CA 2YANA 2IL3A 1RO2A 4O5UA 2FD3A 2YCDA 1U88A 6GSXA 1IMQA 3BBYA 2X49A 4CW9A 3L9UA 4I97A 4J2FA 1EGRA 2CVDA 3G26A 5A4VA 1IYHA 4K2DA 1FB6A 5LD0A 3TKPA 4O7HA 2HSHA 1BEDA 1UN2A 1MEKA 4X43A 4EVMA 4XS1A 2OJLA 4A5PA 4NAXA 1GSYA 3GUSA 2CZ3A 3TOTA 1E0HA 1NW2A 1ILOA 4NV5A 1KNGA 4FQUA 3APQA 5E4WA 1X5EA 2LUSA 5CNWA 3IAM2 4WBJA 2PEQA 3C7MA 1O6JA 4KSOA 3BOAA 2DLXA 4PTSA 3DS2A 4O5RA 5LCZA 2PBJA 5ECNB 2M46A 2GZFA 3FHKA 2LV3A 4N0VA 5F0GA 4ISDA 3BD2A 3LW9A 4NV2A 3A2VA 2UZ8A 1Q82Q 4KSMA 1VQNP 3TJJA 2YNXA 3M1GA 1GLPA 3GURA 2VAFA 1F3AA 9GSSA 4IQ1A 3IV4A 4PQHA 3I55P 2JL4A 2AJQB 3TRPA 2HLSA 3HCZA 3N5OA 3TKQA 1MZ8A 2MBTA 4Q5FA 2CA8A 1BJXA 4JZQA 2X4AA 1N2AA 3GH9A 1OR5A 3Q74A 3M9JA 3EJEA 3RG6C 2ON5A 4V2MA 5KOXA 1GXGA 1AIUA 5DALA 3HY2A 3CCEP 3EU3A 3F8UA 3GNJA 2VM1A 1LBKA 3HD5A 3CPWO 4N10A 3H8QA 3ZTLA 1HNAA 4NXIA 3FW2A 5ELAA 3CMIA 2P5RA 5IPHA 2L22A 3CCJP 5JWOB 2JSZA 2KG6A 5HGOA 3CCRP 4KAEA 1GWCA 2AHEA 2ERHA 3KH7A 5ID2B 2OTLP 1M9BA 3IBHA 4CHSA 2FQ2A 1OAZA 4DSQA 2FACA 2VCZA 2FWFA 3G28A 5KN0A 4PNFA 3IC4A 4MPGA 2B7JA 1VHNA 5JCWA 2JZSA 2FQ1A 1LU4A 1H75A 1K0CA 5KP7B 2Z45A 4IHUA 2N5HA 1YKCA 4IJIA 1SK1A 3F6FA 3GJNA 5E59A 2CT6A 4TN8A 1ZYEA 3ZMKA 2HRAA 1Z5YE 1IMPA 1OE7A 3QD9A 3CRUA 1ZZYA 1MDKA 2HZEB 1CEIA 1T4YA 3H4EA 4WBRD 3M0FA 1HQOA 4U0FA 4MF6A 5HR0A 2VCQA 3HVSA 4JE1A 3SWLA 1PSQA 2DJJA 3UEMA 1K3LA 3DS5A 1YJ9P 1T1VA 5DQSA 1M2BA 2JQ4A 4GCIA 2NVLA 2I9HA 4OCFA 2DKIA 2HI7A 3CCVP 4V2NA 2C4JA 4OFMA 4PUAA 1ZMAA 3E0UA 3IC8A 2E2MA 4ULXA 2GZGA 2YP6A 2F8FA 3VWWA 1X5CA 1QRJA 3G4SP 2H0GA 1GSUA 1A24A 4PQIA 2WULA 3ZLPA 1AAZA 3O6TA 4YAVA 4HEA2 1W89A 2PY8A 3WT2A 3U5RE 4MABA 2OE1A 2A2PA 4H2XC 1YZXA 2O7KA 1L0IA 1K0BA 1KC8Q 4K5RA 2QA4P 3TRXA 5IIZA 1SD8A 3HA9A 1AYIA 2CVKA 4LMWA 2V2GA 3QAWA 2IJYA 2GVPA 2WB9A 3H0DA 3EJDA 3FY7A 3F4SA 1A2JA 1OVNA 3E3EA 3QR6A 4K6XA 3APSA 4BA7A 3LORA 4TXVA 1BG5A 2AV4A 2WCIA 2OACA 4PWVB 1WPIA 4K7OA 4KDYA 5DDLA 3GZLA 1ML6A 2RUEA 2VD0A 12GSA 3CCLP 3CQFA 2VLTA 4L8EA 2TRCP 3F4TA 3ZL5A 3C1SA 4G0IA 3U6VA 3UBKA 1HNBA 5ECQB 2VLVA 4GXZA 4RQRA 2O89A 2CVBA 1THOA 3VWUA 3S9FA 3MYDA 4KH7A 1M0UA 5HR2A 4COPA 4EDYA 3DVWA 4L0UA 4ILFA 5BRTA 6GSSA 4TRXA 3H47A 4IZ6A 1OKTA 3Q19A 5F05A 1XVWA 3O3TA 5HGMA 1A2LA 4PNGA 4JR6A 2QSIA 1R7HA 1S3CA 1GSEA 1W4VA 5IMDA 3IOSA 3I69A 5D96A 2IMIA 4HOJA 3G0VA 3A5IA 5BMUA 3DRNA 1ON4A 5ABRA 2GZJA 5EVOA 2F3MA 3FZ9A 4MDCA 2H72A 4RI6A 4YKGA 1EIAA 4GR2A 3CBUA 2KP2A 2AB6A 1A43A 1M74A 2LKIA 2CX3A 5G2ZA 3ZIJA 1TK8B 2PN8A 1J9BA 2K0DX 2H30A 2G2QA 4PUFC 1FG4A 4IBPA 3PINA 2KG8A 4XRDA 2MR8A 5FT3A 3DS0A 1Q7YQ 3M9KA 4WEYA 1XW6A 4HZ4A 3NIVA 1JHBA 2LJKA 2E2GA 3UJ1A 3C1RA 3CE7A 5F2KA 2GGTA 3D0ZA 3C8EA 3WT1A 3EMPA 4XRAA 4DSRA 2EHTA 2KOKA 4HQZA 3OW2O 1N8JA 2HRFA 5AIVA 1GH2A 3UL3A 4YQMA 5HR3A 3F3QA 3Q6OA 4O32A 3FZ5A 4R0MA 4XS4B 4ECIA 4ML6A 3HVVA 2N50A 2KW2A 1VGLA 1YKAA 3I43A 3ZYWA 2YWMA 4IJ3A 2QC7A 3TJGA 1YJNP 4NHWA 4QL7A 1F2EA 4BWSA 4I2UA 1M6EX 2DBCA 5IMAA 4IN0A 3LFLA 1XBSA 2IMFA 2JAZA 1RNIA 1I5GA 2OBKA 2KODA 3EPTA 2VUPA 2HSYA 1R4WA 5CP1A 2LPKA 2LF4A 4H2YC 5H5RA 2LRNA 2KLXA 4KNDA 2PEIA 2LQOA 1ZYNA 1Z6NA 4X0XA 5DCGA 3D6IA 2MY5A 3HZQA 2GSSA 1NQ4A 1SYRA 2QA1A 2MVUA 2GZYA 3DXBA 4AJ8A 4MMMA 2YZUA 1BX9A 1WRYA 1ACPA 2V32A 3LYKA 3IHGA 19GSA 2PEJA 2AFDA 3QDNA 1A8YA 2M80A 4M0IA 4IVFA 1ZGNA 3G1GA 1TTZA 1Z6MA 2LQQA 2LMLA 2N5FA 1YITP 5G30A 4OD7A 4GTUA 2DKHA 3RHCA 2KHPA 3LYPA 5F07A 5IO2A 3DIEA 1BQ7A 4ZL7A 1U3IA 4OO4A 1VF4A 3FK8A 1NHOA 4EDZA 2P9XA 1VQ7P 1QVFO 3FZAA 1GUMA 2L9FA 3H79A 2VSQA 2MMOA 2L4QA 2L0QA 2V6KA 2XBIA 2CNRA 3A2WA 2YZHA 3L0HA 1JZOA 1SK0A 6GSYA 4ML1A 1FVJA 4WYMA 5JWRB 4HJ2A 1V98A 3LJRA 5DBQA 4AGSA 2IN3A 3RBTA 2LKUA 2FVEA 4EC0A 3D5JA 4MLYA 2FHSC 4EUYA 3DTJA 1XWGA 5H5QA 4LLRA 4POBA 3CCUP 2CV4A 1ZCPA 1YY7A 2K9FA 3A2XA 3CCQP 4ZB9A 3LRYA 2YJHA 4JRRA 2I3YA 4CDOA 2ONTA 1VQPP 3OR5A 2FLSA 3F3RA 3P8WA 1W2BO 3F0IA 2CX4A 2JBGA 1U3AA 1ABAA 1TK0B 1M9AA 2H6XA 2JYGA 1DV5A 3J7Yk 1XIYA 2P0GA 2RIIA 4EXJA 2GZPA 3CRTA 1FB0A 4K0NA 2KGDA 1GSQA 2PWJA 1VQ4P 1PMTA 2FNOA 2PVOC 2LNSA 1T8KA 2KOQA 2O85A 2V6OA 6GSVA 2DJKA 2HXKA 5ECIB 5EL8A 2EFJA 2IIYA 1MDIA 3IK7A 5DQYA 4CA3A 2RUFA 4UHPB 4MZBA 2N5AA 5AIXA 3MAKA 3I6AA 7GSSA 2XV6A 2DGYA 2P31A 5CO3A 2VM2A 8GSSA 3DS1A 1MD4A 2VD1A 2O8VB 3VWVA 1EOGA 5JCUA 3QFAC 3W8JA 5GZZB 3DS4A 4ECJA 1VQ6P 1PL2A 5D9XA 3PH9A 1NHYA 4HU9A 1U87A 3GZMA 2LIWA 3FKFA 2GSRA 4PQ1A 2CWOA 1ZNVA 3ZREA 2ZNMA 4KCAA 3KTBA 5J9BA 2WJUA 2H66A 2PEKA 3P2AA 2X99A 1WMJA 1EEMA 4PURA 1WE0A 2VLQA 3CD6P 5ID2A 4FYUA 2R0PA 3IRAA 4KF9A 11GSA 3DYRA 2K6VA 2I4AA 1FVKA 3MWHA 3GKNA 1WIKA 1XOBA 1AW9A 5J41A 1PKZA 1B4PA 4YQUA 1F6MC 2BHVA 3CC7P 4AJ7A 1URMA 2X8CA 2XZ0D 1X0RA 2BTOT 4I5QA 2PERA 2F8AA 2Z44A 1Z9HA 4GRFA 1R26A 2JU5A 4AF2A 2MVVA 3PPUA 3CC2P 4KB3A 4K7IA 1DNYA 3C73A 5ECOB 2ALBA 5CRWA 3GTUA 3DS3A 2M5RA 2B6MA 3K8NA 1TI1A 4IP6A 2C1YA 4K2XA 4HZ2A 1O85A 2PUKC 3W8SA 5CAXA 2B7KA 4PXHB 5HV8A 2L4BA 4HKGA 6GSUA 4TKYA 4X1UA 2GLRA 3HVXA 5B6MA 5CREA 3KZQA 4E8HA 2H75A 1EP8A 1E6BA 4WR5A 4POLA 4G19A 4Z2UA 4KW6A 2LOLA 5I4TG 3DD3A 2L5OA 4ZILA 1T00A 2E7PA 2JU1A 3VI7A 5H5SA 2NPBA 4EL1A 1JZWA 2H19A 2K94A 4BIKA 4ZXGA 2HZFA 2KORA 3DGQA 4EE0A 1Q86Q 4NEOA 1TI3A 2FUG2 4ZBDA 3UOMA 5J3RA 4K8MA 5G1KA 4RI7A 4I8BA 2L6CA 3UAPA 2OTJP 3ZITA 1OC9A 1YEPA 1YIJP 5ECKB 7CEIA 3NZNA 3FMWA 2E0QA 3HYPA 4WXTA 2NDOA 1PGTA 2MYGA 1R5PA 1T3BA 4TR0A 3E2DA 3HZ8A 3M3MA 2H1BA 1OC3A 1BAJA 1B9YC 1XW9A 3KEBA 5GAND 2MMZA 3ERFA 4MJEA 3CXGA 1K0NA 1K3OA 4IS0A 1TW9A 2DNWA 1XFLA 3FR6A 5F2OA 4XIHA 4TR4A 1O8XA 1AQXA 1GSDA 1PKWA 4LL1B 5DJMA 4BWQA 4YQVA 5DVBA 3EVIA
chains in the Genus database with same CATH topology
2JZRA 2QA2A 5KN1A 1SJ6A 3LXTA 3UARA 3G7IA 1GNWA 2L57A 3LSZA 4NPBA 1LJRA 1CQGA 2V1MA 3H4KA 2B5XA 1X9WB 2DJ2A 3ME7A 5IMVA 3IDVA 1I9DA 3EINA 4NMUA 5D9VA 5KEJA 2DMLA 5C00A 3CSJA 4H86A 5CRHA 2F51A 3VPQA 2JZTA 2L5LA 2LSTA 2AYTA 3VFIA 5HFIA 1RQMA 4OO5A 2R0CA 2VCVA 4MA9A 1SJIA 4L5LA 4IKHA 4MH3A 2F9SA 3TJBA 2L59A 4MF5A 4FH8A 2GSTA 3GHAA 1Y6EA 5G5FA 5ECHB 1FOVA 1X9SB 4J56E 2H8LA 2D2ZA 1C72A 3APOA 1ERUA 4TXOB 4K9ZA 3TKSA 5A4WA 1G7EA 5G5EA 3R3EA 2FWEA 1PX7A 3DMLA 3UMAA 2CAQA 3A5WA 5HR1A 3G7YA 1A0RP 2VL9A 4MK3A 4V1Ag 1FW1A 2HRNA 3EMXA 1DBYA 3FEUA 1GRXA 1TK5B 1XPVA 2NBSA 3WGDA 4L0WA 1V2AA 1B4QA 3IK9A 4ZBBA 1DUGA 1BAYA 2QKEA 2I1UA 2MMAA 4YAPA 3D4TA 5KOWA 3KM6A 2KUCA 3L78A 3P90A 1M2AA 4KUNA 1PA3A 2IWTA 2R6KA 4JBBA 5DALB 5D9TA 3GKKA 3Q18A 2HFDA 5IOXA 2TIRA 2FWHA 2H0IA 2LJAA 4F0CA 2H6YA 1FAAA 5FHIA 3KIJA 3RAZA 3F6DA 2EIQA 2BJXA 1GTAA 3IE3A 4O5QA 2VL2A 1K0MA 3ED3A 2V41A 1TRUA 2HSMA 2FY6A 4V1Ap 3MIXA 2MMNA 3KMOA 4MH2A 5CRGA 1YQ1A 4O92A 4IP1A 1WJKA 4DSSB 3HZ4A 4Q5QA 4JEDA 2JADA 2J23A 4FYCA 3QFBC 4ICYA 4N30A 1QFNA 1JFUA 1SKRB 4J57E 4ID0A 2CAIA 4FO5A 3DWVA 2HE3A 4F82A 1O73A 4K1FA 4IGJA 2EIRA 4F9ZA 4HQSA 2DMMA 2VCTA 5IMZA 5D8IA 3L9SA 2HT9A 2ON7A 1WP0A 1A0FA 10GSA 5AN1A 3SBCA 1A8LA 5B6NA 1JLVA 3FR3A 3GIXA 3R2QA 4MJAA 1SKWB 5JWQB 2XPDA 4YH2A 2R0GA 4GWRA 1ERTA 3LQ7A 3QPMA 4MPFA 1G7OA 5IM9A 3ISOA 2YWIA 2OKAA 3GTUB 3VURA 2B1LA 1YJ6A 1X5DA 1Q4JA 1TRSA 2TRXA 1ST9A 1EGOA 3IR4A 1X9MB 1S3AA 4MNNA 5IQYA 2R4VA 3GN3A 5FWGA 2WZ9A 1T7PB 2VCXA 4HS1A 5KN2A 3GL3A 4CY8A 4OFNA 2PU9C 2RM6A 5ENUA 2DJ0A 3AY8A 2EC4A 2M72A 22GSA 4NWYA 2CZ2A 5ECPB 4GF0A 1PN9A 1GTIA 1MDJA 2XPEA 2C8UA 1XCCA 13GSA 1GP1A 4BVXB 3ME8A 1EV9A 5IOWA 4WF5A 2FA4A 1E2YA 3O76A 2FCHA 5HFKA 1VF3A 5KN3A 4K0GA 5ELGA 1DE1A 3BCKA 1NM3A 2H76A 1XZOA 3CTGA 1HD2A 4BPYA 1RK4A 4FYBA 2K18A 2VLUA 2H71A 1KEBA 1M2DA 4F03A 2GSQA 2N5BA 3FZ4A 3UBLA 3HKRA 1EEJA 1V40A 2R37A 4IQAA 2JACA 4MZWA 4QQ7A 5LNKe 1GTUA 5DJLA 2YV9A 3DEXA 3ZZXA 1PL1A 2C80A 5IPGA 4MCUA 1SL0B 2GZZA 2XHFA 2LRTA 3IPZA 2A2SA 4GSSA 4MJBA 3MDKA 3ZFLA 2O87A 4N11A 3TB2A 3P7XA 4EKZA 1UVZA 3KP9A 1TDIA 3KJYA 6GSWA 4GLTA 5DCHA 2DIZA 2H0HA 5CYYA 4PXOA 4BVXA 2LJRA 3UVHA 4I2TA 4PX1A 2H74A 2WFCA 3KH9A 2B5YA 3TGZA 2HNLA 3VK9A 2VCWA 2RLIA 2VOCA 3QOUA 1GUKA 4XCSA 2FHEA 1UA5A 2IFQB 4HDEA 4WETA 6GSTA 3KTLA 1S3DA 1KBNA 4OMVA 3WYWA 4EIPA 3GFKA 3TKRA 2GQMA 1YF0A 1MTCA 1WWJA 1SKSB 3BJ5A 1QK8A 1SENA 2H73A 1PN0A 4ZIJA 3LXZA 3IAS2 4TR1B 3PGTA 1JZRA 1AC1A 4GQFA 3A3TA 3QCPA 3KXOA 1G6WA 3GKXA 1Z3EA 1TXXA 2FA8A 3H1NA 1G0TA 4TR1A 3RPPA 4BL7A 2AAWA 1JLWA 2GT6A 1V9WA 5INYA 2YWOA 3GMFA 3F4RA 3GYKA 3UIWA 4Q5RA 3I9V2 3EE2A 3KMNA 1V57A 1AQVA 1XOAA 2VL2C 3QAVA 4G0KA 3ZIVA 16GSA 3KGKA 4DVCA 1XVQA 5F8BA 3E9JB 5IO0A 4F2IA 1FOHA 2IMEA 2IMKA 5CRDA 5JCGA 2H70A 2X64A 2BMXA 1YEXA 2REMA 3HJMA 3CYNA 4ZBAA 3FYGA 1OYJA 5IMFA 5A5KA 3TDGA 2XBQA 3WD6A 4X4JA 4IW9A 3LG6A 5EPFA 4KDUA 1K0AA 2C3TA 1M7TA 4LMVA 4ZB6A 3VPTA 1TP9A 1TKDB 4OWYA 2YWNA 2YOIA 1GLQA 2HYXA 1GULA 2A4HA 1DSBA 1TU8A 1HNCA 4DEJA 2XC2A 3RDWA 2C0FA 3GH6A 1EOHA 3VLNA 4I6XA 3GA4A 1PX6A 2JSYA 5IMCA 2X8GA 4K7NA 4F0BA 4V2LA 3F9UA 3GKMA 4USSA 1SU9A 3IHQA 4LL4B 1EP7A 1K3YA 1GTBA 3PR8A 4YKFA 5DAKB 3KCMA 2GT5A 3LWAA 1XXUA 1SL1B 1DE2A 2B1KA 4HUAA 4Z2TA 1T4ZA 4RUVA 2H1DA 1SD9A 2KP1A 4ZB8A 3US3A 1BYEA 1THXA 1EZKA 1K0DA 2X8HA 2RM5A 2YJ7A 1SYXA 3G9BA 1ZL9A 5G1LA 3ERGA 3L9VA 4XS6A 1GSFA 3JCML 4Z2RA 2LRCA 4BVYA 4NHZA 3RPNA 4KCEA 1VRSD 1GUHA 2AUVA 3MNGA 2G0FA 2H01A 3GRXA 3GSSA 5COHA 5AGYA 3KD0A 3C71A 5J5NA 2QGVA 1ZYQB 2H1GA 1PQNA 4JU5A 1OE8A 3ZFBA 2PVQA 4KA0A 1ACVA 2Z9SA 4FIWA 4BVYB 5HFGA 4D73A 2C3NA 3TRQA 2VIMA 1GSSA 4GSNA 3GSTA 1Z7PA 3HJOA 2C3QA 1GNEA 2LEGA 1TRVA 3QMXA 1V58A 3ZMLA 2P5QA 2ZCTA 18GSA 4POKA 3ZVJA 2YN1A 2ES7A 14GSA 17GSA 2ZUPA 3TCOA 2LS5A 3MSZA 3EURA 3TUEA 2WDUA 2A4VA 3VWXA 1QMVA 3D4MA 5D9WA 2MBSA 4MP4A 4G9HA 3HHVA 1OC8A 3FR9A 3TOUA 2LNTA 4E8EA 4TOPA 3CSIA 5L71A 3ZRDA 4EIQA 2LTKA 4CY6A 4HI7A 1QQ2A 1RW1A 2DC5A 5F06A 3TJKA 4BL7B 4N0ZA 4K5SA 5A4UA 4TR3A 2HRKA 1U6TA 3G7JA 3LEFA 3KP8A 20GSA 4EO3A 2WRTA 3ERWA 1ZOFA 1J08A 2B5EA 5ECMB 1Z7RA 1ZYPA 3EWLA 1FHEA 2OE0A 2R5GA 5C04A 4D73B 1TJDA 4MZCA 2FWGA 2PGTA 4HJMA 2GQKA 4ZL8A 3M8NA 1YF1A 2B3SA 1XWAA 3IXRA 1K0OA 5DAKA 1J0FA 1CQHA 1F9MA 2MZCA 2YPMA 1AXDA 1SK2A 1UC7A 1USBA 4Z7XA 1VF2A 2GS3A 3TKSC 1TOFA 2OADA 4OFTA 1O8WA 4POMA 5EY6A 4MF7A 4G0LA 1QGVA 4GSTA 4KDXA 1B48A 2GTUA 3L4NA 1TU7A 2YV7A 3EU4A 1H4OA 2DSAA 2PMTA 1FO5A 1ERVA 3TKSE 2C0EA 5ECSA 2DJ3A 2J9HA 1ERWA 2WGRA 3UVTA 5GSSA 3CSHA 2IMDA 1AQWA 3NOFA 3RHBA 1F37A 1M99A 4L5OA 1PRXA 1VF1A 4RQXA 1SJZA 2OBIA 1EV4A 5G31A 2IPAA 1SL2B 1Y25A 2K8VA 2R3XA 3F63A 4LA1A 1QXHA 4WF4A 3BCIA 4G10A 5GSTA 4HU7A 2L6DA 1OKDA 4TVEA 1XWKA 1QUWA 2OA7A 3HXSA 4KGIA 4XTSA 2IFQA 2H6ZA 4GQCA 3GX8A 1A2MA 4DSSA 5ECLB 5GAPD 4QL9A 4PGTA 1G6YA 4P3YB 3IA1A 1TRWA 2VL3A 3GV1A 1Q98A 2CQ9A 1YDKA 3J7Yb 3QAGA 4G2EA 3EC3A 3DKSA 2GQLA 1XW5A 3HDCA 3W6GA 3ZVJD 5B8BA 2OE3A 4XS4A 2PPTA 4ACSA 4EF0A 2DJ1A 4IELA 2DIYA 5AISA 1A23A 2A2RA 2VO4A 3D21A 5ECRB 1R5AA 1XWBA 2NTOA 2GDRA 5J4UA 4KX4A 2I81A 1O7UA 3LGCA 1B8XA 1IYIA 2FGXA 3HJPA 1PD21 2C0DA 4OCEA 1AUCA 2HZEA 5B8AA 5J9CA 4TXOA 3N9JA 1WOUA 3VI5A 4Q5NA 1GL8A 4MJCA 4WKWA 1NSWA 3CTFA 3WGEA 2EIOA 1HYUA 5B7CA 1F3BA 4ZL9A 3DVXA 3WGXA 1B9XC 2C0GA 1OC9B 3D22A 4ECBA 2WS2A 3FRCA 4KE3A 4TW5A 1O81A 4JR4A 2R2JA 3H93A 5HQPA 1KTEA 3GL5A 3V1WA 5D93A 1T8EB 2K8SA 1EWXA 4AJ6A 4WR4A 1JZDA 1XWCA 5D73A 4ECCA 4XHMA 3EYTA 3TJFA 1MD3A 3GX0A 2H1AA 2L4CA 2YANA 2IL3A 4O5UA 2FD3A 2YCDA 1U88A 6GSXA 3BBYA 2X49A 4CW9A 3L9UA 4I97A 4J2FA 1EGRA 2CVDA 5A4VA 1IYHA 4K2DA 1FB6A 5LD0A 3TKPA 4O7HA 2HSHA 1BEDA 1UN2A 1MEKA 4X43A 4EVMA 4XS1A 2OJLA 4A5PA 4NAXA 1GSYA 3GUSA 2CZ3A 3TOTA 1ILOA 1NW2A 4NV5A 1KNGA 4FQUA 3APQA 5E4WA 1X5EA 2LUSA 5CNWA 3IAM2 4WBJA 3C7MA 1O6JA 4KSOA 3BOAA 2DLXA 4PTSA 4O5RA 5LCZA 2PBJA 5ECNB 2M46A 3FHKA 2LV3A 4N0VA 5F0GA 4ISDA 3BD2A 3LW9A 4NV2A 3A2VA 2UZ8A 4KSMA 3TJJA 2YNXA 3M1GA 1GLPA 3GURA 2VAFA 1F3AA 9GSSA 4IQ1A 3IV4A 4PQHA 2JL4A 2AJQB 3TRPA 2HLSA 3HCZA 3N5OA 3TKQA 2MBTA 4Q5FA 2CA8A 1BJXA 4JZQA 2X4AA 1N2AA 3GH9A 3Q74A 3M9JA 2ON5A 4V2MA 5KOXA 1AIUA 5DALA 3HY2A 3EU3A 3F8UA 3GNJA 2VM1A 1LBKA 3HD5A 4N10A 3H8QA 3ZTLA 1HNAA 4NXIA 3FW2A 5ELAA 3CMIA 2P5RA 5IPHA 5JWOB 2JSZA 4KAEA 1GWCA 2AHEA 3KH7A 5ID2B 1M9BA 3IBHA 4CHSA 1OAZA 4DSQA 2VCZA 2FWFA 5KN0A 4PNFA 3IC4A 4MPGA 2B7JA 5JCWA 2JZSA 1LU4A 1H75A 1K0CA 4IHUA 1YKCA 4IJIA 1SK1A 3F6FA 5E59A 2CT6A 4TN8A 1ZYEA 3ZMKA 2HRAA 1Z5YE 1OE7A 3QD9A 3CRUA 1ZZYA 1MDKA 2HZEB 1T4YA 4WBRD 3M0FA 1HQOA 4MF6A 5HR0A 2VCQA 3HVSA 4JE1A 3SWLA 1PSQA 2DJJA 3UEMA 1K3LA 1T1VA 5DQSA 1M2BA 4GCIA 2NVLA 2I9HA 4OCFA 2DKIA 2HI7A 4V2NA 2C4JA 4OFMA 4PUAA 1ZMAA 3E0UA 3IC8A 2E2MA 4ULXA 2YP6A 2F8FA 3VWWA 1X5CA 2H0GA 1GSUA 1A24A 4PQIA 2WULA 3ZLPA 1AAZA 3O6TA 4YAVA 4HEA2 1W89A 3WT2A 3U5RE 4MABA 2OE1A 2A2PA 1YZXA 2O7KA 1K0BA 4K5RA 3TRXA 5IIZA 1SD8A 3HA9A 2CVKA 4LMWA 2V2GA 3QAWA 2IJYA 2GVPA 2WB9A 3FY7A 3F4SA 1A2JA 1OVNA 3E3EA 3QR6A 4K6XA 3APSA 4BA7A 3LORA 4TXVA 1BG5A 2AV4A 2WCIA 2OACA 1WPIA 4K7OA 4KDYA 5DDLA 1ML6A 2RUEA 2VD0A 12GSA 2VLTA 4L8EA 2TRCP 3F4TA 3ZL5A 3C1SA 4G0IA 3U6VA 3UBKA 1HNBA 5ECQB 2VLVA 4GXZA 4RQRA 2O89A 2CVBA 1THOA 3VWUA 3S9FA 3MYDA 4KH7A 1M0UA 5HR2A 4EDYA 3DVWA 4L0UA 4ILFA 5BRTA 6GSSA 4TRXA 1OKTA 3Q19A 5F05A 1XVWA 3O3TA 1A2LA 4PNGA 4JR6A 2QSIA 1R7HA 1S3CA 5IMDA 1GSEA 1W4VA 3IOSA 3I69A 5D96A 2IMIA 4HOJA 3A5IA 5BMUA 3DRNA 1ON4A 5ABRA 5EVOA 2F3MA 3FZ9A 4MDCA 2H72A 4RI6A 4YKGA 3CBUA 2KP2A 2AB6A 5G2ZA 2CX3A 3ZIJA 1TK8B 2PN8A 1J9BA 2H30A 2G2QA 4PUFC 1FG4A 4IBPA 3PINA 4XRDA 5FT3A 3M9KA 4WEYA 1XW6A 4HZ4A 3NIVA 1JHBA 2LJKA 2E2GA 3UJ1A 3C1RA 2GGTA 3D0ZA 3C8EA 3WT1A 3EMPA 4XRAA 4DSRA 2KOKA 4HQZA 1N8JA 2HRFA 5AIVA 1GH2A 3UL3A 4YQMA 5HR3A 3F3QA 3Q6OA 4O32A 3FZ5A 4XS4B 4ECIA 4ML6A 3HVVA 1VGLA 1YKAA 3I43A 3ZYWA 2YWMA 4IJ3A 2QC7A 3TJGA 4QL7A 4NHWA 1F2EA 4BWSA 4I2UA 2DBCA 5IMAA 4IN0A 3LFLA 1XBSA 2IMFA 1I5GA 2OBKA 3EPTA 2VUPA 2HSYA 1R4WA 5CP1A 5H5RA 2LRNA 2KLXA 4KNDA 2LQOA 1ZYNA 1Z6NA 4X0XA 5DCGA 3D6IA 2GSSA 1SYRA 2QA1A 2GZYA 3DXBA 4AJ8A 4MMMA 2YZUA 1BX9A 1WRYA 2V32A 3LYKA 3IHGA 19GSA 3QDNA 1A8YA 2M80A 4IVFA 1ZGNA 1TTZA 1Z6MA 2LQQA 2N5FA 5G30A 4OD7A 4GTUA 2DKHA 3RHCA 2KHPA 3LYPA 5F07A 5IO2A 3DIEA 1BQ7A 4ZL7A 1U3IA 4OO4A 1VF4A 3FK8A 1NHOA 4EDZA 3FZAA 1GUMA 3H79A 2MMOA 2L4QA 2V6KA 2XBIA 3A2WA 2YZHA 3L0HA 1JZOA 1SK0A 6GSYA 4ML1A 1FVJA 5JWRB 4HJ2A 1V98A 3LJRA 5DBQA 4AGSA 2IN3A 3RBTA 2LKUA 4EC0A 3D5JA 4MLYA 4EUYA 1XWGA 5H5QA 4LLRA 4POBA 2CV4A 1ZCPA 1YY7A 2K9FA 3A2XA 4ZB9A 2YJHA 4JRRA 2I3YA 4CDOA 3OR5A 2FLSA 3F3RA 3P8WA 3F0IA 2CX4A 1U3AA 1ABAA 1TK0B 1M9AA 2H6XA 3J7Yk 1XIYA 2P0GA 2RIIA 4EXJA 2GZPA 3CRTA 1FB0A 4K0NA 1GSQA 2PWJA 1PMTA 2FNOA 2PVOC 2LNSA 2O85A 2V6OA 6GSVA 2DJKA 2HXKA 5ECIB 5EL8A 2IIYA 1MDIA 3IK7A 5DQYA 2RUFA 4MZBA 2N5AA 5AIXA 3MAKA 3I6AA 7GSSA 2P31A 5CO3A 2VM2A 8GSSA 1MD4A 2VD1A 2O8VB 3VWVA 1EOGA 5JCUA 3QFAC 3W8JA 5GZZB 4ECJA 5D9XA 1PL2A 3PH9A 1NHYA 4HU9A 1U87A 3FKFA 2GSRA 4PQ1A 3ZREA 2ZNMA 4KCAA 3KTBA 5J9BA 2WJUA 2H66A 3P2AA 2X99A 1WMJA 1EEMA 4PURA 1WE0A 5ID2A 4FYUA 2R0PA 3IRAA 4KF9A 11GSA 3DYRA 2K6VA 2I4AA 1FVKA 3MWHA 3GKNA 1WIKA 1XOBA 1AW9A 5J41A 1PKZA 1B4PA 4YQUA 1F6MC 4AJ7A 1URMA 2X8CA 1X0RA 2BTOT 4I5QA 2PERA 2F8AA 1Z9HA 4GRFA 1R26A 2JU5A 4AF2A 3PPUA 4KB3A 4K7IA 3C73A 5ECOB 2ALBA 5CRWA 3GTUA 2B6MA 3K8NA 1TI1A 4IP6A 2C1YA 4K2XA 1O85A 4HZ2A 2PUKC 3W8SA 5CAXA 2B7KA 6GSUA 4TKYA 4X1UA 2GLRA 3HVXA 5B6MA 5CREA 3KZQA 4E8HA 2H75A 1EP8A 1E6BA 4WR5A 4POLA 4G19A 4Z2UA 4KW6A 3DD3A 2L5OA 4ZILA 1T00A 2E7PA 3VI7A 5H5SA 2NPBA 4EL1A 1JZWA 2H19A 4ZXGA 2HZFA 3DGQA 4EE0A 1TI3A 2FUG2 4ZBDA 3UOMA 5J3RA 4K8MA 5G1KA 4RI7A 4I8BA 2L6CA 3UAPA 3ZITA 1OC9A 1YEPA 5ECKB 3NZNA 3FMWA 2E0QA 3HYPA 4WXTA 2NDOA 1PGTA 2MYGA 1R5PA 1T3BA 4TR0A 3HZ8A 3M3MA 2H1BA 1OC3A 1B9YC 1XW9A 3KEBA 5GAND 2MMZA 3ERFA 4MJEA 3CXGA 1K0NA 1K3OA 4IS0A 1TW9A 1XFLA 3FR6A 4XIHA 4TR4A 1O8XA 1AQXA 1GSDA 1PKWA 4LL1B 5DJMA 4BWQA 4YQVA 5DVBA 3EVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZR A;  5KN1 A;  1SJ6 A;  3LXT A;  3UAR A;  3G7I A;  1GNW A;  2L57 A;  3LSZ A;  4NPB A;  1LJR A;  1CQG A;  2V1M A;  3H4K A;  2B5X A;  1X9W B;  2DJ2 A;  3ME7 A;  5IMV A;  3IDV A;  1I9D A;  3EIN A;  4NMU A;  5D9V A;  5KEJ A;  2DML A;  5C00 A;  3CSJ A;  4H86 A;  5CRH A;  2F51 A;  3VPQ A;  2JZT A;  2L5L A;  2LST A;  2AYT A;  3VFI A;  5HFI A;  1RQM A;  4OO5 A;  2VCV A;  4MA9 A;  1SJI A;  4L5L A;  4IKH A;  4MH3 A;  2F9S A;  3TJB A;  2L59 A;  4MF5 A;  4FH8 A;  2GST A;  3GHA A;  1Y6E A;  5G5F A;  5ECH B;  1FOV A;  1X9S B;  4J56 E;  2H8L A;  2D2Z A;  1C72 A;  3APO A;  1ERU A;  4TXO B;  4K9Z A;  3TKS A;  5A4W A;  1G7E A;  5G5E A;  2FWE A;  1PX7 A;  3DML A;  3UMA A;  2CAQ A;  3A5W A;  5HR1 A;  3G7Y A;  1A0R P;  2VL9 A;  4MK3 A;  4V1A g;  1FW1 A;  2HRN A;  3EMX A;  1DBY A;  3FEU A;  1GRX A;  1TK5 B;  1XPV A;  2NBS A;  3WGD A;  4L0W A;  1V2A A;  1B4Q A;  3IK9 A;  4ZBB A;  1DUG A;  1BAY A;  2QKE A;  2I1U A;  2MMA A;  4YAP A;  3D4T A;  3KM6 A;  2KUC A;  3L78 A;  3P90 A;  1M2A A;  4KUN A;  1PA3 A;  2IWT A;  2R6K A;  4JBB A;  5DAL B;  5D9T A;  3GKK A;  3Q18 A;  2HFD A;  5IOX A;  2TIR A;  2FWH A;  2H0I A;  2LJA A;  4F0C A;  2H6Y A;  1FAA A;  5FHI A;  3KIJ A;  3RAZ A;  3F6D A;  2EIQ A;  2BJX A;  1GTA A;  3IE3 A;  2VL2 A;  1K0M A;  3ED3 A;  2V41 A;  1TRU A;  2FY6 A;  4V1A p;  2MMN A;  3KMO A;  4MH2 A;  5CRG A;  1YQ1 A;  4O92 A;  4IP1 A;  1WJK A;  4DSS B;  3HZ4 A;  4Q5Q A;  4JED A;  2JAD A;  2J23 A;  4FYC A;  3QFB C;  4N30 A;  1QFN A;  1JFU A;  1SKR B;  4J57 E;  4ID0 A;  2CAI A;  4FO5 A;  3DWV A;  2HE3 A;  4F82 A;  1O73 A;  4K1F A;  4IGJ A;  2EIR A;  4F9Z A;  4HQS A;  2DMM A;  2VCT A;  5IMZ A;  5D8I A;  3L9S A;  2HT9 A;  2ON7 A;  1WP0 A;  1A0F A;  10GS A;  5AN1 A;  3SBC A;  1A8L A;  5B6N A;  1JLV A;  3FR3 A;  3GIX A;  3R2Q A;  4MJA A;  1SKW B;  5JWQ B;  2XPD A;  4YH2 A;  4GWR A;  1ERT A;  3LQ7 A;  3QPM A;  4MPF A;  1G7O A;  5IM9 A;  3ISO A;  2YWI A;  2OKA A;  3GTU B;  3VUR A;  2B1L A;  1YJ6 A;  1X5D A;  1Q4J A;  1TRS A;  2TRX A;  1ST9 A;  1EGO A;  3IR4 A;  1X9M B;  1S3A A;  5IQY A;  2R4V A;  3GN3 A;  5FWG A;  2WZ9 A;  1T7P B;  2VCX A;  4HS1 A;  5KN2 A;  3GL3 A;  4OFN A;  2PU9 C;  2RM6 A;  5ENU A;  2DJ0 A;  3AY8 A;  2EC4 A;  2M72 A;  22GS A;  4NWY A;  2CZ2 A;  5ECP B;  4GF0 A;  1PN9 A;  1GTI A;  1MDJ A;  2XPE A;  2C8U A;  1XCC A;  13GS A;  1GP1 A;  3ME8 A;  1EV9 A;  5IOW A;  4WF5 A;  2FA4 A;  1E2Y A;  3O76 A;  2FCH A;  5HFK A;  1VF3 A;  5KN3 A;  4K0G A;  5ELG A;  1DE1 A;  3BCK A;  1NM3 A;  2H76 A;  1XZO A;  3CTG A;  1HD2 A;  4BPY A;  1RK4 A;  4FYB A;  2K18 A;  2VLU A;  2H71 A;  1KEB A;  1M2D A;  4F03 A;  2GSQ A;  2N5B A;  3FZ4 A;  3UBL A;  3HKR A;  1EEJ A;  1V40 A;  2R37 A;  4IQA A;  2JAC A;  4MZW A;  4QQ7 A;  5LNK e;  1GTU A;  5DJL A;  2YV9 A;  3DEX A;  3ZZX A;  1PL1 A;  2C80 A;  5IPG A;  4MCU A;  1SL0 B;  2GZZ A;  2XHF A;  2LRT A;  3IPZ A;  2A2S A;  4GSS A;  4MJB A;  3MDK A;  3ZFL A;  2O87 A;  4N11 A;  3TB2 A;  3P7X A;  4EKZ A;  1UVZ A;  3KP9 A;  1TDI A;  3KJY A;  6GSW A;  4GLT A;  5DCH A;  2DIZ A;  2H0H A;  5CYY A;  4PXO A;  4BVX A;  2LJR A;  3UVH A;  4I2T A;  4PX1 A;  2H74 A;  2WFC A;  3KH9 A;  2B5Y A;  3TGZ A;  2HNL A;  3VK9 A;  2VCW A;  2RLI A;  2VOC A;  3QOU A;  1GUK A;  4XCS A;  2FHE A;  1UA5 A;  2IFQ B;  4HDE A;  4WET A;  6GST A;  3KTL A;  1S3D A;  1KBN A;  4OMV A;  3WYW A;  3GFK A;  3TKR A;  2GQM A;  1YF0 A;  1MTC A;  1WWJ A;  1SKS B;  3BJ5 A;  1QK8 A;  1SEN A;  2H73 A;  4ZIJ A;  3LXZ A;  3IAS 2;  4TR1 B;  3PGT A;  1JZR A;  1AC1 A;  4GQF A;  3A3T A;  3QCP A;  3KXO A;  1G6W A;  3GKX A;  1Z3E A;  1TXX A;  2FA8 A;  3H1N A;  1G0T A;  4TR1 A;  3RPP A;  4BL7 A;  2AAW A;  1JLW A;  2GT6 A;  1V9W A;  5INY A;  2YWO A;  3GMF A;  3F4R A;  3GYK A;  3UIW A;  4Q5R A;  3I9V 2;  3EE2 A;  3KMN A;  1V57 A;  1AQV A;  1XOA A;  2VL2 C;  3QAV A;  3ZIV A;  16GS A;  3KGK A;  4DVC A;  1XVQ A;  5F8B A;  3E9J B;  5IO0 A;  4F2I A;  2IME A;  2IMK A;  5CRD A;  5JCG A;  2H70 A;  2X64 A;  2BMX A;  1YEX A;  2REM A;  3HJM A;  3CYN A;  4ZBA A;  3FYG A;  1OYJ A;  5IMF A;  5A5K A;  3TDG A;  2XBQ A;  3WD6 A;  4IW9 A;  3LG6 A;  5EPF A;  4KDU A;  1K0A A;  2C3T A;  1M7T A;  4LMV A;  4ZB6 A;  3VPT A;  1TP9 A;  1TKD B;  4OWY A;  2YWN A;  2YOI A;  1GLQ A;  2HYX A;  1GUL A;  1DSB A;  1TU8 A;  1HNC A;  4DEJ A;  2XC2 A;  3RDW A;  2C0F A;  3GH6 A;  1EOH A;  3VLN A;  4I6X A;  3GA4 A;  1PX6 A;  2JSY A;  5IMC A;  2X8G A;  4K7N A;  4F0B A;  4V2L A;  3F9U A;  3GKM A;  1SU9 A;  3IHQ A;  4LL4 B;  1EP7 A;  1K3Y A;  1GTB A;  3PR8 A;  5DAK B;  3KCM A;  2GT5 A;  3LWA A;  1XXU A;  1SL1 B;  1DE2 A;  2B1K A;  4HUA A;  1T4Z A;  4RUV A;  2H1D A;  1SD9 A;  2KP1 A;  4ZB8 A;  3US3 A;  1BYE A;  1THX A;  1EZK A;  1K0D A;  2X8H A;  2RM5 A;  2YJ7 A;  1SYX A;  3G9B A;  1ZL9 A;  5G1L A;  3ERG A;  3L9V A;  4XS6 A;  1GSF A;  3JCM L;  2LRC A;  4BVY A;  4NHZ A;  3RPN A;  4KCE A;  1VRS D;  1GUH A;  2AUV A;  3MNG A;  2G0F A;  2H01 A;  3GRX A;  3GSS A;  5COH A;  5AGY A;  3KD0 A;  3C71 A;  5J5N A;  2QGV A;  1ZYQ B;  2H1G A;  1PQN A;  4JU5 A;  1OE8 A;  3ZFB A;  2PVQ A;  4KA0 A;  1ACV A;  2Z9S A;  4FIW A;  5HFG A;  4D73 A;  2C3N A;  3TRQ A;  2VIM A;  1GSS A;  4GSN A;  3GST A;  1Z7P A;  3HJO A;  2C3Q A;  1GNE A;  2LEG A;  1TRV A;  3QMX A;  1V58 A;  3ZML A;  2P5Q A;  2ZCT A;  18GS A;  4POK A;  3ZVJ A;  2YN1 A;  2ES7 A;  14GS A;  17GS A;  2ZUP A;  3TCO A;  2LS5 A;  3MSZ A;  3EUR A;  3TUE A;  2WDU A;  2A4V A;  3VWX A;  1QMV A;  3D4M A;  5D9W A;  2MBS A;  4MP4 A;  4G9H A;  3HHV A;  1OC8 A;  3FR9 A;  3TOU A;  2LNT A;  4E8E A;  4TOP A;  3CSI A;  5L71 A;  3ZRD A;  2LTK A;  4HI7 A;  1QQ2 A;  1RW1 A;  2DC5 A;  5F06 A;  3TJK A;  4N0Z A;  5A4U A;  4TR3 A;  1U6T A;  3G7J A;  3LEF A;  3KP8 A;  20GS A;  4EO3 A;  2WRT A;  3ERW A;  1ZOF A;  1J08 A;  2B5E A;  5ECM B;  1Z7R A;  3EWL A;  1FHE A;  2OE0 A;  2R5G A;  5C04 A;  4D73 B;  1TJD A;  4MZC A;  2FWG A;  2PGT A;  4HJM A;  2GQK A;  4ZL8 A;  3M8N A;  1YF1 A;  2B3S A;  1XWA A;  3IXR A;  1K0O A;  5DAK A;  1J0F A;  1CQH A;  1F9M A;  2MZC A;  2YPM A;  1AXD A;  1SK2 A;  1UC7 A;  1USB A;  4Z7X A;  1VF2 A;  2GS3 A;  3TKS C;  1TOF A;  2OAD A;  4OFT A;  1O8W A;  4POM A;  4MF7 A;  5EY6 A;  1QGV A;  4GST A;  4KDX A;  1B48 A;  2GTU A;  3L4N A;  1TU7 A;  2YV7 A;  3EU4 A;  1H4O A;  2DSA A;  2PMT A;  1FO5 A;  1ERV A;  3TKS E;  2C0E A;  5ECS A;  2DJ3 A;  2J9H A;  1ERW A;  2WGR A;  3UVT A;  5GSS A;  3CSH A;  2IMD A;  1AQW A;  3NOF A;  3RHB A;  1F37 A;  1M99 A;  4L5O A;  1PRX A;  1VF1 A;  4RQX A;  1SJZ A;  2OBI A;  1EV4 A;  5G31 A;  2IPA A;  1SL2 B;  1Y25 A;  2K8V A;  2R3X A;  3F63 A;  4LA1 A;  1QXH A;  4WF4 A;  3BCI A;  4G10 A;  5GST A;  4HU7 A;  2L6D A;  1OKD A;  4TVE A;  1XWK A;  1QUW A;  2OA7 A;  3HXS A;  4KGI A;  4XTS A;  2IFQ A;  2H6Z A;  4GQC A;  3GX8 A;  1A2M A;  4DSS A;  5ECL B;  5GAP D;  4QL9 A;  4PGT A;  1G6Y A;  4P3Y B;  3IA1 A;  1TRW A;  2VL3 A;  3GV1 A;  1Q98 A;  2CQ9 A;  1YDK A;  3J7Y b;  3QAG A;  4G2E A;  3EC3 A;  3DKS A;  2GQL A;  1XW5 A;  3HDC A;  3W6G A;  3ZVJ D;  5B8B A;  2OE3 A;  4XS4 A;  2PPT A;  4ACS A;  4EF0 A;  2DJ1 A;  4IEL A;  2DIY A;  5AIS A;  1A23 A;  2A2R A;  2VO4 A;  3D21 A;  5ECR B;  1R5A A;  1XWB A;  2NTO A;  2GDR A;  5J4U A;  4KX4 A;  2I81 A;  1O7U A;  3LGC A;  1B8X A;  1IYI A;  2FGX A;  3HJP A;  1PD2 1;  2C0D A;  4OCE A;  1AUC A;  2HZE A;  5B8A A;  5J9C A;  4TXO A;  3N9J A;  1WOU A;  3VI5 A;  4Q5N A;  1GL8 A;  4MJC A;  4WKW A;  1NSW A;  3CTF A;  3WGE A;  2EIO A;  1HYU A;  5B7C A;  1F3B A;  4ZL9 A;  3DVX A;  3WGX A;  1B9X C;  2C0G A;  1OC9 B;  3D22 A;  4ECB A;  2WS2 A;  3FRC A;  4KE3 A;  4TW5 A;  1O81 A;  4JR4 A;  2R2J A;  3H93 A;  5HQP A;  1KTE A;  3GL5 A;  3V1W A;  5D93 A;  1T8E B;  2K8S A;  1EWX A;  4AJ6 A;  4WR4 A;  1JZD A;  1XWC A;  5D73 A;  4ECC A;  4XHM A;  3EYT A;  3TJF A;  1MD3 A;  3GX0 A;  2H1A A;  2L4C A;  2YAN A;  2IL3 A;  2FD3 A;  2YCD A;  1U88 A;  6GSX A;  3BBY A;  4CW9 A;  3L9U A;  4I97 A;  4J2F A;  1EGR A;  2CVD A;  5A4V A;  1IYH A;  4K2D A;  1FB6 A;  5LD0 A;  3TKP A;  4O7H A;  2HSH A;  1BED A;  1UN2 A;  1MEK A;  4X43 A;  4EVM A;  4XS1 A;  2OJL A;  4NAX A;  1GSY A;  3GUS A;  2CZ3 A;  3TOT A;  1ILO A;  1NW2 A;  4NV5 A;  1KNG A;  3APQ A;  5E4W A;  1X5E A;  2LUS A;  5CNW A;  3IAM 2;  4WBJ A;  3C7M A;  1O6J A;  4KSO A;  3BOA A;  2DLX A;  4O5R A;  5LCZ A;  2PBJ A;  5ECN B;  2M46 A;  3FHK A;  2LV3 A;  4N0V A;  5F0G A;  4ISD A;  3BD2 A;  4NV2 A;  3A2V A;  4KSM A;  3TJJ A;  2YNX A;  3M1G A;  1GLP A;  3GUR A;  2VAF A;  1F3A A;  9GSS A;  4IQ1 A;  3IV4 A;  4PQH A;  2JL4 A;  2AJQ B;  3TRP A;  2HLS A;  3HCZ A;  3N5O A;  3TKQ A;  2MBT A;  4Q5F A;  2CA8 A;  1BJX A;  4JZQ A;  1N2A A;  3GH9 A;  3Q74 A;  3M9J A;  2ON5 A;  4V2M A;  1AIU A;  5DAL A;  3HY2 A;  3EU3 A;  3F8U A;  3GNJ A;  2VM1 A;  1LBK A;  3HD5 A;  4N10 A;  3H8Q A;  3ZTL A;  1HNA A;  4NXI A;  3FW2 A;  5ELA A;  3CMI A;  2P5R A;  5IPH A;  5JWO B;  2JSZ A;  4KAE A;  1GWC A;  2AHE A;  3KH7 A;  5ID2 B;  1M9B A;  3IBH A;  4CHS A;  1OAZ A;  4DSQ A;  2VCZ A;  2FWF A;  5KN0 A;  4PNF A;  3IC4 A;  4MPG A;  2B7J A;  5JCW A;  2JZS A;  1LU4 A;  1H75 A;  1K0C A;  4IHU A;  1YKC A;  4IJI A;  1SK1 A;  3F6F A;  5E59 A;  2CT6 A;  4TN8 A;  1ZYE A;  3ZMK A;  1Z5Y E;  1OE7 A;  3QD9 A;  3CRU A;  1ZZY A;  1MDK A;  2HZE B;  1T4Y A;  4WBR D;  3M0F A;  1HQO A;  4MF6 A;  5HR0 A;  2VCQ A;  3HVS A;  4JE1 A;  3SWL A;  1PSQ A;  2DJJ A;  3UEM A;  1K3L A;  1T1V A;  5DQS A;  1M2B A;  4GCI A;  2NVL A;  2I9H A;  4OCF A;  2HI7 A;  4V2N A;  2C4J A;  4OFM A;  4PUA A;  1ZMA A;  3E0U A;  2E2M A;  4ULX A;  2YP6 A;  2F8F A;  3VWW A;  1X5C A;  2H0G A;  1GSU A;  1A24 A;  4PQI A;  2WUL A;  3ZLP A;  1AAZ A;  3O6T A;  4YAV A;  4HEA 2;  1W89 A;  3WT2 A;  3U5R E;  4MAB A;  2OE1 A;  1YZX A;  2O7K A;  1K0B A;  3TRX A;  5IIZ A;  1SD8 A;  3HA9 A;  2CVK A;  4LMW A;  2V2G A;  3QAW A;  2IJY A;  2GVP A;  2WB9 A;  3FY7 A;  3F4S A;  1A2J A;  1OVN A;  3E3E A;  3QR6 A;  4K6X A;  3APS A;  4BA7 A;  3LOR A;  4TXV A;  1BG5 A;  2AV4 A;  2WCI A;  2OAC A;  1WPI A;  4K7O A;  4KDY A;  5DDL A;  1ML6 A;  2RUE A;  2VD0 A;  12GS A;  2VLT A;  4L8E A;  2TRC P;  3F4T A;  3ZL5 A;  3C1S A;  3U6V A;  3UBK A;  1HNB A;  5ECQ B;  2VLV A;  4GXZ A;  4RQR A;  2O89 A;  2CVB A;  1THO A;  3VWU A;  3S9F A;  4KH7 A;  1M0U A;  5HR2 A;  4EDY A;  3DVW A;  4L0U A;  4ILF A;  6GSS A;  4TRX A;  1OKT A;  3Q19 A;  5F05 A;  1XVW A;  3O3T A;  1A2L A;  4PNG A;  4JR6 A;  2QSI A;  1R7H A;  1S3C A;  5IMD A;  1GSE A;  1W4V A;  3IOS A;  3I69 A;  5D96 A;  2IMI A;  4HOJ A;  3DRN A;  1ON4 A;  5ABR A;  5EVO A;  2F3M A;  3FZ9 A;  4MDC A;  2H72 A;  4RI6 A;  3CBU A;  2KP2 A;  2AB6 A;  5G2Z A;  2CX3 A;  3ZIJ A;  1TK8 B;  2PN8 A;  1J9B A;  2H30 A;  2G2Q A;  4PUF C;  1FG4 A;  4IBP A;  3PIN A;  4XRD A;  5FT3 A;  3M9K A;  4WEY A;  1XW6 A;  4HZ4 A;  3NIV A;  1JHB A;  2LJK A;  2E2G A;  3UJ1 A;  3C1R A;  2GGT A;  3D0Z A;  3C8E A;  3WT1 A;  3EMP A;  4XRA A;  4DSR A;  2KOK A;  4HQZ A;  1N8J A;  2HRF A;  5AIV A;  1GH2 A;  3UL3 A;  4YQM A;  5HR3 A;  3F3Q A;  3Q6O A;  4O32 A;  3FZ5 A;  4XS4 B;  4ECI A;  4ML6 A;  3HVV A;  1VGL A;  1YKA A;  3I43 A;  3ZYW A;  2YWM A;  4IJ3 A;  2QC7 A;  3TJG A;  4QL7 A;  4NHW A;  1F2E A;  4BWS A;  4I2U A;  2DBC A;  5IMA A;  4IN0 A;  3LFL A;  1XBS A;  2IMF A;  1I5G A;  2OBK A;  2VUP A;  2HSY A;  1R4W A;  5CP1 A;  5H5R A;  2LRN A;  2KLX A;  4KND A;  2LQO A;  1Z6N A;  4X0X A;  5DCG A;  3D6I A;  2GSS A;  1SYR A;  2GZY A;  3DXB A;  4AJ8 A;  4MMM A;  2YZU A;  1BX9 A;  1WRY A;  2V32 A;  3LYK A;  19GS A;  3QDN A;  1A8Y A;  2M80 A;  4IVF A;  1ZGN A;  1TTZ A;  1Z6M A;  2LQQ A;  2N5F A;  5G30 A;  4OD7 A;  4GTU A;  3RHC A;  2KHP A;  3LYP A;  5F07 A;  5IO2 A;  3DIE A;  1BQ7 A;  4ZL7 A;  1U3I A;  4OO4 A;  1VF4 A;  3FK8 A;  1NHO A;  4EDZ A;  3FZA A;  1GUM A;  3H79 A;  2MMO A;  2L4Q A;  2V6K A;  2XBI A;  3A2W A;  2YZH A;  3L0H A;  1JZO A;  1SK0 A;  6GSY A;  4ML1 A;  1FVJ A;  5JWR B;  4HJ2 A;  1V98 A;  3LJR A;  5DBQ A;  4AGS A;  2IN3 A;  3RBT A;  2LKU A;  4EC0 A;  3D5J A;  4MLY A;  4EUY A;  1XWG A;  5H5Q A;  4LLR A;  4POB A;  2CV4 A;  1ZCP A;  1YY7 A;  2K9F A;  3A2X A;  4ZB9 A;  2YJH A;  4JRR A;  2I3Y A;  4CDO A;  3OR5 A;  2FLS A;  3F3R A;  3P8W A;  3F0I A;  2CX4 A;  1U3A A;  1ABA A;  1TK0 B;  1M9A A;  2H6X A;  3J7Y k;  1XIY A;  2P0G A;  2RII A;  4EXJ A;  2GZP A;  3CRT A;  1FB0 A;  4K0N A;  1GSQ A;  2PWJ A;  1PMT A;  2FNO A;  2PVO C;  2LNS A;  2O85 A;  2V6O A;  6GSV A;  2DJK A;  2HXK A;  5ECI B;  5EL8 A;  2IIY A;  1MDI A;  3IK7 A;  5DQY A;  2RUF A;  4MZB A;  2N5A A;  5AIX A;  3MAK A;  3I6A A;  7GSS A;  2P31 A;  5CO3 A;  2VM2 A;  8GSS A;  1MD4 A;  2VD1 A;  2O8V B;  3VWV A;  1EOG A;  5JCU A;  3QFA C;  3W8J A;  5GZZ B;  4ECJ A;  5D9X A;  1PL2 A;  3PH9 A;  1NHY A;  4HU9 A;  1U87 A;  3FKF A;  2GSR A;  4PQ1 A;  3ZRE A;  2ZNM A;  4KCA A;  3KTB A;  5J9B A;  2WJU A;  2H66 A;  3P2A A;  2X99 A;  1WMJ A;  1EEM A;  4PUR A;  1WE0 A;  5ID2 A;  4FYU A;  3IRA A;  11GS A;  3DYR A;  2K6V A;  2I4A A;  1FVK A;  3MWH A;  3GKN A;  1WIK A;  1XOB A;  1AW9 A;  5J41 A;  1PKZ A;  1B4P A;  4YQU A;  1F6M C;  4AJ7 A;  1URM A;  2X8C A;  1X0R A;  2BTO T;  4I5Q A;  2PER A;  2F8A A;  1Z9H A;  4GRF A;  1R26 A;  2JU5 A;  4AF2 A;  4KB3 A;  4K7I A;  3C73 A;  5ECO B;  2ALB A;  5CRW A;  3GTU A;  2B6M A;  3K8N A;  1TI1 A;  4IP6 A;  2C1Y A;  1O85 A;  4HZ2 A;  2PUK C;  3W8S A;  5CAX A;  2B7K A;  6GSU A;  4TKY A;  4X1U A;  2GLR A;  3HVX A;  5B6M A;  5CRE A;  3KZQ A;  4E8H A;  2H75 A;  1EP8 A;  1E6B A;  4WR5 A;  4POL A;  4G19 A;  4KW6 A;  3DD3 A;  2L5O A;  4ZIL A;  1T00 A;  2E7P A;  3VI7 A;  5H5S A;  2NPB A;  4EL1 A;  1JZW A;  2H19 A;  4ZXG A;  2HZF A;  3DGQ A;  4EE0 A;  1TI3 A;  2FUG 2;  4ZBD A;  3UOM A;  5J3R A;  4K8M A;  5G1K A;  4RI7 A;  4I8B A;  2L6C A;  3UAP A;  3ZIT A;  1OC9 A;  1YEP A;  5ECK B;  3NZN A;  2E0Q A;  3HYP A;  4WXT A;  2NDO A;  1PGT A;  2MYG A;  1R5P A;  1T3B A;  4TR0 A;  3HZ8 A;  3M3M A;  2H1B A;  1OC3 A;  1B9Y C;  1XW9 A;  3KEB A;  5GAN D;  2MMZ A;  3ERF A;  4MJE A;  3CXG A;  1K0N A;  1K3O A;  4IS0 A;  1TW9 A;  1XFL A;  3FR6 A;  4XIH A;  4TR4 A;  1O8X A;  1AQX A;  1GSD A;  1PKW A;  4LL1 B;  5DJM A;  4BWQ A;  4YQV A;  5DVB A;  3EVI A; 
#chains in the Genus database with same CATH topology
 2JZR A;  2QA2 A;  2JGP A;  5KN1 A;  1SJ6 A;  3LXT A;  3UAR A;  3G7I A;  1GNW A;  4U0A A;  2L57 A;  3LSZ A;  2EHS A;  4NPB A;  1LJR A;  1CQG A;  2V1M A;  3H4K A;  2B5X A;  1X9W B;  2DJ2 A;  2GYK A;  3ME7 A;  5IMV A;  3G71 P;  3IDV A;  1I9D A;  3EIN A;  3CCS P;  2FAE A;  1QVG O;  4NMU A;  5D9V A;  5KEJ A;  2DML A;  5C00 A;  3CSJ A;  4H86 A;  5CRH A;  2F51 A;  3VPQ A;  2JZT A;  2L5L A;  2LST A;  2AYT A;  3VFI A;  5HFI A;  1RQM A;  4OO5 A;  2R0C A;  2VCV A;  4MA9 A;  1SJI A;  4L5L A;  4IKH A;  1M6N A;  4MH3 A;  3G6E P;  3GKL C;  2F9S A;  3TJB A;  2L59 A;  4MF5 A;  4FH8 A;  2GST A;  2K0X A;  3GHA A;  1Y6E A;  5G5F A;  5ECH B;  1FOV A;  1X9S B;  2KOP A;  3WBH A;  3LMO A;  4J56 E;  2H8L A;  4QNB A;  2D2Z A;  1C72 A;  3APO A;  1ERU A;  4TXO B;  4K9Z A;  3TKS A;  2GDW A;  5A4W A;  1G7E A;  2KOS A;  5G5E A;  3R3E A;  2FWE A;  1PX7 A;  3DML A;  3UMA A;  2CAQ A;  3A5W A;  3RG2 A;  5HR1 A;  3G7Y A;  1A0R P;  2VL9 A;  4MK3 A;  4V1A g;  1FW1 A;  2HRN A;  3EMX A;  1DBY A;  3FEU A;  1GRX A;  1TK5 B;  1XPV A;  2NBS A;  1N8R Q;  5EW5 E;  5BS1 A;  3WGD A;  4L0W A;  1V2A A;  1B4Q A;  3IK9 A;  4ZBB A;  1DUG A;  1BAY A;  2QKE A;  2KGA A;  2I1U A;  2MMA A;  1S3R A;  2N5I A;  4YAP A;  3D4T A;  5KOW A;  3KM6 A;  1K73 Q;  2KUC A;  1S72 P;  3L78 A;  3P90 A;  1M2A A;  4KUN A;  1PA3 A;  2IWT A;  2R6K A;  3MGE A;  4JBB A;  5DAL B;  5D9T A;  3GKK A;  3Q18 A;  2HFD A;  5IOX A;  2TIR A;  2FWH A;  2H0I A;  2LJA A;  2VLP A;  4F0C A;  2H6Y A;  1FAA A;  5FHI A;  3KIJ A;  3RAZ A;  3F6D A;  2EIQ A;  2BJX A;  1GTA A;  2Z46 A;  3IE3 A;  4O5Q A;  5HVC A;  1K30 A;  2VL2 A;  1K0M A;  3ED3 A;  2V41 A;  2JU2 A;  1TRU A;  2HSM A;  2FY6 A;  4V1A p;  3MIX A;  2MMN A;  3NTE A;  3KMO A;  2N6Z A;  4MH2 A;  5CRG A;  1YQ1 A;  4O92 A;  4U0D A;  4IP1 A;  1WJK A;  4DSS B;  2K5X A;  3HZ4 A;  4Q5Q A;  4JED A;  2JAD A;  2J23 A;  4FYC A;  3QFB C;  4ICY A;  2KOO A;  2CQ8 A;  4N30 A;  1QFN A;  1JFU A;  1SKR B;  4J57 E;  4ID0 A;  2CAI A;  1BXI A;  4FO5 A;  2XXM A;  1VKU A;  3DWV A;  2HE3 A;  4F82 A;  1O73 A;  4K1F A;  1AUM A;  4IGJ A;  2EIR A;  4F9Z A;  4HQS A;  2DMM A;  2VCT A;  5IMZ A;  5D8I A;  3L9S A;  2HT9 A;  2X2B A;  2ON7 A;  1WP0 A;  1A0F A;  10GS A;  1VQ9 P;  5AN1 A;  3SBC A;  1A8L A;  5B6N A;  1JLV A;  3FR3 A;  3GIX A;  3R2Q A;  4MJA A;  1SKW B;  5JWQ B;  4XFZ A;  3CCM P;  2XPD A;  4YH2 A;  2R0G A;  3G29 A;  4GWR A;  4HSC X;  1ERT A;  3G1I A;  1M90 Q;  3LQ7 A;  3QPM A;  4MPF A;  1G7O A;  5IM9 A;  3ISO A;  2KGC A;  2YWI A;  2OKA A;  3GTU B;  3VUR A;  2B1L A;  1YJ6 A;  2LIU A;  1X5D A;  1Q4J A;  2K93 A;  1TRS A;  2TRX A;  1ST9 A;  1EGO A;  3IR4 A;  4IPY A;  1X9M B;  1S3A A;  4MNN A;  5IQY A;  2R4V A;  3GN3 A;  5FWG A;  2WZ9 A;  4PH0 A;  1T7P B;  2VCX A;  4HS1 A;  2LTE A;  5KN2 A;  5HGL A;  3GL3 A;  4CY8 A;  4OFN A;  1E6J P;  2PU9 C;  2RM6 A;  2DJ0 A;  5ENU A;  3AY8 A;  2EC4 A;  2M72 A;  22GS A;  4NWY A;  2CZ2 A;  2EG5 A;  2MR7 A;  5ECP B;  2GZE A;  4GF0 A;  1K9M Q;  1PN9 A;  1GTI A;  5BS2 A;  1MDJ A;  2M8N A;  2XPE A;  2C8U A;  4QKO A;  1XCC A;  13GS A;  1GP1 A;  4BVX B;  3ME8 A;  1EV9 A;  2XT1 A;  5IOW A;  4WF5 A;  2FA4 A;  1E2Y A;  3O76 A;  4XFX A;  2FCH A;  1RO0 A;  5HFK A;  1VF3 A;  5KN3 A;  4K0G A;  5ELG A;  1DE1 A;  3BCK A;  1NM3 A;  2H76 A;  1XZO A;  5EJD A;  3CTG A;  4F37 A;  1HD2 A;  4BPY A;  1RK4 A;  4FYB A;  4BPH A;  2K18 A;  1JJ2 O;  4U0E A;  2VLU A;  2H71 A;  1KEB A;  1M2D A;  4F03 A;  2GSQ A;  2E1M A;  2N5B A;  3FZ4 A;  1L0H A;  3UBL A;  3HKR A;  1EEJ A;  1V40 A;  2R37 A;  4IQA A;  2JAC A;  4MZW A;  4QQ7 A;  2CGQ A;  5JPA A;  5LNK e;  1K8A Q;  1GTU A;  5DJL A;  2GDX A;  2YV9 A;  3DEX A;  3ZZX A;  1PL1 A;  2C80 A;  5IPG A;  4MCU A;  1SL0 B;  2GZZ A;  2XHF A;  2LRT A;  3IPZ A;  2A2S A;  4GSS A;  4MJB A;  3MDK A;  3ZFL A;  2O87 A;  4N11 A;  3DPH A;  3TB2 A;  3P7X A;  1F80 D;  4EKZ A;  1UVZ A;  3KP9 A;  1TDI A;  3KJY A;  6GSW A;  4GLT A;  5DCH A;  2DIZ A;  2H0H A;  5CYY A;  4PXO A;  4BVX A;  2LJR A;  3UVH A;  4I2T A;  4PX1 A;  2H74 A;  2WFC A;  1PFO A;  3KH9 A;  2B5Y A;  3TGZ A;  2KWL A;  2HNL A;  3VK9 A;  2PNG A;  2VCW A;  2RLI A;  3G21 A;  2VOC A;  3QOU A;  1GUK A;  4XCS A;  2FHE A;  1UA5 A;  3HVN A;  2IFQ B;  4HDE A;  4WET A;  6GST A;  3KTL A;  1S3D A;  1KBN A;  4OMV A;  3WYW A;  4EIP A;  3GFK A;  3TKR A;  2GQM A;  1YF0 A;  1MTC A;  1WWJ A;  1SKS B;  3BJ5 A;  1QK8 A;  1SEN A;  2H73 A;  1PN0 A;  4ZIJ A;  1AF8 A;  3LXZ A;  3IAS 2;  2GZI A;  4TR1 B;  3PGT A;  1JZR A;  1AC1 A;  3VRL C;  4GQF A;  3A3T A;  3B4Q A;  3QCP A;  3KXO A;  1G6W A;  3GKX A;  1Z3E A;  1TXX A;  2FA8 A;  3H1N A;  1G0T A;  4TR1 A;  3RPP A;  4BL7 A;  2AAW A;  1JLW A;  2GT6 A;  1V9W A;  2XZ1 C;  1VQL P;  5INY A;  2YWO A;  3GMF A;  2VLN A;  3CXC O;  3F4R A;  3GYK A;  3UIW A;  4XRO A;  3I9V 2;  4Q5R A;  3EE2 A;  3KMN A;  1VQO P;  1V57 A;  1AQV A;  1IUQ A;  1XOA A;  2MD9 A;  2VL2 C;  3QAV A;  4G0K A;  3ZIV A;  16GS A;  2PEO A;  3CME P;  3KGK A;  4DVC A;  1XVQ A;  2VLO A;  5F8B A;  3E9J B;  4XFY A;  5IO0 A;  4F2I A;  1FOH A;  2IME A;  2IMK A;  5CRD A;  5JCG A;  2QNW A;  1VQ5 P;  2H70 A;  2X64 A;  2BMX A;  1YEX A;  2REM A;  3HJM A;  2MF4 A;  2K0Y A;  3CYN A;  4ZBA A;  3FYG A;  5HGN A;  1OYJ A;  5IMF A;  2PEN A;  4BPF A;  5A5K A;  3TDG A;  2XBQ A;  3WD6 A;  3M1M A;  4X4J A;  4IW9 A;  3LG6 A;  5EPF A;  4KDU A;  1K0A A;  2C3T A;  1M7T A;  4LMV A;  4ZB6 A;  3VPT A;  1TP9 A;  1TKD B;  2L6E A;  4OWY A;  2YWN A;  2YOI A;  1GLQ A;  2HYX A;  1GUL A;  2A4H A;  2K92 A;  1DSB A;  1KD1 Q;  1TU8 A;  1HNC A;  4DEJ A;  2XC2 A;  3RDW A;  2C0F A;  3GH6 A;  1EOH A;  2WPT A;  3VLN A;  4I6X A;  3GA4 A;  1PX6 A;  2JSY A;  5IMC A;  2BUO A;  2X8G A;  4K7N A;  4F0B A;  4V2L A;  3F9U A;  3GKM A;  4USS A;  3EJB A;  1SU9 A;  3IHQ A;  4LL4 B;  1EP7 A;  1K3Y A;  1GTB A;  3PR8 A;  2ROQ A;  4YKF A;  5DAK B;  2JO0 A;  2KGE A;  3KCM A;  2KG9 A;  1GXH A;  2AF8 A;  2GT5 A;  3LWA A;  1XXU A;  2JYL A;  1SL1 B;  1DE2 A;  2B1K A;  4HUA A;  4Z2T A;  1T4Z A;  3CC4 P;  4RUV A;  1EMV A;  1KLP A;  2H1D A;  1Q81 Q;  1SD9 A;  2KP1 A;  4ZB8 A;  3US3 A;  1BYE A;  1THX A;  2FVA A;  4GR6 A;  1EZK A;  1K0D A;  2X8H A;  2RM5 A;  2YJ7 A;  2KR5 A;  3CMA P;  1SYX A;  3G9B A;  1ZL9 A;  5G1L A;  1UNK A;  3ERG A;  3L9V A;  4XS6 A;  1GSF A;  3JCM L;  1HY8 A;  4Z2R A;  2LRC A;  4BVY A;  4NHZ A;  3RPN A;  4KCE A;  1VRS D;  1GUH A;  2AUV A;  3MNG A;  2G0F A;  2H01 A;  3GRX A;  3GSS A;  5COH A;  5AGY A;  3KD0 A;  3C71 A;  5J5N A;  2QGV A;  2M8L A;  1ZYQ B;  2H1G A;  1PQN A;  4JU5 A;  1OE8 A;  3ZFB A;  1HQB A;  2PVQ A;  4KA0 A;  1ACV A;  2Z9S A;  4FIW A;  4BVY B;  5HFG A;  4D73 A;  2OAR A;  2C3N A;  3TRQ A;  2VIM A;  1GSS A;  4GSN A;  3GST A;  1Z7P A;  3HJO A;  2C3Q A;  1GNE A;  2LEG A;  1TRV A;  1NJI Q;  3QMX A;  1V58 A;  3ZML A;  2P5Q A;  2ZCT A;  18GS A;  4POK A;  3ZVJ A;  3HYB A;  2YN1 A;  1KQS O;  2ES7 A;  14GS A;  3U43 A;  17GS A;  2ZUP A;  2LS5 A;  3MSZ A;  3TCO A;  3EUR A;  3TUE A;  2WDU A;  2A4V A;  3VWX A;  1QMV A;  3D4M A;  5KP6 B;  2QEX P;  5D9W A;  2MBS A;  4MP4 A;  4G9H A;  3HHV A;  1OC8 A;  1VQK P;  3FR9 A;  3TOU A;  2LNT A;  4E8E A;  4TOP A;  3CSI A;  5L71 A;  3ZRD A;  4EIQ A;  4BPG A;  2LTK A;  4CY6 A;  4HI7 A;  1QQ2 A;  1VQ8 P;  4COC A;  1RW1 A;  2DC5 A;  5F06 A;  2NO8 A;  3TJK A;  4BL7 B;  4N0Z A;  4K5S A;  5A4U A;  4TR3 A;  2HRK A;  1U6T A;  3G7J A;  4PH1 A;  3LEF A;  3KP8 A;  20GS A;  1A8O A;  4EO3 A;  2WRT A;  3ERW A;  1ZOF A;  1J08 A;  2B5E A;  5ECM B;  1Z7R A;  1ZYP A;  3EWL A;  1FHE A;  2OE0 A;  2R5G A;  5C04 A;  4D73 B;  1TJD A;  4MZC A;  2FWG A;  2PGT A;  4HJM A;  2GQK A;  2FAD A;  4ZL8 A;  3M8N A;  4H2W C;  1YF1 A;  2B3S A;  1XWA A;  3IXR A;  1K0O A;  5DAK A;  1J0F A;  1CQH A;  1F9M A;  2MZC A;  2YPM A;  1AXD A;  1SK2 A;  4DG9 A;  1UC7 A;  1USB A;  4Z7X A;  1FR2 A;  1VF2 A;  2GS3 A;  3TKS C;  1TOF A;  2FQ0 A;  2OAD A;  4OFT A;  1O8W A;  4POM A;  4MF7 A;  5EY6 A;  4G0L A;  1QGV A;  2AVA A;  4GST A;  4KDX A;  1D1D A;  1B48 A;  2GTU A;  3L4N A;  1TU7 A;  2YV7 A;  4MRT C;  3EU4 A;  1H4O A;  2DSA A;  2PMT A;  1FO5 A;  1ERV A;  3TKS E;  2C0E A;  5ECS A;  2DJ3 A;  2LL8 A;  1ERW A;  2J9H A;  2WGR A;  3UVT A;  5GSS A;  3CSH A;  2IMD A;  1AQW A;  3NOF A;  3RHB A;  1XG8 A;  1F37 A;  1M99 A;  4L5O A;  1PRX A;  1VF1 A;  4RQX A;  1SJZ A;  2OBI A;  1EV4 A;  5G31 A;  2IPA A;  1SL2 B;  1VQM P;  1Y25 A;  2K8V A;  2R3X A;  3F63 A;  4LA1 A;  1QXH A;  4WF4 A;  1M3J A;  2N6Y A;  1YJW P;  3BCI A;  4G10 A;  5GST A;  4HU7 A;  1YHQ P;  2L6D A;  2EIA A;  1OKD A;  4TVE A;  4U0C A;  1XWK A;  1QUW A;  2OA7 A;  3HXS A;  4KGI A;  4XTS A;  2FVF A;  2IFQ A;  2H6Z A;  4GQC A;  3GX8 A;  1A2M A;  4DSS A;  5ECL B;  5GAP D;  4QL9 A;  4PGT A;  1G6Y A;  2M8P A;  4P3Y B;  3IA1 A;  1TRW A;  1UJZ A;  3GV1 A;  2VL3 A;  1ZMB A;  5F2N A;  1Q98 A;  2CQ9 A;  1YI2 P;  1YDK A;  3J7Y b;  3QAG A;  4G2E A;  3EC3 A;  3DKS A;  2GQL A;  1XW5 A;  3HDC A;  3W6G A;  5DCK A;  3ZVJ D;  5B8B A;  2OE3 A;  4XS4 A;  2PPT A;  4ACS A;  5CZD B;  4EF0 A;  2DJ1 A;  2PEM A;  2DIY A;  4IEL A;  1A23 A;  5AIS A;  1M3I A;  2A2R A;  2VO4 A;  3D21 A;  5ECR B;  1R5A A;  2CG5 B;  1XWB A;  2NTO A;  2GDR A;  5J4U A;  4KX4 A;  4U0B A;  2I81 A;  1O7U A;  3LGC A;  1B8X A;  1IYI A;  3P05 A;  2FGX A;  3Q20 A;  3HJP A;  1PD2 1;  3NY7 B;  2C0D A;  4OCE A;  1AUC A;  2HZE A;  1EOQ A;  5B8A A;  5J9C A;  3B5I A;  4TXO A;  1X3O A;  2AFE A;  3N9J A;  1WOU A;  3VI5 A;  2JB0 A;  4Q5N A;  1GL8 A;  4MJC A;  4WKW A;  1NSW A;  3CTF A;  3WGE A;  2EIO A;  1HYU A;  2N98 A;  5B7C A;  1F3B A;  4ZL9 A;  3DVX A;  1GPJ A;  3WGX A;  1B9X C;  2C0G A;  1OC9 B;  3D22 A;  2K2Q A;  4ECB A;  2WS2 A;  3FRC A;  1M1K Q;  4KE3 A;  5KP8 B;  1O81 A;  4TW5 A;  4JR4 A;  2GDY A;  2R2J A;  3H93 A;  5HQP A;  1KTE A;  3GL5 A;  3V1W A;  5D93 A;  1T8E B;  4XRQ A;  2K8S A;  1EWX A;  4AJ6 A;  4WR4 A;  1JZD A;  1XWC A;  5D73 A;  4ECC A;  3I56 P;  4XHM A;  3EYT A;  3TJF A;  1MD3 A;  3GX0 A;  2H1A A;  2L4C A;  2YAN A;  2IL3 A;  1RO2 A;  4O5U A;  2FD3 A;  2YCD A;  1U88 A;  6GSX A;  1IMQ A;  3BBY A;  2X49 A;  4CW9 A;  3L9U A;  4I97 A;  4J2F A;  1EGR A;  2CVD A;  3G26 A;  5A4V A;  1IYH A;  4K2D A;  1FB6 A;  5LD0 A;  3TKP A;  4O7H A;  2HSH A;  1BED A;  1UN2 A;  1MEK A;  4X43 A;  4EVM A;  4XS1 A;  2OJL A;  4A5P A;  4NAX A;  1GSY A;  3GUS A;  2CZ3 A;  3TOT A;  1E0H A;  1NW2 A;  1ILO A;  4NV5 A;  1KNG A;  4FQU A;  3APQ A;  5E4W A;  1X5E A;  2LUS A;  5CNW A;  3IAM 2;  4WBJ A;  2PEQ A;  3C7M A;  1O6J A;  4KSO A;  3BOA A;  2DLX A;  4PTS A;  3DS2 A;  4O5R A;  5LCZ A;  2PBJ A;  5ECN B;  2M46 A;  2GZF A;  3FHK A;  2LV3 A;  4N0V A;  5F0G A;  4ISD A;  3BD2 A;  3LW9 A;  4NV2 A;  3A2V A;  2UZ8 A;  1Q82 Q;  4KSM A;  1VQN P;  3TJJ A;  2YNX A;  3M1G A;  1GLP A;  3GUR A;  2VAF A;  1F3A A;  9GSS A;  4IQ1 A;  3IV4 A;  4PQH A;  3I55 P;  2JL4 A;  2AJQ B;  3TRP A;  2HLS A;  3HCZ A;  3N5O A;  3TKQ A;  1MZ8 A;  2MBT A;  4Q5F A;  2CA8 A;  1BJX A;  4JZQ A;  2X4A A;  1N2A A;  3GH9 A;  1OR5 A;  3Q74 A;  3M9J A;  3EJE A;  3RG6 C;  2ON5 A;  4V2M A;  5KOX A;  1GXG A;  1AIU A;  5DAL A;  3HY2 A;  3CCE P;  3EU3 A;  3F8U A;  3GNJ A;  2VM1 A;  1LBK A;  3HD5 A;  3CPW O;  4N10 A;  3H8Q A;  3ZTL A;  1HNA A;  4NXI A;  3FW2 A;  5ELA A;  3CMI A;  2P5R A;  5IPH A;  2L22 A;  3CCJ P;  5JWO B;  2JSZ A;  2KG6 A;  5HGO A;  3CCR P;  4KAE A;  1GWC A;  2AHE A;  2ERH A;  3KH7 A;  5ID2 B;  2OTL P;  1M9B A;  3IBH A;  4CHS A;  2FQ2 A;  1OAZ A;  4DSQ A;  2FAC A;  2VCZ A;  2FWF A;  3G28 A;  5KN0 A;  4PNF A;  3IC4 A;  4MPG A;  2B7J A;  1VHN A;  5JCW A;  2JZS A;  2FQ1 A;  1LU4 A;  1H75 A;  1K0C A;  5KP7 B;  2Z45 A;  4IHU A;  2N5H A;  1YKC A;  4IJI A;  1SK1 A;  3F6F A;  3GJN A;  5E59 A;  2CT6 A;  4TN8 A;  1ZYE A;  3ZMK A;  2HRA A;  1Z5Y E;  1IMP A;  1OE7 A;  3QD9 A;  3CRU A;  1ZZY A;  1MDK A;  2HZE B;  1CEI A;  1T4Y A;  3H4E A;  4WBR D;  3M0F A;  1HQO A;  4U0F A;  4MF6 A;  5HR0 A;  2VCQ A;  3HVS A;  4JE1 A;  3SWL A;  1PSQ A;  2DJJ A;  3UEM A;  1K3L A;  3DS5 A;  1YJ9 P;  1T1V A;  5DQS A;  1M2B A;  2JQ4 A;  4GCI A;  2NVL A;  2I9H A;  4OCF A;  2DKI A;  2HI7 A;  3CCV P;  4V2N A;  2C4J A;  4OFM A;  4PUA A;  1ZMA A;  3E0U A;  3IC8 A;  2E2M A;  4ULX A;  2GZG A;  2YP6 A;  2F8F A;  3VWW A;  1X5C A;  1QRJ A;  3G4S P;  2H0G A;  1GSU A;  1A24 A;  4PQI A;  2WUL A;  3ZLP A;  1AAZ A;  3O6T A;  4YAV A;  4HEA 2;  1W89 A;  2PY8 A;  3WT2 A;  3U5R E;  4MAB A;  2OE1 A;  2A2P A;  4H2X C;  1YZX A;  2O7K A;  1L0I A;  1K0B A;  1KC8 Q;  4K5R A;  2QA4 P;  3TRX A;  5IIZ A;  1SD8 A;  3HA9 A;  1AYI A;  2CVK A;  4LMW A;  2V2G A;  3QAW A;  2IJY A;  2GVP A;  2WB9 A;  3H0D A;  3EJD A;  3FY7 A;  3F4S A;  1A2J A;  1OVN A;  3E3E A;  3QR6 A;  4K6X A;  3APS A;  4BA7 A;  3LOR A;  4TXV A;  1BG5 A;  2AV4 A;  2WCI A;  2OAC A;  4PWV B;  1WPI A;  4K7O A;  4KDY A;  5DDL A;  3GZL A;  1ML6 A;  2RUE A;  2VD0 A;  12GS A;  3CCL P;  3CQF A;  2VLT A;  4L8E A;  2TRC P;  3F4T A;  3ZL5 A;  3C1S A;  4G0I A;  3U6V A;  3UBK A;  1HNB A;  5ECQ B;  2VLV A;  4GXZ A;  4RQR A;  2O89 A;  2CVB A;  1THO A;  3VWU A;  3S9F A;  3MYD A;  4KH7 A;  1M0U A;  5HR2 A;  4COP A;  4EDY A;  3DVW A;  4L0U A;  4ILF A;  5BRT A;  6GSS A;  4TRX A;  3H47 A;  4IZ6 A;  1OKT A;  3Q19 A;  5F05 A;  1XVW A;  3O3T A;  5HGM A;  1A2L A;  4PNG A;  4JR6 A;  2QSI A;  1R7H A;  1S3C A;  1GSE A;  1W4V A;  5IMD A;  3IOS A;  3I69 A;  5D96 A;  2IMI A;  4HOJ A;  3G0V A;  3A5I A;  5BMU A;  3DRN A;  1ON4 A;  5ABR A;  2GZJ A;  5EVO A;  2F3M A;  3FZ9 A;  4MDC A;  2H72 A;  4RI6 A;  4YKG A;  1EIA A;  4GR2 A;  3CBU A;  2KP2 A;  2AB6 A;  1A43 A;  1M74 A;  2LKI A;  2CX3 A;  5G2Z A;  3ZIJ A;  1TK8 B;  2PN8 A;  1J9B A;  2K0D X;  2H30 A;  2G2Q A;  4PUF C;  1FG4 A;  4IBP A;  3PIN A;  2KG8 A;  4XRD A;  2MR8 A;  5FT3 A;  3DS0 A;  1Q7Y Q;  3M9K A;  4WEY A;  1XW6 A;  4HZ4 A;  3NIV A;  1JHB A;  2LJK A;  2E2G A;  3UJ1 A;  3C1R A;  3CE7 A;  5F2K A;  2GGT A;  3D0Z A;  3C8E A;  3WT1 A;  3EMP A;  4XRA A;  4DSR A;  2EHT A;  2KOK A;  4HQZ A;  3OW2 O;  1N8J A;  2HRF A;  5AIV A;  1GH2 A;  3UL3 A;  4YQM A;  5HR3 A;  3F3Q A;  3Q6O A;  4O32 A;  3FZ5 A;  4R0M A;  4XS4 B;  4ECI A;  4ML6 A;  3HVV A;  2N50 A;  2KW2 A;  1VGL A;  1YKA A;  3I43 A;  3ZYW A;  2YWM A;  4IJ3 A;  2QC7 A;  3TJG A;  1YJN P;  4NHW A;  4QL7 A;  1F2E A;  4BWS A;  4I2U A;  1M6E X;  2DBC A;  5IMA A;  4IN0 A;  3LFL A;  1XBS A;  2IMF A;  2JAZ A;  1RNI A;  1I5G A;  2OBK A;  2KOD A;  3EPT A;  2VUP A;  2HSY A;  1R4W A;  5CP1 A;  2LPK A;  2LF4 A;  4H2Y C;  5H5R A;  2LRN A;  2KLX A;  4KND A;  2PEI A;  2LQO A;  1ZYN A;  1Z6N A;  4X0X A;  5DCG A;  3D6I A;  2MY5 A;  3HZQ A;  2GSS A;  1NQ4 A;  1SYR A;  2QA1 A;  2MVU A;  2GZY A;  3DXB A;  4AJ8 A;  4MMM A;  2YZU A;  1BX9 A;  1WRY A;  1ACP A;  2V32 A;  3LYK A;  3IHG A;  19GS A;  2PEJ A;  2AFD A;  3QDN A;  1A8Y A;  2M80 A;  4M0I A;  4IVF A;  1ZGN A;  3G1G A;  1TTZ A;  1Z6M A;  2LQQ A;  2LML A;  2N5F A;  1YIT P;  5G30 A;  4OD7 A;  4GTU A;  2DKH A;  3RHC A;  2KHP A;  3LYP A;  5F07 A;  5IO2 A;  3DIE A;  1BQ7 A;  4ZL7 A;  1U3I A;  4OO4 A;  1VF4 A;  3FK8 A;  1NHO A;  4EDZ A;  2P9X A;  1VQ7 P;  1QVF O;  3FZA A;  1GUM A;  2L9F A;  3H79 A;  2VSQ A;  2MMO A;  2L4Q A;  2L0Q A;  2V6K A;  2XBI A;  2CNR A;  3A2W A;  2YZH A;  3L0H A;  1JZO A;  1SK0 A;  6GSY A;  4ML1 A;  1FVJ A;  4WYM A;  5JWR B;  4HJ2 A;  1V98 A;  3LJR A;  5DBQ A;  4AGS A;  2IN3 A;  3RBT A;  2LKU A;  2FVE A;  4EC0 A;  3D5J A;  4MLY A;  2FHS C;  4EUY A;  3DTJ A;  1XWG A;  5H5Q A;  4LLR A;  4POB A;  3CCU P;  2CV4 A;  1ZCP A;  1YY7 A;  2K9F A;  3A2X A;  3CCQ P;  4ZB9 A;  3LRY A;  2YJH A;  4JRR A;  2I3Y A;  4CDO A;  2ONT A;  1VQP P;  3OR5 A;  2FLS A;  3F3R A;  3P8W A;  1W2B O;  3F0I A;  2CX4 A;  2JBG A;  1U3A A;  1ABA A;  1TK0 B;  1M9A A;  2H6X A;  2JYG A;  1DV5 A;  3J7Y k;  1XIY A;  2P0G A;  2RII A;  4EXJ A;  2GZP A;  3CRT A;  1FB0 A;  4K0N A;  2KGD A;  1GSQ A;  2PWJ A;  1VQ4 P;  1PMT A;  2FNO A;  2PVO C;  2LNS A;  1T8K A;  2KOQ A;  2O85 A;  2V6O A;  6GSV A;  2DJK A;  2HXK A;  5ECI B;  5EL8 A;  2EFJ A;  2IIY A;  1MDI A;  3IK7 A;  5DQY A;  4CA3 A;  2RUF A;  4UHP B;  4MZB A;  2N5A A;  5AIX A;  3MAK A;  3I6A A;  7GSS A;  2XV6 A;  2DGY A;  2P31 A;  5CO3 A;  2VM2 A;  8GSS A;  3DS1 A;  1MD4 A;  2VD1 A;  2O8V B;  3VWV A;  1EOG A;  5JCU A;  3QFA C;  3W8J A;  5GZZ B;  3DS4 A;  4ECJ A;  1VQ6 P;  1PL2 A;  5D9X A;  3PH9 A;  1NHY A;  4HU9 A;  1U87 A;  3GZM A;  2LIW A;  3FKF A;  2GSR A;  4PQ1 A;  2CWO A;  1ZNV A;  3ZRE A;  2ZNM A;  4KCA A;  3KTB A;  5J9B A;  2WJU A;  2H66 A;  2PEK A;  3P2A A;  2X99 A;  1WMJ A;  1EEM A;  4PUR A;  1WE0 A;  2VLQ A;  3CD6 P;  5ID2 A;  4FYU A;  2R0P A;  3IRA A;  4KF9 A;  11GS A;  3DYR A;  2K6V A;  2I4A A;  1FVK A;  3MWH A;  3GKN A;  1WIK A;  1XOB A;  1AW9 A;  5J41 A;  1PKZ A;  1B4P A;  4YQU A;  1F6M C;  2BHV A;  3CC7 P;  4AJ7 A;  1URM A;  2X8C A;  2XZ0 D;  1X0R A;  2BTO T;  4I5Q A;  2PER A;  2F8A A;  2Z44 A;  1Z9H A;  4GRF A;  1R26 A;  2JU5 A;  4AF2 A;  2MVV A;  3PPU A;  3CC2 P;  4KB3 A;  4K7I A;  1DNY A;  3C73 A;  5ECO B;  2ALB A;  5CRW A;  3GTU A;  3DS3 A;  2M5R A;  2B6M A;  3K8N A;  1TI1 A;  4IP6 A;  2C1Y A;  4K2X A;  4HZ2 A;  1O85 A;  2PUK C;  3W8S A;  5CAX A;  2B7K A;  4PXH B;  5HV8 A;  2L4B A;  4HKG A;  6GSU A;  4TKY A;  4X1U A;  2GLR A;  3HVX A;  5B6M A;  5CRE A;  3KZQ A;  4E8H A;  2H75 A;  1EP8 A;  1E6B A;  4WR5 A;  4POL A;  4G19 A;  4Z2U A;  4KW6 A;  2LOL A;  5I4T G;  3DD3 A;  2L5O A;  4ZIL A;  1T00 A;  2E7P A;  2JU1 A;  3VI7 A;  5H5S A;  2NPB A;  4EL1 A;  1JZW A;  2H19 A;  2K94 A;  4BIK A;  4ZXG A;  2HZF A;  2KOR A;  3DGQ A;  4EE0 A;  1Q86 Q;  4NEO A;  1TI3 A;  2FUG 2;  4ZBD A;  3UOM A;  5J3R A;  4K8M A;  5G1K A;  4RI7 A;  4I8B A;  2L6C A;  3UAP A;  2OTJ P;  3ZIT A;  1OC9 A;  1YEP A;  1YIJ P;  5ECK B;  7CEI A;  3NZN A;  3FMW A;  2E0Q A;  3HYP A;  4WXT A;  2NDO A;  1PGT A;  2MYG A;  1R5P A;  1T3B A;  4TR0 A;  3E2D A;  3HZ8 A;  3M3M A;  2H1B A;  1OC3 A;  1BAJ A;  1B9Y C;  1XW9 A;  3KEB A;  5GAN D;  2MMZ A;  3ERF A;  4MJE A;  3CXG A;  1K0N A;  1K3O A;  4IS0 A;  1TW9 A;  2DNW A;  1XFL A;  3FR6 A;  5F2O A;  4XIH A;  4TR4 A;  1O8X A;  1AQX A;  1GSD A;  1PKW A;  4LL1 B;  5DJM A;  4BWQ A;  4YQV A;  5DVB A;  3EVI A; 
#chains in the Genus database with same CATH homology
 2JZR A;  2QA2 A;  5KN1 A;  1SJ6 A;  3LXT A;  3UAR A;  3G7I A;  1GNW A;  2L57 A;  3LSZ A;  4NPB A;  1LJR A;  1CQG A;  2V1M A;  3H4K A;  2B5X A;  1X9W B;  2DJ2 A;  3ME7 A;  5IMV A;  3IDV A;  1I9D A;  3EIN A;  4NMU A;  5D9V A;  5KEJ A;  2DML A;  5C00 A;  3CSJ A;  4H86 A;  5CRH A;  2F51 A;  3VPQ A;  2JZT A;  2L5L A;  2LST A;  2AYT A;  3VFI A;  5HFI A;  1RQM A;  4OO5 A;  2R0C A;  2VCV A;  4MA9 A;  1SJI A;  4L5L A;  4IKH A;  4MH3 A;  2F9S A;  3TJB A;  2L59 A;  4MF5 A;  4FH8 A;  2GST A;  3GHA A;  1Y6E A;  5G5F A;  5ECH B;  1FOV A;  1X9S B;  4J56 E;  2H8L A;  2D2Z A;  1C72 A;  3APO A;  1ERU A;  4TXO B;  4K9Z A;  3TKS A;  5A4W A;  1G7E A;  5G5E A;  3R3E A;  2FWE A;  1PX7 A;  3DML A;  3UMA A;  2CAQ A;  3A5W A;  5HR1 A;  3G7Y A;  1A0R P;  2VL9 A;  4MK3 A;  4V1A g;  1FW1 A;  2HRN A;  3EMX A;  1DBY A;  3FEU A;  1GRX A;  1TK5 B;  1XPV A;  2NBS A;  3WGD A;  4L0W A;  1V2A A;  1B4Q A;  3IK9 A;  4ZBB A;  1DUG A;  1BAY A;  2QKE A;  2I1U A;  2MMA A;  4YAP A;  3D4T A;  5KOW A;  3KM6 A;  2KUC A;  3L78 A;  3P90 A;  1M2A A;  4KUN A;  1PA3 A;  2IWT A;  2R6K A;  4JBB A;  5DAL B;  5D9T A;  3GKK A;  3Q18 A;  2HFD A;  5IOX A;  2TIR A;  2FWH A;  2H0I A;  2LJA A;  4F0C A;  2H6Y A;  1FAA A;  5FHI A;  3KIJ A;  3RAZ A;  3F6D A;  2EIQ A;  2BJX A;  1GTA A;  3IE3 A;  4O5Q A;  2VL2 A;  1K0M A;  3ED3 A;  2V41 A;  1TRU A;  2HSM A;  2FY6 A;  4V1A p;  3MIX A;  2MMN A;  3KMO A;  4MH2 A;  5CRG A;  1YQ1 A;  4O92 A;  4IP1 A;  1WJK A;  4DSS B;  3HZ4 A;  4Q5Q A;  4JED A;  2JAD A;  2J23 A;  4FYC A;  3QFB C;  4ICY A;  4N30 A;  1QFN A;  1JFU A;  1SKR B;  4J57 E;  4ID0 A;  2CAI A;  4FO5 A;  3DWV A;  2HE3 A;  4F82 A;  1O73 A;  4K1F A;  4IGJ A;  2EIR A;  4F9Z A;  4HQS A;  2DMM A;  2VCT A;  5IMZ A;  5D8I A;  3L9S A;  2HT9 A;  2ON7 A;  1WP0 A;  1A0F A;  10GS A;  5AN1 A;  3SBC A;  1A8L A;  5B6N A;  1JLV A;  3FR3 A;  3GIX A;  3R2Q A;  4MJA A;  1SKW B;  5JWQ B;  2XPD A;  4YH2 A;  2R0G A;  4GWR A;  1ERT A;  3LQ7 A;  3QPM A;  4MPF A;  1G7O A;  5IM9 A;  3ISO A;  2YWI A;  2OKA A;  3GTU B;  3VUR A;  2B1L A;  1YJ6 A;  1X5D A;  1Q4J A;  1TRS A;  2TRX A;  1ST9 A;  1EGO A;  3IR4 A;  1X9M B;  1S3A A;  4MNN A;  5IQY A;  2R4V A;  3GN3 A;  5FWG A;  2WZ9 A;  1T7P B;  2VCX A;  4HS1 A;  5KN2 A;  3GL3 A;  4CY8 A;  4OFN A;  2PU9 C;  2RM6 A;  5ENU A;  2DJ0 A;  3AY8 A;  2EC4 A;  2M72 A;  22GS A;  4NWY A;  2CZ2 A;  5ECP B;  4GF0 A;  1PN9 A;  1GTI A;  1MDJ A;  2XPE A;  2C8U A;  1XCC A;  13GS A;  1GP1 A;  4BVX B;  3ME8 A;  1EV9 A;  5IOW A;  4WF5 A;  2FA4 A;  1E2Y A;  3O76 A;  2FCH A;  5HFK A;  1VF3 A;  5KN3 A;  4K0G A;  5ELG A;  1DE1 A;  3BCK A;  1NM3 A;  2H76 A;  1XZO A;  3CTG A;  1HD2 A;  4BPY A;  1RK4 A;  4FYB A;  2K18 A;  2VLU A;  2H71 A;  1KEB A;  1M2D A;  4F03 A;  2GSQ A;  2N5B A;  3FZ4 A;  3UBL A;  3HKR A;  1EEJ A;  1V40 A;  2R37 A;  4IQA A;  2JAC A;  4MZW A;  4QQ7 A;  5LNK e;  1GTU A;  5DJL A;  2YV9 A;  3DEX A;  3ZZX A;  1PL1 A;  2C80 A;  5IPG A;  4MCU A;  1SL0 B;  2GZZ A;  2XHF A;  2LRT A;  3IPZ A;  2A2S A;  4GSS A;  4MJB A;  3MDK A;  3ZFL A;  2O87 A;  4N11 A;  3TB2 A;  3P7X A;  4EKZ A;  1UVZ A;  3KP9 A;  1TDI A;  3KJY A;  6GSW A;  4GLT A;  5DCH A;  2DIZ A;  2H0H A;  5CYY A;  4PXO A;  4BVX A;  2LJR A;  3UVH A;  4I2T A;  4PX1 A;  2H74 A;  2WFC A;  3KH9 A;  2B5Y A;  3TGZ A;  2HNL A;  3VK9 A;  2VCW A;  2RLI A;  2VOC A;  3QOU A;  1GUK A;  4XCS A;  2FHE A;  1UA5 A;  2IFQ B;  4HDE A;  4WET A;  6GST A;  3KTL A;  1S3D A;  1KBN A;  4OMV A;  3WYW A;  4EIP A;  3GFK A;  3TKR A;  2GQM A;  1YF0 A;  1MTC A;  1WWJ A;  1SKS B;  3BJ5 A;  1QK8 A;  1SEN A;  2H73 A;  1PN0 A;  4ZIJ A;  3LXZ A;  3IAS 2;  4TR1 B;  3PGT A;  1JZR A;  1AC1 A;  4GQF A;  3A3T A;  3QCP A;  3KXO A;  1G6W A;  3GKX A;  1Z3E A;  1TXX A;  2FA8 A;  3H1N A;  1G0T A;  4TR1 A;  3RPP A;  4BL7 A;  2AAW A;  1JLW A;  2GT6 A;  1V9W A;  5INY A;  2YWO A;  3GMF A;  3F4R A;  3GYK A;  3UIW A;  4Q5R A;  3I9V 2;  3EE2 A;  3KMN A;  1V57 A;  1AQV A;  1XOA A;  2VL2 C;  3QAV A;  4G0K A;  3ZIV A;  16GS A;  3KGK A;  4DVC A;  1XVQ A;  5F8B A;  3E9J B;  5IO0 A;  4F2I A;  1FOH A;  2IME A;  2IMK A;  5CRD A;  5JCG A;  2H70 A;  2X64 A;  2BMX A;  1YEX A;  2REM A;  3HJM A;  3CYN A;  4ZBA A;  3FYG A;  1OYJ A;  5IMF A;  5A5K A;  3TDG A;  2XBQ A;  3WD6 A;  4X4J A;  4IW9 A;  3LG6 A;  5EPF A;  4KDU A;  1K0A A;  2C3T A;  1M7T A;  4LMV A;  4ZB6 A;  3VPT A;  1TP9 A;  1TKD B;  4OWY A;  2YWN A;  2YOI A;  1GLQ A;  2HYX A;  1GUL A;  2A4H A;  1DSB A;  1TU8 A;  1HNC A;  4DEJ A;  2XC2 A;  3RDW A;  2C0F A;  3GH6 A;  1EOH A;  3VLN A;  4I6X A;  3GA4 A;  1PX6 A;  2JSY A;  5IMC A;  2X8G A;  4K7N A;  4F0B A;  4V2L A;  3F9U A;  3GKM A;  4USS A;  1SU9 A;  3IHQ A;  4LL4 B;  1EP7 A;  1K3Y A;  1GTB A;  3PR8 A;  4YKF A;  5DAK B;  3KCM A;  2GT5 A;  3LWA A;  1XXU A;  1SL1 B;  1DE2 A;  2B1K A;  4HUA A;  4Z2T A;  1T4Z A;  4RUV A;  2H1D A;  1SD9 A;  2KP1 A;  4ZB8 A;  3US3 A;  1BYE A;  1THX A;  1EZK A;  1K0D A;  2X8H A;  2RM5 A;  2YJ7 A;  1SYX A;  3G9B A;  1ZL9 A;  5G1L A;  3ERG A;  3L9V A;  4XS6 A;  1GSF A;  3JCM L;  4Z2R A;  2LRC A;  4BVY A;  4NHZ A;  3RPN A;  4KCE A;  1VRS D;  1GUH A;  2AUV A;  3MNG A;  2G0F A;  2H01 A;  3GRX A;  3GSS A;  5COH A;  5AGY A;  3KD0 A;  3C71 A;  5J5N A;  2QGV A;  1ZYQ B;  2H1G A;  1PQN A;  4JU5 A;  1OE8 A;  3ZFB A;  2PVQ A;  4KA0 A;  1ACV A;  2Z9S A;  4FIW A;  4BVY B;  5HFG A;  4D73 A;  2C3N A;  3TRQ A;  2VIM A;  1GSS A;  4GSN A;  3GST A;  1Z7P A;  3HJO A;  2C3Q A;  1GNE A;  2LEG A;  1TRV A;  3QMX A;  1V58 A;  3ZML A;  2P5Q A;  2ZCT A;  18GS A;  4POK A;  3ZVJ A;  2YN1 A;  2ES7 A;  14GS A;  17GS A;  2ZUP A;  3TCO A;  2LS5 A;  3MSZ A;  3EUR A;  3TUE A;  2WDU A;  2A4V A;  3VWX A;  1QMV A;  3D4M A;  5D9W A;  2MBS A;  4MP4 A;  4G9H A;  3HHV A;  1OC8 A;  3FR9 A;  3TOU A;  2LNT A;  4E8E A;  4TOP A;  3CSI A;  5L71 A;  3ZRD A;  4EIQ A;  2LTK A;  4CY6 A;  4HI7 A;  1QQ2 A;  1RW1 A;  2DC5 A;  5F06 A;  3TJK A;  4BL7 B;  4N0Z A;  4K5S A;  5A4U A;  4TR3 A;  2HRK A;  1U6T A;  3G7J A;  3LEF A;  3KP8 A;  20GS A;  4EO3 A;  2WRT A;  3ERW A;  1ZOF A;  1J08 A;  2B5E A;  5ECM B;  1Z7R A;  1ZYP A;  3EWL A;  1FHE A;  2OE0 A;  2R5G A;  5C04 A;  4D73 B;  1TJD A;  4MZC A;  2FWG A;  2PGT A;  4HJM A;  2GQK A;  4ZL8 A;  3M8N A;  1YF1 A;  2B3S A;  1XWA A;  3IXR A;  1K0O A;  5DAK A;  1J0F A;  1CQH A;  1F9M A;  2MZC A;  2YPM A;  1AXD A;  1SK2 A;  1UC7 A;  1USB A;  4Z7X A;  1VF2 A;  2GS3 A;  3TKS C;  1TOF A;  2OAD A;  4OFT A;  1O8W A;  4POM A;  5EY6 A;  4MF7 A;  4G0L A;  1QGV A;  4GST A;  4KDX A;  1B48 A;  2GTU A;  3L4N A;  1TU7 A;  2YV7 A;  3EU4 A;  1H4O A;  2DSA A;  2PMT A;  1FO5 A;  1ERV A;  3TKS E;  2C0E A;  5ECS A;  2DJ3 A;  2J9H A;  1ERW A;  2WGR A;  3UVT A;  5GSS A;  3CSH A;  2IMD A;  1AQW A;  3NOF A;  3RHB A;  1F37 A;  1M99 A;  4L5O A;  1PRX A;  1VF1 A;  4RQX A;  1SJZ A;  2OBI A;  1EV4 A;  5G31 A;  2IPA A;  1SL2 B;  1Y25 A;  2K8V A;  2R3X A;  3F63 A;  4LA1 A;  1QXH A;  4WF4 A;  3BCI A;  4G10 A;  5GST A;  4HU7 A;  2L6D A;  1OKD A;  4TVE A;  1XWK A;  1QUW A;  2OA7 A;  3HXS A;  4KGI A;  4XTS A;  2IFQ A;  2H6Z A;  4GQC A;  3GX8 A;  1A2M A;  4DSS A;  5ECL B;  5GAP D;  4QL9 A;  4PGT A;  1G6Y A;  4P3Y B;  3IA1 A;  1TRW A;  2VL3 A;  3GV1 A;  1Q98 A;  2CQ9 A;  1YDK A;  3J7Y b;  3QAG A;  4G2E A;  3EC3 A;  3DKS A;  2GQL A;  1XW5 A;  3HDC A;  3W6G A;  3ZVJ D;  5B8B A;  2OE3 A;  4XS4 A;  2PPT A;  4ACS A;  4EF0 A;  2DJ1 A;  4IEL A;  2DIY A;  5AIS A;  1A23 A;  2A2R A;  2VO4 A;  3D21 A;  5ECR B;  1R5A A;  1XWB A;  2NTO A;  2GDR A;  5J4U A;  4KX4 A;  2I81 A;  1O7U A;  3LGC A;  1B8X A;  1IYI A;  2FGX A;  3HJP A;  1PD2 1;  2C0D A;  4OCE A;  1AUC A;  2HZE A;  5B8A A;  5J9C A;  4TXO A;  3N9J A;  1WOU A;  3VI5 A;  4Q5N A;  1GL8 A;  4MJC A;  4WKW A;  1NSW A;  3CTF A;  3WGE A;  2EIO A;  1HYU A;  5B7C A;  1F3B A;  4ZL9 A;  3DVX A;  3WGX A;  1B9X C;  2C0G A;  1OC9 B;  3D22 A;  4ECB A;  2WS2 A;  3FRC A;  4KE3 A;  4TW5 A;  1O81 A;  4JR4 A;  2R2J A;  3H93 A;  5HQP A;  1KTE A;  3GL5 A;  3V1W A;  5D93 A;  1T8E B;  2K8S A;  1EWX A;  4AJ6 A;  4WR4 A;  1JZD A;  1XWC A;  5D73 A;  4ECC A;  4XHM A;  3EYT A;  3TJF A;  1MD3 A;  3GX0 A;  2H1A A;  2L4C A;  2YAN A;  2IL3 A;  4O5U A;  2FD3 A;  2YCD A;  1U88 A;  6GSX A;  3BBY A;  2X49 A;  4CW9 A;  3L9U A;  4I97 A;  4J2F A;  1EGR A;  2CVD A;  5A4V A;  1IYH A;  4K2D A;  1FB6 A;  5LD0 A;  3TKP A;  4O7H A;  2HSH A;  1BED A;  1UN2 A;  1MEK A;  4X43 A;  4EVM A;  4XS1 A;  2OJL A;  4A5P A;  4NAX A;  1GSY A;  3GUS A;  2CZ3 A;  3TOT A;  1ILO A;  1NW2 A;  4NV5 A;  1KNG A;  4FQU A;  3APQ A;  5E4W A;  1X5E A;  2LUS A;  5CNW A;  3IAM 2;  4WBJ A;  3C7M A;  1O6J A;  4KSO A;  3BOA A;  2DLX A;  4PTS A;  4O5R A;  5LCZ A;  2PBJ A;  5ECN B;  2M46 A;  3FHK A;  2LV3 A;  4N0V A;  5F0G A;  4ISD A;  3BD2 A;  3LW9 A;  4NV2 A;  3A2V A;  2UZ8 A;  4KSM A;  3TJJ A;  2YNX A;  3M1G A;  1GLP A;  3GUR A;  2VAF A;  1F3A A;  9GSS A;  4IQ1 A;  3IV4 A;  4PQH A;  2JL4 A;  2AJQ B;  3TRP A;  2HLS A;  3HCZ A;  3N5O A;  3TKQ A;  2MBT A;  4Q5F A;  2CA8 A;  1BJX A;  4JZQ A;  2X4A A;  1N2A A;  3GH9 A;  3Q74 A;  3M9J A;  2ON5 A;  4V2M A;  5KOX A;  1AIU A;  5DAL A;  3HY2 A;  3EU3 A;  3F8U A;  3GNJ A;  2VM1 A;  1LBK A;  3HD5 A;  4N10 A;  3H8Q A;  3ZTL A;  1HNA A;  4NXI A;  3FW2 A;  5ELA A;  3CMI A;  2P5R A;  5IPH A;  5JWO B;  2JSZ A;  4KAE A;  1GWC A;  2AHE A;  3KH7 A;  5ID2 B;  1M9B A;  3IBH A;  4CHS A;  1OAZ A;  4DSQ A;  2VCZ A;  2FWF A;  5KN0 A;  4PNF A;  3IC4 A;  4MPG A;  2B7J A;  5JCW A;  2JZS A;  1LU4 A;  1H75 A;  1K0C A;  4IHU A;  1YKC A;  4IJI A;  1SK1 A;  3F6F A;  5E59 A;  2CT6 A;  4TN8 A;  1ZYE A;  3ZMK A;  2HRA A;  1Z5Y E;  1OE7 A;  3QD9 A;  3CRU A;  1ZZY A;  1MDK A;  2HZE B;  1T4Y A;  4WBR D;  3M0F A;  1HQO A;  4MF6 A;  5HR0 A;  2VCQ A;  3HVS A;  4JE1 A;  3SWL A;  1PSQ A;  2DJJ A;  3UEM A;  1K3L A;  1T1V A;  5DQS A;  1M2B A;  4GCI A;  2NVL A;  2I9H A;  4OCF A;  2DKI A;  2HI7 A;  4V2N A;  2C4J A;  4OFM A;  4PUA A;  1ZMA A;  3E0U A;  3IC8 A;  2E2M A;  4ULX A;  2YP6 A;  2F8F A;  3VWW A;  1X5C A;  2H0G A;  1GSU A;  1A24 A;  4PQI A;  2WUL A;  3ZLP A;  1AAZ A;  3O6T A;  4YAV A;  4HEA 2;  1W89 A;  3WT2 A;  3U5R E;  4MAB A;  2OE1 A;  2A2P A;  1YZX A;  2O7K A;  1K0B A;  4K5R A;  3TRX A;  5IIZ A;  1SD8 A;  3HA9 A;  2CVK A;  4LMW A;  2V2G A;  3QAW A;  2IJY A;  2GVP A;  2WB9 A;  3FY7 A;  3F4S A;  1A2J A;  1OVN A;  3E3E A;  3QR6 A;  4K6X A;  3APS A;  4BA7 A;  3LOR A;  4TXV A;  1BG5 A;  2AV4 A;  2WCI A;  2OAC A;  1WPI A;  4K7O A;  4KDY A;  5DDL A;  1ML6 A;  2RUE A;  2VD0 A;  12GS A;  2VLT A;  4L8E A;  2TRC P;  3F4T A;  3ZL5 A;  3C1S A;  4G0I A;  3U6V A;  3UBK A;  1HNB A;  5ECQ B;  2VLV A;  4GXZ A;  4RQR A;  2O89 A;  2CVB A;  1THO A;  3VWU A;  3S9F A;  3MYD A;  4KH7 A;  1M0U A;  5HR2 A;  4EDY A;  3DVW A;  4L0U A;  4ILF A;  5BRT A;  6GSS A;  4TRX A;  1OKT A;  3Q19 A;  5F05 A;  1XVW A;  3O3T A;  1A2L A;  4PNG A;  4JR6 A;  2QSI A;  1R7H A;  1S3C A;  5IMD A;  1GSE A;  1W4V A;  3IOS A;  3I69 A;  5D96 A;  2IMI A;  4HOJ A;  3A5I A;  5BMU A;  3DRN A;  1ON4 A;  5ABR A;  5EVO A;  2F3M A;  3FZ9 A;  4MDC A;  2H72 A;  4RI6 A;  4YKG A;  3CBU A;  2KP2 A;  2AB6 A;  5G2Z A;  2CX3 A;  3ZIJ A;  1TK8 B;  2PN8 A;  1J9B A;  2H30 A;  2G2Q A;  4PUF C;  1FG4 A;  4IBP A;  3PIN A;  4XRD A;  5FT3 A;  3M9K A;  4WEY A;  1XW6 A;  4HZ4 A;  3NIV A;  1JHB A;  2LJK A;  2E2G A;  3UJ1 A;  3C1R A;  2GGT A;  3D0Z A;  3C8E A;  3WT1 A;  3EMP A;  4XRA A;  4DSR A;  2KOK A;  4HQZ A;  1N8J A;  2HRF A;  5AIV A;  1GH2 A;  3UL3 A;  4YQM A;  5HR3 A;  3F3Q A;  3Q6O A;  4O32 A;  3FZ5 A;  4XS4 B;  4ECI A;  4ML6 A;  3HVV A;  1VGL A;  1YKA A;  3I43 A;  3ZYW A;  2YWM A;  4IJ3 A;  2QC7 A;  3TJG A;  4QL7 A;  4NHW A;  1F2E A;  4BWS A;  4I2U A;  2DBC A;  5IMA A;  4IN0 A;  3LFL A;  1XBS A;  2IMF A;  1I5G A;  2OBK A;  3EPT A;  2VUP A;  2HSY A;  1R4W A;  5CP1 A;  5H5R A;  2LRN A;  2KLX A;  4KND A;  2LQO A;  1ZYN A;  1Z6N A;  4X0X A;  5DCG A;  3D6I A;  2GSS A;  1SYR A;  2QA1 A;  2GZY A;  3DXB A;  4AJ8 A;  4MMM A;  2YZU A;  1BX9 A;  1WRY A;  2V32 A;  3LYK A;  3IHG A;  19GS A;  3QDN A;  1A8Y A;  2M80 A;  4IVF A;  1ZGN A;  1TTZ A;  1Z6M A;  2LQQ A;  2N5F A;  5G30 A;  4OD7 A;  4GTU A;  2DKH A;  3RHC A;  2KHP A;  3LYP A;  5F07 A;  5IO2 A;  3DIE A;  1BQ7 A;  4ZL7 A;  1U3I A;  4OO4 A;  1VF4 A;  3FK8 A;  1NHO A;  4EDZ A;  3FZA A;  1GUM A;  3H79 A;  2MMO A;  2L4Q A;  2V6K A;  2XBI A;  3A2W A;  2YZH A;  3L0H A;  1JZO A;  1SK0 A;  6GSY A;  4ML1 A;  1FVJ A;  5JWR B;  4HJ2 A;  1V98 A;  3LJR A;  5DBQ A;  4AGS A;  2IN3 A;  3RBT A;  2LKU A;  4EC0 A;  3D5J A;  4MLY A;  4EUY A;  1XWG A;  5H5Q A;  4LLR A;  4POB A;  2CV4 A;  1ZCP A;  1YY7 A;  2K9F A;  3A2X A;  4ZB9 A;  2YJH A;  4JRR A;  2I3Y A;  4CDO A;  3OR5 A;  2FLS A;  3F3R A;  3P8W A;  3F0I A;  2CX4 A;  1U3A A;  1ABA A;  1TK0 B;  1M9A A;  2H6X A;  3J7Y k;  1XIY A;  2P0G A;  2RII A;  4EXJ A;  2GZP A;  3CRT A;  1FB0 A;  4K0N A;  1GSQ A;  2PWJ A;  1PMT A;  2FNO A;  2PVO C;  2LNS A;  2O85 A;  2V6O A;  6GSV A;  2DJK A;  2HXK A;  5ECI B;  5EL8 A;  2IIY A;  1MDI A;  3IK7 A;  5DQY A;  2RUF A;  4MZB A;  2N5A A;  5AIX A;  3MAK A;  3I6A A;  7GSS A;  2P31 A;  5CO3 A;  2VM2 A;  8GSS A;  1MD4 A;  2VD1 A;  2O8V B;  3VWV A;  1EOG A;  5JCU A;  3QFA C;  3W8J A;  5GZZ B;  4ECJ A;  5D9X A;  1PL2 A;  3PH9 A;  1NHY A;  4HU9 A;  1U87 A;  3FKF A;  2GSR A;  4PQ1 A;  3ZRE A;  2ZNM A;  4KCA A;  3KTB A;  5J9B A;  2WJU A;  2H66 A;  3P2A A;  2X99 A;  1WMJ A;  1EEM A;  4PUR A;  1WE0 A;  5ID2 A;  4FYU A;  2R0P A;  3IRA A;  4KF9 A;  11GS A;  3DYR A;  2K6V A;  2I4A A;  1FVK A;  3MWH A;  3GKN A;  1WIK A;  1XOB A;  1AW9 A;  5J41 A;  1PKZ A;  1B4P A;  4YQU A;  1F6M C;  4AJ7 A;  1URM A;  2X8C A;  1X0R A;  2BTO T;  4I5Q A;  2PER A;  2F8A A;  1Z9H A;  4GRF A;  1R26 A;  2JU5 A;  4AF2 A;  3PPU A;  4KB3 A;  4K7I A;  3C73 A;  5ECO B;  2ALB A;  5CRW A;  3GTU A;  2B6M A;  3K8N A;  1TI1 A;  4IP6 A;  2C1Y A;  4K2X A;  1O85 A;  4HZ2 A;  2PUK C;  3W8S A;  5CAX A;  2B7K A;  6GSU A;  4TKY A;  4X1U A;  2GLR A;  3HVX A;  5B6M A;  5CRE A;  3KZQ A;  4E8H A;  2H75 A;  1EP8 A;  1E6B A;  4WR5 A;  4POL A;  4G19 A;  4Z2U A;  4KW6 A;  3DD3 A;  2L5O A;  4ZIL A;  1T00 A;  2E7P A;  3VI7 A;  5H5S A;  2NPB A;  4EL1 A;  1JZW A;  2H19 A;  4ZXG A;  2HZF A;  3DGQ A;  4EE0 A;  1TI3 A;  2FUG 2;  4ZBD A;  3UOM A;  5J3R A;  4K8M A;  5G1K A;  4RI7 A;  4I8B A;  2L6C A;  3UAP A;  3ZIT A;  1OC9 A;  1YEP A;  5ECK B;  3NZN A;  3FMW A;  2E0Q A;  3HYP A;  4WXT A;  2NDO A;  1PGT A;  2MYG A;  1R5P A;  1T3B A;  4TR0 A;  3HZ8 A;  3M3M A;  2H1B A;  1OC3 A;  1B9Y C;  1XW9 A;  3KEB A;  5GAN D;  2MMZ A;  3ERF A;  4MJE A;  3CXG A;  1K0N A;  1K3O A;  4IS0 A;  1TW9 A;  1XFL A;  3FR6 A;  4XIH A;  4TR4 A;  1O8X A;  1AQX A;  1GSD A;  1PKW A;  4LL1 B;  5DJM A;  4BWQ A;  4YQV A;  5DVB A;  3EVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...