1Z6MA

Structure of conserved protein of unknown function from enterococcus faecalis v583
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
175
structure length
175
Chain Sequence
b'SNAMDISVIDATKVNTETGLHIGESNAPVKMIEFINVRCPYCRKWFEESEELLAQSVKSGKVERIIKLFDKEKESLQRGNVMHHYIDYSAPEQALSALHKMFATQDEWGNLTLEEVATYAEKNLGLKEQKDATLVSAVIAEANAAHIQFVPTIIIGEYIFDESVTEEELRGYIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Structure of a conserved hypothetical protein from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 57
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.90 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A DsbA-like domain 1z6mA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1z6mA01
2KOKA 1IYIA 5DAKB 1A23A 2HFDA 2JACA 4ZILA 1GTBA 2OKAA 3M1GA 1XWCA 4P3YB 1QQ2A 1XWBA 6GSTA 3OR5A 4IELA 1PX6A 4J57E 3LQ7A 1AC1A 3IC4A 5E4WA 1ZZYA 3UMAA 4RI6A 4J56E 5IO2A 2DJ1A 3D4TA 1XW5A 2MMNA 3HZ4A 4WR5A 3ZIVA 5IO0A 5A4UA 1IYHA 1G7OA 2F8FA 1NHYA 2EIQA 2IPAA 2IMEA 4TR3A 3EE2A 5AIVA 2A4VA 3LJRA 3UAPA 2L6DA 1M0UA 3D4MA 4RQRA 4EDZA 3KTLA 5FT3A 1TRSA 4LMWA 1GULA 3BCIA 4I5QA 3LYKA 2YWMA 1EP7A 1QGVA 4WXTA 5D9TA 3IE3A 1SK1A 2C0GA 1SD8A 4TRXA 3EU4A 4HZ4A 4CW9A 3DEXA 4MJCA 1PD21 1X0RA 3ED3A 2EC4A 4IQAA 2H6ZA 2JADA 1BEDA 3GFKA 3DIEA 3UIWA 3HVSA 3WGXA 1K3LA 4I2TA 2H0IA 3CTGA 4MJBA 2YWIA 3PH9A 6GSSA 1O73A 1XOAA 3KTBA 3C71A 1Q98A 3C7MA 3RPPA 3QD9A 2M80A 1UC7A 3C73A 3F8UA 1AQWA 2R5GA 1ZOFA 4YQVA 3UOMA 2HXKA 3UL3A 1Q4JA 5D93A 4L0WA 4IN0A 4F9ZA 1X9WB 1TK5B 5IMZA 4MK3A 1ABAA 4IHUA 3ZMLA 1GSUA 2B6MA 4XS4B 3UARA 3TKQA 2JSYA 4GQFA 2K8SA 2PWJA 1SL1B 3BOAA 1OC9B 4KSMA 14GSA 11GSA 4K2DA 3DRNA 4EDYA 3F0IA 4F2IA 2GSTA 2PPTA 1M99A 3HCZA 1X5EA 3LG6A 4JU5A 2B3SA 4XRDA 2HI7A 2LSTA 1TDIA 4IS0A 4CDOA 5ECKB 1GRXA 5CRHA 1XXUA 5ABRA 2K9FA 4PQ1A 2XHFA 5G31A 2OBKA 3WGEA 4EXJA 4OCFA 4MZBA 2PBJA 3TKRA 4PURA 2H0HA 1XVWA 1SKWB 1U3AA 1EOHA 1SU9A 2NVLA 2O87A 1EP8A 3F6FA 3BCKA 3UVHA 3LWAA 2GT6A 3HKRA 4HEA2 2EIRA 2ZUPA 4ZBDA 3G7JA 2GZYA 2JSZA 1PX7A 5IMAA 3SBCA 2CX3A 2X64A 2AV4A 1YKAA 4XS1A 4WBJA 3MNGA 3ZTLA 4F0BA 5IPGA 1KEBA 1QFNA 1U88A 2IJYA 1GTAA 1SD9A 1PL1A 3WYWA 4BVXA 10GSA 4GRFA 4MF6A 2DMLA 1AAZA 2H74A 4ISDA 4TR1B 3GTUB 5ECQB 2IFQB 2F9SA 1XWKA 3RPNA 2VOCA 2H1AA 3IV4A 3ZFBA 3VURA 3I6AA 5KN2A 4D73B 3GA4A 1ILOA 4MA9A 4RQXA 4ID0A 5EVOA 3ZVJA 3RHBA 4YH2A 4N11A 1JFUA 1ZL9A 4ACSA 1GUMA 4JZQA 3APOA 4HS1A 3NIVA 2M72A 1J08A 1OKTA 4JR6A 2HT9A 1XOBA 1XW6A 5H5SA 2YN1A 1O85A 2QSIA 4GTUA 2OBIA 3HJOA 4E8EA 2LNSA 2CV4A 4V1Ap 1SENA 5CP1A 1TRUA 1H4OA 1B8XA 4JRRA 4IJ3A 18GSA 2DIZA 1BYEA 1FO5A 2WZ9A 2GGTA 3A2WA 2GDRA 3KD0A 1U6TA 2LNTA 2FUG2 2MBSA 3P7XA 4V2LA 3GL5A 4PQIA 3KJYA 3APSA 2YJHA 1G0TA 3IOSA 1A2LA 1V9WA 2FWHA 2K6VA 2XPDA 4DSSB 3DVXA 2FHEA 2B7JA 4ZB8A 3O3TA 3CRTA 3KP8A 1YQ1A 2DSAA 5G2ZA 2VM1A 3TJKA 1GSFA 4FYBA 2YV7A 1MDKA 1K0OA 4ML6A 3IAM2 1OE8A 2IMIA 2H6YA 2VCXA 4NHZA 5D9XA 2HZFA 3L78A 5H5RA 4IGJA 2H8LA 1Z3EA 3TGZA 3CSIA 4GWRA 5HQPA 1TXXA 1T4YA 1UVZA 1GUKA 1GLQA 2FWEA 4Z7XA 3M9KA 5CRDA 2AJQB 4TVEA 4G19A 2MBTA 2DLXA 1YF1A 1EV4A 4ECIA 2H6XA 2HLSA 5F0GA 4HQSA 3TJJA 3LXZA 7GSSA 3DKSA 2I4AA 2B1KA 1T3BA 3L9SA 1J9BA 3CXGA 5D73A 2XBQA 2GQKA 3E9JB 2YPMA 3I43A 2MYGA 2AB6A 3TOTA 4N0ZA 3H8QA 1NSWA 1AQXA 2PMTA 2V2GA 4MF7A 3C1RA 1JZOA 2TRCP 1K0CA 3HJPA 2WULA 4POMA 5IPHA 3W8SA 2VIMA 4PXOA 4XS6A 3H1NA 1GSDA 4MF5A 2L6CA 4LL4B 2GS3A 4EKZA 3PGTA 3GV1A 3GMFA 2KP2A 3R2QA 2E0QA 4L0UA 1JHBA 2H76A 2C3QA 5J41A 2WS2A 1YJ6A 1BQ7A 3FW2A 5ELAA 4AF2A 1A8LA 4TR4A 1R5AA 5B6MA 3W6GA 3FR3A 3N9JA 1O7UA 4MLYA 1B4PA 3US3A 1WPIA 4I2UA 1FVJA 3L0HA 1V58A 2P5QA 5B7CA 5ECIB 3TRQA 2HNLA 4OFNA 4AJ6A 3LGCA 1OAZA 4TXVA 5B8AA 5IIZA 1THXA 4OWYA 2ES7A 1A8YA 4QQ7A 1VF2A 3I9V2 4HU9A 3LYPA 5JCWA 2B5YA 2NBSA 5D8IA 2V1MA 4KA0A 5L71A 4WKWA 3FK8A 5DCHA 2R3XA 3UEMA 2DC5A 4RI7A 2C3TA 1SKRB 4K7OA 4HJMA 3FZAA 3E3EA 4HU7A 2KLXA 5D9VA 1EGOA 2WDUA 5F06A 3BJ5A 3LEFA 3ZLPA 4TXOA 2D2ZA 2FLSA 2PVOC 3RAZA 5HFGA 3KIJA 2VCTA 4OMVA 2A2SA 3U6VA 1NHOA 5J9BA 2HZEA 5JWOB 4G9HA 3QAGA 4ILFA 19GSA 3D6IA 2AAWA 3L9VA 5IOWA 1J0FA 3H79A 4EO3A 3JCML 5D96A 3GL3A 2PU9C 2GSRA 1LU4A 2OA7A 2VLTA 3UJ1A 2DJ0A 4L5LA 3D0ZA 5IQYA 1N2AA 2WCIA 3F63A 1X5CA 1WE0A 2JZRA 5CO3A 3VWUA 4X0XA 3APQA 6GSUA 1F37A 5DJMA 4K6XA 3GN3A 3HJMA 4GSTA 3L9UA 1TI1A 2FA4A 22GSA 3CYNA 4NMUA 1R4WA 6GSXA 2QGVA 2P0GA 2VM2A 1YY7A 2OADA 3GRXA 2VAFA 4OFMA 5G5EA 2V6OA 4TKYA 4MCUA 2QC7A 4LA1A 1THOA 4MDCA 4ML1A 3DVWA 4Q5QA 3HD5A 1K3YA 2R4VA 1F3BA 1TI3A 3HA9A 5LNKe 4X43A 2DMMA 3A2XA 2CVBA 4KSOA 1TU8A 2DJ2A 5IMVA 5G5FA 1R26A 3QOUA 6GSVA 1U87A 1ERVA 2WRTA 1W4VA 1K0AA 3HXSA 4JEDA 4DSQA 3H93A 2CZ3A 4XHMA 1TU7A 2K8VA 4BL7A 3EURA 4MH2A 2C1YA 3DWVA 1XPVA 1GUHA 3H4KA 4KDYA 2C80A 1HNBA 1FB6A 1XWAA 2RIIA 2KUCA 4AGSA 13GSA 1Z6MA 5JCGA 1HD2A 2M46A 3GKMA 3EC3A 3TCOA 3GHAA 2LUSA 5A5KA 2N5AA 5HR2A 1RW1A 2YJ7A 4V2MA 3FYGA 5GSSA 3QMXA 3F4SA 4QL7A 1YZXA 2H19A 1O8XA 1E6BA 5DJLA 2WJUA 1EEMA 3KEBA 2GLRA 2GSSA 2P5RA 4BVYA 4TR0A 2BMXA 2FCHA 2VCVA 1TK8B 3GKKA 3FKFA 1EGRA 1K0BA 3KGKA 1WWJA 1YEPA 5ID2A 3Q6OA 5D9WA 3E0UA 3IK9A 2H1DA 3CBUA 1LJRA 2IMKA 1NM3A 3A5WA 4F82A 1KNGA 2FD3A 4KCEA 4LMVA 1W89A 3K8NA 1GP1A 2VUPA 3F3QA 2K18A 1ZYEA 3LSZA 1OKDA 1T7PB 4Q5RA 4MABA 1SK0A 4KCAA 4LLRA 3Q18A 2CVKA 1QMVA 5CNWA 2H72A 5JCUA 2RUEA 3VI7A 3GKXA 1VF4A 2FWGA 3D22A 4ECJA 4KB3A 1AIUA 2CAIA 1Z5YE 2X8GA 4JE1A 2HRNA 2GT5A 3TDGA 3I69A 2YP6A 4NXIA 8GSSA 1CQGA 1PSQA 1TKDB 2BJXA 2ZNMA 3VLNA 4FYCA 4FO5A 1X5DA 4KNDA 1EEJA 1HNCA 1Y25A 3VK9A 1TRWA 3KMNA 2WFCA 2NPBA 3GX0A 4AJ8A 2CZ2A 2CQ9A 4POKA 3D5JA 4JR4A 1TTZA 5DQYA 2O89A 5E59A 2FWFA 3F3RA 5FHIA 1OE7A 1KBNA 2DBCA 1M9BA 3IAS2 9GSSA 1M2DA 1BX9A 3KMOA 2L4QA 4BWSA 5KN1A 1GH2A 3EYTA 1QK8A 1OYJA 3EMPA 3Q19A 3TB2A 1GSEA 1OVNA 3WD6A 1BJXA 4L5OA 3RHCA 3LXTA 1VF3A 2LV3A 2DJJA 2J23A 3U5RE 2C3NA 2E7PA 5J5NA 4H86A 2C0DA 3F9UA 5CRWA 5FWGA 4OO4A 1GNEA 3V1WA 4PX1A 3CTFA 2E2MA 4OFTA 2RLIA 3A2VA 4IJIA 1GNWA 1SK2A 2MMAA 3LFLA 2C4JA 4NHWA 2AUVA 2Z9SA 2VO4A 1T00A 1PMTA 2J9HA 4GXZA 3QAWA 3HY2A 4O92A 3S9FA 3GTUA 5GSTA 1TP9A 1Z6NA 2XC2A 4O5RA 2GVPA 1VF1A 2MZCA 2E2GA 4HOJA 1SL2B 1ZCPA 4D73A 2LJAA 1ERWA 3VFIA 5ECNB 1NW2A 3P8WA 4HQZA 2REMA 3HDCA 3GX8A 3IA1A 5A4VA 2JL4A 2I3YA 4WR4A 3F4RA 1RQMA 2L59A 4X1UA 4EL1A 5LD0A 2IMFA 2GZPA 2PUKC 4POLA 5LCZA 5GAND 1SYRA 2LRTA 3ZVJD 4EUYA 1WIKA 3ERWA 1X9MB 4WF4A 3ZITA 3KP9A 2CT6A 2RUFA 2CAQA 1MD3A 1B9YC 4CHSA 1YF0A 5HR1A 3TKPA 3HZ8A 4TOPA 3ZL5A 5KEJA 4XRAA 1YDKA 2HE3A 2VL2A 2IWTA 3GYKA 4O32A 1MEKA 3AY8A 20GSA 1JZWA 4F0CA 3P2AA 1E2YA 1GL8A 2FA8A 3IR4A 2YOIA 3M0FA 4I8BA 2H01A 3ME7A 1K3OA 5H5QA 2AHEA 2L4CA 4Q5NA 2C8UA 5ECPB 3NZNA 4PGTA 5HR3A 4K0GA 2ON7A 4TXOB 2MMZA 1AXDA 2RM6A 1EZKA 2DJKA 4ZB6A 3IPZA 4N30A 3WGDA 3UBKA 3CSJA 4YAVA 5COHA 1V40A 1DBYA 1ERUA 1VRSD 2HZEB 1N8JA 1V2AA 2LTKA 2WB9A 3QAVA 5ELGA 2I1UA 1EWXA 1H75A 3FZ4A 3FEUA 2ZCTA 4NPBA 4IQ1A 4BPYA 2VCWA 1GLPA 3KZQA 4K9ZA 1FB0A 3G9BA 1ON4A 2C0FA 3HYPA 1FOVA 2FGXA 5KN3A 2TRXA 4POBA 1UN2A 1K0DA 3TKSA 3MDKA 3KH9A 4F03A 1ST9A 3CSHA 2IMDA 4AJ7A 2LQQA 1GSYA 2F51A 2VL2C 2R2JA 1EOGA 3DGQA 1R7HA 3QDNA 3L4NA 4N0VA 5EY6A 1T1VA 1DE2A 2C0EA 2LJRA 2YZUA 4GQCA 5J9CA 4V1Ag 2YWNA 5DALA 2R37A 1OC8A 3ISOA 3M3MA 2H1GA 1F6MC 3EU3A 1HNAA 1SJ6A 2IIYA 4LL1B 2I9HA 5CREA 3TJBA 1AUCA 1XVQA 1BAYA 1YEXA 5IOXA 1QUWA 2OACA 3QFAC 5JWRB 5GAPD 1JLWA 5ECMB 4G10A 4K7IA 1ZGNA 4EE0A 5J4UA 3ZREA 3FR9A 4ZB9A 5AISA 4K8MA 1G7EA 1MTCA 5IMFA 2VCQA 4NAXA 4E8HA 4MPGA 1SJIA 5CYYA 5ECLB 2N5FA 5INYA 4I6XA 1G6WA 2B5EA 1BG5A 5B8BA 1TJDA 3ZIJA 3TKSC 3ZRDA 2LRNA 16GSA 1VGLA 3F6DA 3A3TA 3GH9A 2O8VB 3VWVA 2LQOA 5HR0A 2JZTA 4KDUA 3QR6A 3UBLA 3FHKA 3PINA 3RDWA 1GSQA 4PQHA 1M7TA 4ECCA 5ECHB 2DJ3A 2X8CA 5AN1A 1F9MA 4DSRA 2OE1A 2NTOA 2L57A 3O76A 3DYRA 2L5LA 4JBBA 4FYUA 5DAKA 5KN0A 2AYTA 2H70A 4WBRD 2LRCA 2GZZA 4KUNA 1U3IA 4PUFC 4FH8A 2YCDA 1YKCA 5F05A 3NOFA 2H0GA 4IP1A 4ZIJA 1A0FA 1B9XC 1GSSA 2LKUA 1C72A 1RK4A 3C1SA 4HDEA 5ECRB 4IBPA 1PA3A 1JZRA 1HYUA 3TRXA 5ID2B 3GUSA 1ERTA 2GQMA 3QFBC 1WMJA 3QCPA 3C8EA 6GSWA 4NWYA 3G7IA 1M2BA 3N5OA 5B6NA 1XZOA 1GWCA 3VPQA 1R5PA 4GSNA 1XW9A 3FZ5A 2LS5A 2A2RA 3CMIA 4XCSA 3G7YA 5CAXA 3ZMKA 2P31A 4OO5A 4NV5A 2X99A 5EPFA 3P90A 2V6KA 1I5GA 1V57A 1G6YA 4GSSA 3ERFA 4BA7A 4PNGA 4ECBA 2VL9A 5IMCA 5AGYA 1A24A 1ZYQB 4PNFA 5ECOB 1GTUA 4WEYA 1T8EB 2IL3A 1XWGA 1ACVA 3HHVA 4PUAA 5DDLA 1MD4A 1Y6EA 3ME8A 2HSYA 4K1FA 4KGIA 2YNXA 3GIXA 1PRXA 1S3DA 4MZCA 3PR8A 3KXOA 4KAEA 4QL9A 1ZMAA 2VD1A 1OC3A 4GCIA 4XS4A 1T4ZA 3CRUA 2FNOA 5DQSA 4TW5A 3IXRA 2BTOT 1O8WA 1DSBA 3RBTA 1F3AA 3TRPA 1OC9A 4EVMA 1PQNA 4MH3A 4MZWA 3J7Yk 4WF5A 1PL2A 2H73A 1A2MA 1S3AA 17GSA 2LEGA 1SYXA 4ZBBA 4L8EA 3HVVA 2ON5A 1AQVA 3IHQA 2MMOA 3FZ9A 3VPTA 4V2NA 4MMMA 4TN8A 3O6TA 2PN8A 1MDIA 4OCEA 4KE3A 4YQUA 3VWXA 4IW9A 1WOUA 2H30A 2VLVA 3M8NA 2H71A 2IN3A 3EVIA 4I97A 2YANA 3ZFLA 4EF0A 2F8AA 2WGRA 5CRGA 5ENUA 5C00A 1FW1A 2H66A 1MDJA 4HZ2A 3IRAA 1WP0A 1B4QA 3KM6A 3IK7A 4IVFA 2XBIA 1HQOA 5HFIA 4MJEA 1K0NA 4ZBAA 2VL3A 2YWOA 3TJFA 4ZL8A 2DIYA 4YAPA 2G0FA 2OE3A 3EINA 3FR6A 4EC0A 5F8BA 1WJKA 1DUGA 1Z7RA 3W8JA 3FRCA 5G1LA 3WT1A 1URMA 5DVBA 3MSZA 2QKEA 2GQLA 1ML6A 4TR1A 2N5BA 4ZL9A 2IFQA 3GKNA 2XPEA 4MJAA 1WRYA 4K0NA 2PGTA 4OD7A 5J3RA 3VWWA 3TJGA 4Q5FA 4K7NA 2PVQA 1Z9HA 3FY7A 3BBYA 1UA5A 3DMLA 3ZYWA 4G2EA 4MPFA 1FAAA 3IDVA 1PKWA 1O81A 2OJLA 2HRFA 4ZL7A 1SL0B 2V41A 5G1KA 5IM9A 2YZHA 1PN9A 1KTEA 2YV9A 2HSHA 1F2EA 1M9AA 1XCCA 3GSSA 3GSTA 4IP6A 4IKHA 1A0RP 2B1LA 3J7Yb 4HI7A 2OE0A 1GTIA 12GSA 4GF0A 1CQHA 3KH7A 5DBQA 2V32A 2HYXA 2FY6A 5GZZB 2R6KA 3D21A 1X9SB 2JU5A 3EWLA 4WETA 5HFKA 3IBHA 2KHPA 2B7KA 5IMDA 2X8HA 2RM5A 4ULXA 1XBSA 1DE1A 1USBA 5G30A 2TIRA 1QXHA 4N10A 4KX4A 3EMXA 1SKSB 1TOFA 2O7KA 4DSSA 3M9JA 4DVCA 3TUEA 1K0MA 3UVTA 3KCMA 1A2JA 3GURA 1Z7PA 2CX4A 3DXBA 2JZSA 4HJ2A 4XIHA 5DALB 3QPMA 3ZZXA 1JLVA 1PKZA 2I81A 4ZXGA 2B5XA 3VI5A 3GNJA 2O85A 5C04A 5ECSA 1EV9A 2F3MA 4MP4A 2CA8A 1LBKA 5EL8A 1FVKA 4J2FA 3HVXA 5DCGA 2H1BA 4YQMA 2H75A 2PERA 3DD3A 6GSYA 4FIWA 2VCZA 1PGTA 3MAKA 2CVDA 1SJZA 3MWHA 4NV2A 2NDOA 1TK0B 4HUAA 1B48A 3F4TA 3LORA 3ERGA 1XIYA 1JZDA 1O6JA 5A4WA 4BWQA 2GTUA 4XTSA 1AW9A 2VLUA 2GSQA 1M2AA 4RUVA 3BD2A 2VD0A 2LJKA 4O7HA 1FHEA 5F07A 1XFLA 3Q74A 3TOUA 4DEJA 2G2QA 5AIXA 3WT2A 3SWLA 1I9DA 2L5OA 4KW6A 4KH7A 2KP1A 5JWQB 1V98A 4KDXA 3TKSE 1TRVA 2EIOA 1TW9A 1S3CA 1FG4A 3GH6A 4GLTA 2ALBA
chains in the Genus database with same CATH superfamily
2KOKA 1IYIA 4K5SA 2EG5A 5DAKB 1A23A 2HFDA 2JACA 4ZILA 1GTBA 2OKAA 3M1GA 1XWCA 4P3YB 1QQ2A 1XWBA 6GSTA 1IMPA 3OR5A 2A2PA 1AUMA 4IELA 1PX6A 7CEIA 4J57E 3LQ7A 3OW2O 1AC1A 3IC4A 3RG2A 5E4WA 1ZZYA 4UHPB 3UMAA 3G4SP 4RI6A 2KGAA 4J56E 5IO2A 2DJ1A 3D4TA 1XW5A 2MMNA 3HZ4A 4WR5A 3ZIVA 5IO0A 5A4UA 1UJZA 1IYHA 1G7OA 2F8FA 1NHYA 2EIQA 2IPAA 2IMEA 4TR3A 2Z44A 3EE2A 5AIVA 2A4VA 3LJRA 3UAPA 2L6DA 1M0UA 3D4MA 4RQRA 4EDZA 3KTLA 5FT3A 1TRSA 4LMWA 1GULA 3BCIA 4I5QA 3LYKA 2YWMA 4HSCX 1EP7A 4DG9A 1QGVA 4WXTA 5D9TA 3IE3A 2PEKA 1SK1A 5BS2A 2C0GA 1SD8A 4CY8A 4TRXA 3EU4A 2KORA 4HZ4A 4CW9A 3DEXA 4MJCA 1PD21 1X0RA 3ED3A 2EC4A 4IQAA 2H6ZA 2JADA 1BEDA 3GFKA 3DIEA 3UIWA 3HVSA 2GZIA 1K3LA 3WGXA 4I2TA 2H0IA 3CTGA 4MJBA 4IZ6A 2M8LA 2YWIA 3PH9A 6GSSA 1D1DA 1O73A 1VQ5P 1XOAA 3KTBA 3C71A 4BVYB 1Q98A 3C7MA 3RPPA 3QD9A 2M80A 1UC7A 3C73A 2WPTA 2HSMA 3F8UA 1AQWA 2R5GA 1ZOFA 4YQVA 3UOMA 2HXKA 3UL3A 1Q4JA 5D93A 4L0WA 4IN0A 4F9ZA 2AF8A 1X9WB 1TK5B 2L22A 5IMZA 4MK3A 1ABAA 4IHUA 4K5RA 3ZMLA 1GSUA 2B6MA 4XS4B 3CCRP 3UARA 3U43A 3TKQA 2JSYA 4GQFA 1M6NA 1YHQP 2K8SA 2PWJA 1SL1B 1GPJA 3BOAA 1OC9B 4KSMA 14GSA 11GSA 4K2DA 3DRNA 4EDYA 3F0IA 4F2IA 2GSTA 2PPTA 1M99A 3HCZA 1X5EA 3LG6A 4JU5A 2B3SA 4XRDA 2HI7A 2LSTA 1TDIA 4IS0A 4CDOA 2AVAA 5ECKB 2DNWA 3HZQA 1GRXA 5CRHA 2CGQA 1XXUA 5ABRA 2K9FA 2MD9A 4PQ1A 2XHFA 5G31A 3I55P 2OBKA 3WGEA 4EXJA 4OCFA 4MZBA 2PBJA 3TKRA 4PURA 2H0HA 1XVWA 1SKWB 1U3AA 1EOHA 2NVLA 2O87A 2LIUA 1EP8A 1BAJA 3F6FA 3BCKA 2HRAA 3UVHA 2MVUA 3LWAA 3NTEA 2GT6A 3HKRA 1N8RQ 2MR7A 4HEA2 2EIRA 2ZUPA 4ZBDA 3G7JA 2GDWA 2GZYA 2JSZA 1PX7A 5IMAA 3SBCA 2AFEA 2CX3A 2X64A 2AV4A 5F2KA 1YKAA 4XS1A 5HGOA 4WBJA 3MNGA 2NO8A 3ZTLA 4F0BA 5IPGA 1VQ9P 2KG9A 1KEBA 2KODA 1QFNA 2LKIA 1U88A 2IJYA 1GTAA 1SD9A 3VRLC 4O5QA 1PL1A 1E0HA 3WYWA 4BVXA 10GSA 4GRFA 4MF6A 2DMLA 2JYGA 1AAZA 2H74A 4ISDA 4TR1B 1KC8Q 3GTUB 1VHNA 5ECQB 2IFQB 2F9SA 1XWKA 3RPNA 1VQ7P 2VOCA 2H1AA 2M8NA 3IV4A 3ZFBA 3VURA 5HVCA 3I6AA 5KN2A 4D73B 3GA4A 1ILOA 4MA9A 4RQXA 4ID0A 5EVOA 3ZVJA 3H47A 3RHBA 4YH2A 4N11A 1JFUA 1ZL9A 4ACSA 1KQSO 3CCJP 1GUMA 4JZQA 3APOA 4HS1A 3NIVA 2M72A 1J08A 1OKTA 4JR6A 2HT9A 1XOBA 1XW6A 5H5SA 2YN1A 1O85A 2QSIA 4GTUA 2OBIA 3HJOA 4E8EA 2LNSA 2CV4A 4V1Ap 1SENA 5CP1A 1VQMP 1TRUA 1H4OA 1B8XA 4JRRA 3H4EA 4IJ3A 18GSA 2DIZA 1BYEA 1FO5A 2WZ9A 2GGTA 3A2WA 2GDRA 3KD0A 1U6TA 1A8OA 2FADA 2LNTA 2FUG2 2MBSA 3P7XA 4PXHB 4V2LA 3GL5A 4PQIA 3KJYA 3APSA 2PENA 2YJHA 2JB0A 1G0TA 3IOSA 1A2LA 1M1KQ 1V9WA 2FWHA 1UNKA 2K6VA 2XPDA 4DSSB 5KOXA 3DVXA 2FHEA 2B7JA 4ZB8A 3O3TA 3CRTA 3KP8A 1YQ1A 2DSAA 5G2ZA 2VM1A 3TJKA 3I56P 1GSFA 2K0YA 4FYBA 2JU1A 2YV7A 1MDKA 1K0OA 4ML6A 3IAM2 1OE8A 2IMIA 2H6YA 2VCXA 4NHZA 5D9XA 2HZFA 3L78A 5H5RA 4IGJA 2H8LA 1Z3EA 3TGZA 3CSIA 4GWRA 5HQPA 2X4AA 1TXXA 1T4YA 1UVZA 1GUKA 1GLQA 2FWEA 4Z7XA 3M9KA 5CRDA 2AJQB 4TVEA 4G19A 2MBTA 2DLXA 1YF1A 1Q81Q 1EV4A 4HKGA 2H6XA 4ECIA 4USSA 2LPKA 2HLSA 5F0GA 4HQSA 3TJJA 3LXZA 7GSSA 3DKSA 2I4AA 2B1KA 1T3BA 3L9SA 1J9BA 3CXGA 5D73A 2XBQA 2R0GA 2GQKA 3E9JB 2YPMA 3I43A 2MYGA 2AB6A 1EOQA 3TOTA 4COCA 4N0ZA 3H8QA 1NSWA 1AQXA 5F2OA 2PMTA 1YJWP 2V2GA 5HGLA 4MF7A 1RO2A 1F80D 2JU2A 4XFYA 2R0PA 3C1RA 1JZOA 2TRCP 3DS5A 1K0CA 3HJPA 2WULA 1K9MQ 4POMA 3DS2A 5IPHA 3W8SA 4QKOA 2VIMA 5CZDB 4PXOA 4XS6A 3H1NA 2Z45A 1GSDA 4MF5A 2L6CA 4LL4B 2GS3A 4EKZA 3PGTA 3GV1A 2JYLA 3GMFA 2KP2A 3R2QA 2E0QA 4L0UA 1JHBA 2H76A 2C3QA 5EW5E 5J41A 2WS2A 1YJ6A 1BQ7A 3FW2A 3LW9A 2M8PA 5ELAA 4AF2A 1A8LA 1VQKP 1R5AA 4TR4A 5B6MA 3W6GA 1FR2A 3FR3A 3N9JA 1O7UA 4MLYA 1B4PA 3US3A 1WPIA 4I2UA 1KLPA 1FVJA 1IMQA 3L0HA 1V58A 2P5QA 5B7CA 5ECIB 2K93A 3TRQA 2HNLA 4OFNA 4AJ6A 3LGCA 3LMOA 1OAZA 4TXVA 5B8AA 5IIZA 1THXA 4OWYA 2QNWA 2ES7A 1A8YA 4QQ7A 1VF2A 3Q20A 3I9V2 2OTJP 1VKUA 4HU9A 3LYPA 5JCWA 2B5YA 2NBSA 5D8IA 4MRTC 2V1MA 4K2XA 4KA0A 5L71A 5BS1A 4WKWA 4COPA 3RG6C 3FK8A 1Q86Q 5DCHA 2R3XA 3G21A 3UEMA 2DC5A 4RI7A 2C3TA 1SKRB 4K7OA 4HJMA 3FZAA 3E3EA 4GLTA 4HU7A 2KLXA 5D9VA 1EGOA 2WDUA 5F06A 3BJ5A 3LEFA 3ZLPA 4TXOA 2K2QA 2BHVA 1KD1Q 3CC7P 2D2ZA 2FLSA 2PVOC 3RAZA 5HFGA 3CCQP 3KIJA 2VCTA 2FQ0A 4OMVA 2A2SA 3U6VA 1NHOA 5J9BA 2EHTA 2HZEA 5JWOB 4M0IA 4G9HA 3QAGA 4ILFA 19GSA 3D6IA 2AAWA 3L9VA 4BIKA 5IOWA 1J0FA 1VQ6P 3H79A 4XROA 4EO3A 3JCML 5D96A 3GL3A 2PU9C 2KOQA 2GSRA 2PEIA 2ROQA 1LU4A 2OA7A 3CMEP 2VLTA 3UJ1A 2DJ0A 4L5LA 3D0ZA 5IQYA 1N2AA 2WCIA 3F63A 1RO0A 5KP7B 1X5CA 1WE0A 2JZRA 5CO3A 3VWUA 4X0XA 3APQA 6GSUA 2MVVA 1F37A 5DJMA 4K6XA 3GN3A 3HJMA 4GSTA 3L9UA 1TI1A 2FA4A 22GSA 3CYNA 4NMUA 1R4WA 1M6EX 6GSXA 2QGVA 2P0GA 2VM2A 1YY7A 2OADA 3GRXA 2CNRA 2VAFA 4OFMA 5G5EA 2V6OA 4TKYA 4MCUA 2QC7A 4LA1A 3B5IA 1THOA 1M74A 4MDCA 4ML1A 3GKLC 3DVWA 4Q5QA 3HD5A 1K3YA 2R4VA 1F3BA 2GZEA 1TI3A 3HA9A 5LNKe 3CCEP 4X43A 2DMMA 3A2XA 2CVBA 4KSOA 4CY6A 1TU8A 2DJ2A 5IMVA 5G5FA 1R26A 2Z46A 3QOUA 6GSVA 1U87A 3G6EP 1ERVA 2WRTA 1W4VA 1T8KA 1K0AA 3HXSA 4JEDA 4DSQA 3H93A 2LIWA 3CCUP 2CZ3A 2KR5A 4XHMA 1TU7A 2KW2A 2K8VA 1S3RA 4BL7A 3EURA 4MH2A 4U0FA 2C1YA 3DWVA 1XPVA 1GUHA 3H4KA 2LF4A 1FOHA 4BVXB 4KDYA 2C80A 2XT1A 1HNBA 1FB6A 1XWAA 2RIIA 2KUCA 4AGSA 2PEJA 4A5PA 1YITP 13GSA 1Z6MA 5JCGA 1HD2A 2M46A 3GKMA 3EC3A 3TCOA 3GHAA 2LUSA 2KGDA 5A5KA 2N5AA 2GDXA 5HR2A 1RW1A 2YJ7A 1OR5A 4V2MA 3DS3A 3FYGA 5HV8A 5GSSA 3QMXA 3F4SA 4QL7A 1YZXA 2H19A 1O8XA 1E6BA 5DJLA 2WJUA 1Q7YQ 1EEMA 3KEBA 2GLRA 2GSSA 2P5RA 4BVYA 4TR0A 2BMXA 2FCHA 2VCVA 1TK8B 3GKKA 3FKFA 1EGRA 1M3IA 2L9FA 1HQBA 1K0BA 1ZYNA 3KGKA 1WWJA 1YEPA 5ID2A 3Q6OA 3G29A 5D9WA 3E0UA 3IK9A 2H1DA 3CBUA 1LJRA 3EJEA 2IMKA 1NM3A 3A5WA 4F82A 1KNGA 2FD3A 4KCEA 4LMVA 1W89A 3K8NA 1GP1A 2VUPA 3F3QA 2K18A 1ZYEA 3LSZA 1OKDA 1T7PB 1GXGA 4Q5RA 4MABA 1SK0A 4KCAA 4LLRA 2MF4A 2CVKA 3Q18A 3DTJA 1QMVA 5CNWA 2H72A 5JCUA 2RUEA 3VI7A 3GKXA 3DS0A 1VF4A 2FWGA 3D22A 4ECJA 4KB3A 1AIUA 1ACPA 2CAIA 1Z5YE 2X8GA 4JE1A 2HRNA 2GT5A 3TDGA 3I69A 2YP6A 4NXIA 3EJBA 8GSSA 1CQGA 1PSQA 2EHSA 1TKDB 2BJXA 2ZNMA 3VLNA 4FYCA 4FO5A 1X5DA 4KNDA 1EEJA 1HNCA 1Y25A 3VK9A 1TRWA 3KMNA 2WFCA 2NPBA 3GX0A 4AJ8A 2CZ2A 2CQ9A 1M90Q 4POKA 3D5JA 4JR4A 1TTZA 5DQYA 2KGCA 2O89A 3CCLP 5E59A 2FWFA 3F3RA 5I4TG 5FHIA 1OE7A 5JPAA 1K8AQ 2LOLA 1KBNA 2DBCA 1M9BA 3IAS2 9GSSA 2VLOA 1M2DA 1BX9A 3KMOA 2L4QA 4BWSA 5KN1A 3EJDA 1GH2A 3EYTA 1QK8A 2FVFA 2EFJA 1OYJA 3EMPA 3Q19A 3TB2A 1GSEA 4U0AA 1OVNA 3M1MA 3WD6A 4L5OA 1BJXA 4MNNA 2LTEA 3RHCA 3LXTA 1VF3A 2LV3A 2DJJA 2J23A 3GJNA 3U5RE 2C3NA 2E7PA 3NY7B 5J5NA 4H86A 2C0DA 3F9UA 2KGEA 5CRWA 5FWGA 4OO4A 1GNEA 4FQUA 2KG6A 3V1WA 2XZ0D 4PX1A 3CTFA 4Z2UA 2E2MA 4OFTA 2RLIA 3A2VA 4IJIA 1GNWA 1SK2A 1RNIA 1VQOP 2MMAA 3LFLA 2C4JA 4NHWA 2AUVA 2Z9SA 2P9XA 2JO0A 1T00A 2VO4A 1PMTA 2J9HA 4GXZA 3QAWA 3HY2A 4O92A 3S9FA 4PH0A 3GTUA 5GSTA 1YJ9P 1TP9A 1Z6NA 2XC2A 4O5RA 2GVPA 1VF1A 2MZCA 2E2GA 4HOJA 1SL2B 1ZCPA 4D73A 2LJAA 1ERWA 3VFIA 5ECNB 1NW2A 3P8WA 4HQZA 2REMA 3HDCA 3GX8A 4CA3A 3IA1A 4U0EA 5A4VA 2K0DX 2JL4A 2I3YA 4F37A 4WR4A 3DS4A 1RQMA 3F4RA 2L59A 4X1UA 2A4HA 2FQ2A 4PWVB 4EL1A 5LD0A 2IMFA 2GZPA 2PUKC 4POLA 5LCZA 4O5UA 5GAND 1VQPP 1SYRA 2LRTA 3ZVJD 4EUYA 2K5XA 1WIKA 3CQFA 3ERWA 1X9MB 4WF4A 3ZITA 2GZGA 3KP9A 1VQLP 2CT6A 2RUFA 2CAQA 2UZ8A 5KOWA 1MD3A 1B9YC 4CHSA 1DV5A 1YF0A 5HR1A 3TKPA 3HZ8A 4TOPA 3ZL5A 5KEJA 3G1GA 4XRAA 1YDKA 2HE3A 2VL2A 2IWTA 3GYKA 2FHSC 4O32A 1MEKA 2VSQA 3AY8A 20GSA 1JZWA 4F0CA 3P2AA 1E2YA 1GL8A 2XXMA 2FA8A 3IR4A 2X49A 2YOIA 1DNYA 2KOSA 3M0FA 4I8BA 2H01A 3ME7A 1K3OA 2CG5B 5H5QA 2BUOA 3WBHA 2AHEA 1ZMBA 2L4CA 1W2BO 4Q5NA 2C8UA 5ECPB 4PTSA 3NZNA 4PGTA 5HR3A 4K0GA 2ON7A 4TXOB 2KOOA 2L4BA 2MMZA 1AXDA 2RM6A 1EZKA 2DJKA 4ZB6A 3IPZA 4N30A 3WGDA 3UBKA 1NJIQ 4XFXA 3CSJA 1JJ2O 5COHA 1V40A 4YAVA 4U0BA 1DBYA 1ERUA 1VRSD 2HZEB 1N8JA 1V2AA 2LTKA 2WB9A 3QAVA 5ELGA 2I1UA 1EWXA 1H75A 3FZ4A 3FEUA 4Z2RA 2ZCTA 4NPBA 2DKHA 4IQ1A 2KOPA 4BPYA 5KP8B 2VCWA 1XG8A 1GLPA 3KZQA 4K9ZA 1FB0A 3G9BA 1L0IA 1ON4A 2C0FA 3HYPA 4ICYA 1FOVA 2FGXA 5KN3A 2TRXA 2FACA 4POBA 1UN2A 1K0DA 3TKSA 3MDKA 3KH9A 4F03A 1ST9A 3CSHA 2IMDA 4AJ7A 2LQQA 1GSYA 2F51A 2VL2C 2R2JA 2FVEA 1EOGA 3MGEA 3DGQA 1R7HA 3QDNA 3L4NA 4N0VA 4NEOA 5EY6A 1T1VA 1DE2A 4U0CA 2C0EA 2GDYA 3LRYA 2LJRA 2YZUA 4GQCA 4V1Ag 5J9CA 2YWNA 5DALA 2R37A 2JAZA 1OC8A 3ISOA 3M3MA 2H1GA 1F6MC 3EU3A 1HNAA 1SJ6A 2IIYA 4LL1B 2I9HA 5CREA 3TJBA 1AUCA 2QA1A 1XVQA 1BAYA 1YEXA 3DS1A 5IOXA 4H2XC 1QUWA 3FMWA 5BRTA 2OACA 3QFAC 5JWRB 2OARA 5GAPD 1JLWA 3IC8A 5ECMB 4G10A 4K7IA 1ZGNA 4EE0A 5J4UA 3ZREA 3FR9A 3CC4P 4ZB9A 5AISA 3G1IA 4K8MA 1G7EA 1MTCA 5IMFA 1L0HA 4EIPA 2VCQA 4NAXA 3CCMP 2N6ZA 4E8HA 3H0DA 4MPGA 1SJIA 5CYYA 5ECLB 2N5FA 4G0IA 5INYA 4G0LA 4I6XA 1G6WA 2B5EA 1BG5A 5B8BA 1TJDA 3ZIJA 3TKSC 3ZRDA 2LRNA 2PY8A 16GSA 1VGLA 3F6DA 4BL7B 3A3TA 3GH9A 5HGMA 2M5RA 2O8VB 3VWVA 2LQOA 2FAEA 5HR0A 3MIXA 2JZTA 4KDUA 3QR6A 3UBLA 3FHKA 1YI2P 3PINA 3RDWA 1GSQA 4PQHA 1M7TA 4ECCA 3G28A 5ECHB 4KF9A 2DJ3A 2X8CA 5AN1A 1F9MA 2L6EA 4DSRA 2OE1A 2NTOA 1BXIA 2L57A 3O76A 2VLNA 3DYRA 2L5LA 4JBBA 4FYUA 5DAKA 5KN0A 2AYTA 2H70A 4WBRD 2LRCA 3CXCO 3G0VA 3CCSP 2GZZA 4KUNA 4BPGA 1U3IA 1PN0A 4PUFC 4FH8A 2GZJA 2YCDA 1YKCA 5F05A 3NOFA 2H0GA 4IP1A 1VQ4P 4ZIJA 1A0FA 1B9XC 1GSSA 2LKUA 1C72A 1RK4A 3C1SA 1M3JA 4HDEA 5ECRB 4IBPA 1PA3A 2PEQA 1JZRA 1HYUA 3TRXA 2JQ4A 1AYIA 4G0KA 5ID2B 3GUSA 2GQMA 1ERTA 2VLPA 3QFBC 3G26A 1WMJA 3QCPA 2QEXP 3C8EA 6GSWA 4NWYA 3G7IA 1M2BA 1K30A 3N5OA 3CMAP 5B6NA 1XZOA 1GWCA 3VPQA 1R5PA 4GSNA 4EIQA 3DPHA 1YIJP 3CE7A 1XW9A 3FZ5A 2LS5A 2A2RA 3CMIA 4XCSA 3G7YA 3MYDA 3ZMKA 5CAXA 2P31A 2E1MA 4OO5A 4NV5A 2X99A 5EPFA 3P90A 2V6KA 1I5GA 1V57A 1G6YA 4GSSA 2PNGA 3ERFA 4BA7A 4PNGA 4ECBA 2VL9A 5IMCA 5AGYA 1A24A 1ZYQB 4PNFA 5ECOB 1GTUA 3E2DA 4WYMA 4WEYA 1T8EB 2IL3A 1XWGA 1ACVA 3HHVA 4PUAA 5DDLA 1MD4A 1Y6EA 3ME8A 2PEMA 2HSYA 4K1FA 4KGIA 2YNXA 2OTLP 3GIXA 1PRXA 2X2BA 1S3DA 4MZCA 3PR8A 3KXOA 2JBGA 4KAEA 4QL9A 1ZMAA 2VD1A 1OC3A 4GCIA 4XS4A 2XV6A 1T4ZA 3CRUA 2FNOA 5DQSA 4TW5A 4QNBA 3IXRA 2BTOT 1O8WA 1DSBA 1IUQA 3RBTA 1F3AA 3TRPA 1OC9A 4EVMA 1PQNA 4MH3A 4MZWA 3J7Yk 4WF5A 4BPFA 1PL2A 2H73A 1A2MA 1S3AA 17GSA 2LEGA 1SYXA 4ZBBA 2MR8A 4L8EA 3HVNA 3EPTA 3HVVA 2ON5A 2LL8A 1AQVA 3IHQA 1GXHA 1YJNP 2MMOA 1AF8A 2CQ8A 3FZ9A 3VPTA 4V2NA 4MMMA 3G71P 4TN8A 3O6TA 2PN8A 1MDIA 4OCEA 4KE3A 4YQUA 3VWXA 4IW9A 2MY5A 1WOUA 2H30A 2VLVA 5F2NA 2N5HA 1S72P 2CWOA 1E6JP 3M8NA 2H71A 2IN3A 3EVIA 4I97A 2YANA 3ZFLA 4EF0A 3PPUA 2F8AA 2WGRA 5CRGA 5ENUA 5C00A 1FW1A 2H66A 1MDJA 4HZ2A 3IRAA 1WP0A 1B4QA 3KM6A 3IK7A 4IVFA 2XBIA 3CCVP 1X3OA 1HQOA 2DKIA 5HFIA 1A43A 1CEIA 1QVFO 4MJEA 2DGYA 1K0NA 4ZBAA 2VL3A 2YWOA 3TJFA 2L0QA 4H2WC 4ZL8A 2DIYA 4YAPA 2G0FA 2OE3A 3EINA 4Z2TA 3FR6A 4EC0A 5F8BA 1WJKA 1DUGA 3IHGA 2K94A 1Z7RA 3W8JA 3FRCA 5G1LA 3WT1A 1URMA 1Q82Q 5DVBA 2N6YA 3MSZA 2QKEA 1VQNP 2GQLA 1ML6A 4TR1A 2N5BA 4ZL9A 2IFQA 3GKNA 2XPEA 4MJAA 1WRYA 5EJDA 4K0NA 2PGTA 4OD7A 5J3RA 3VWWA 4YKGA 3TJGA 4Q5FA 4K7NA 2PVQA 1Z9HA 1QVGO 3FY7A 4R0MA 3BBYA 1UA5A 3DMLA 3ZYWA 4G2EA 4MPFA 1FAAA 2HRKA 3IDVA 1PKWA 1O81A 2OJLA 2HRFA 4ZL7A 1SL0B 2V41A 5G1KA 1HY8A 5IM9A 1EMVA 2YZHA 1PN9A 2N98A 1KTEA 2YV9A 2HSHA 1F2EA 1M9AA 1XCCA 2K0XA 1MZ8A 1K73Q 3GSSA 3GSTA 4IP6A 1ZNVA 4IKHA 1A0RP 2B1LA 3J7Yb 4HI7A 2OE0A 1GTIA 12GSA 4GF0A 2ERHA 1CQHA 3KH7A 5DBQA 2V32A 2HYXA 1VQ8P 2FY6A 2VLQA 2R6KA 3D21A 5GZZB 1X9SB 2JU5A 3EWLA 4WETA 5HFKA 3IBHA 2KHPA 2B7KA 3P05A 5IMDA 2X8HA 2RM5A 4ULXA 1XBSA 4XRQA 1DE1A 1USBA 2AFDA 5G30A 2TIRA 1QXHA 2ONTA 1PFOA 3CC2P 4N10A 4KX4A 5HGNA 3EMXA 1SKSB 2QA2A 1TOFA 2O7KA 4DSSA 3M9JA 4DVCA 3GZLA 5BMUA 2KWLA 4H2YC 3TUEA 4U0DA 2LMLA 2JGPA 1K0MA 3UVTA 3KCMA 1A2JA 3GURA 1Z7PA 2CX4A 2GYKA 3DXBA 4PH1A 2GZFA 2JZSA 2FQ1A 4HJ2A 4XIHA 5DALB 3QPMA 3ZZXA 1JLVA 1PKZA 2I81A 4XFZA 4ZXGA 2B5XA 3VI5A 3GNJA 2O85A 5C04A 5ECSA 2N50A 3B4QA 3HYBA 1EV9A 2F3MA 4MP4A 2KG8A 2CA8A 1LBKA 5EL8A 1FVKA 4J2FA 3HVXA 5DCGA 2H1BA 4GR6A 4YQMA 5KP6B 2H75A 2PERA 3DD3A 2EIAA 6GSYA 4BPHA 2VCZA 4FIWA 2K92A 2N5IA 3CD6P 1PGTA 3MAKA 2CVDA 1SJZA 3MWHA 4NV2A 2NDOA 2PEOA 1TK0B 1NQ4A 4HUAA 1B48A 3GZMA 1EIAA 3F4TA 3LORA 3ERGA 1XIYA 1JZDA 4IPYA 1O6JA 5A4WA 4BWQA 2GTUA 4XTSA 4GR2A 1AW9A 2VLUA 2GSQA 1QRJA 1M2AA 4RUVA 3BD2A 2VD0A 4YKFA 2LJKA 4O7HA 5DCKA 1FHEA 5F07A 1XFLA 3Q74A 3TOUA 2QA4P 4DEJA 3CPWO 2G2QA 5AIXA 3WT2A 3SWLA 1I9DA 2L5OA 4X4JA 4KW6A 3R3EA 2R0CA 2FVAA 4KH7A 3A5IA 2XZ1C 2KP1A 5JWQB 1V98A 4KDXA 3TKSE 1TRVA 2EIOA 1TW9A 1S3CA 1ZYPA 1FG4A 3GH6A 1SU9A 2ALBA
chains in the Genus database with same CATH topology
2KOKA 1IYIA 4K5SA 5DAKB 1A23A 2HFDA 2JACA 4ZILA 1GTBA 2OKAA 3M1GA 1XWCA 4P3YB 1QQ2A 1XWBA 6GSTA 3OR5A 2A2PA 4IELA 1PX6A 4J57E 3LQ7A 1AC1A 3IC4A 5E4WA 1ZZYA 3UMAA 4RI6A 4J56E 5IO2A 2DJ1A 3D4TA 1XW5A 2MMNA 3HZ4A 4WR5A 3ZIVA 5IO0A 5A4UA 1IYHA 1G7OA 2F8FA 1NHYA 2EIQA 2IPAA 2IMEA 4TR3A 3EE2A 5AIVA 2A4VA 3LJRA 3UAPA 2L6DA 1M0UA 3D4MA 4RQRA 4EDZA 3KTLA 5FT3A 1TRSA 4LMWA 1GULA 3BCIA 4I5QA 3LYKA 2YWMA 1EP7A 1QGVA 4WXTA 5D9TA 3IE3A 1SK1A 2C0GA 1SD8A 4CY8A 4TRXA 3EU4A 4HZ4A 4CW9A 3DEXA 4MJCA 1PD21 1X0RA 3ED3A 2EC4A 4IQAA 2H6ZA 2JADA 1BEDA 3GFKA 3DIEA 3UIWA 3HVSA 3WGXA 1K3LA 4I2TA 2H0IA 3CTGA 4MJBA 2YWIA 3PH9A 6GSSA 1O73A 1XOAA 3KTBA 3C71A 4BVYB 1Q98A 3C7MA 3RPPA 3QD9A 2M80A 1UC7A 3C73A 2HSMA 3F8UA 1AQWA 2R5GA 1ZOFA 4YQVA 3UOMA 2HXKA 3UL3A 1Q4JA 5D93A 4L0WA 4IN0A 4F9ZA 1X9WB 1TK5B 5IMZA 4MK3A 1ABAA 4IHUA 4K5RA 3ZMLA 1GSUA 2B6MA 4XS4B 3UARA 3TKQA 2JSYA 4GQFA 2K8SA 2PWJA 1SL1B 3BOAA 1OC9B 4KSMA 14GSA 11GSA 4K2DA 3DRNA 4EDYA 3F0IA 4F2IA 2GSTA 2PPTA 1M99A 3HCZA 1X5EA 3LG6A 4JU5A 2B3SA 4XRDA 2HI7A 2LSTA 1TDIA 4IS0A 4CDOA 5ECKB 1GRXA 5CRHA 1XXUA 5ABRA 2K9FA 4PQ1A 2XHFA 5G31A 2OBKA 3WGEA 4EXJA 4OCFA 4MZBA 2PBJA 3TKRA 4PURA 2H0HA 1XVWA 1SKWB 1U3AA 1EOHA 1SU9A 2NVLA 2O87A 1EP8A 3F6FA 3BCKA 2HRAA 3UVHA 3LWAA 2GT6A 3HKRA 4HEA2 2EIRA 2ZUPA 4ZBDA 3G7JA 2GZYA 2JSZA 1PX7A 5IMAA 3SBCA 2CX3A 2X64A 2AV4A 1YKAA 4XS1A 4WBJA 3MNGA 3ZTLA 4F0BA 5IPGA 1KEBA 1QFNA 1U88A 2IJYA 1GTAA 1SD9A 4O5QA 1PL1A 3WYWA 4BVXA 10GSA 4GRFA 4MF6A 2DMLA 1AAZA 2H74A 4ISDA 4TR1B 3GTUB 5ECQB 2IFQB 2F9SA 1XWKA 3RPNA 2VOCA 2H1AA 3IV4A 3ZFBA 3VURA 3I6AA 5KN2A 4D73B 3GA4A 1ILOA 4MA9A 4RQXA 4ID0A 5EVOA 3ZVJA 3RHBA 4YH2A 4N11A 1JFUA 1ZL9A 4ACSA 1GUMA 4JZQA 3APOA 4HS1A 3NIVA 2M72A 1J08A 1OKTA 4JR6A 2HT9A 1XOBA 1XW6A 5H5SA 2YN1A 1O85A 2QSIA 4GTUA 2OBIA 3HJOA 4E8EA 2LNSA 2CV4A 4V1Ap 1SENA 5CP1A 1TRUA 1H4OA 1B8XA 4JRRA 4IJ3A 18GSA 2DIZA 1BYEA 1FO5A 2WZ9A 2GGTA 3A2WA 2GDRA 3KD0A 1U6TA 2LNTA 2FUG2 2MBSA 3P7XA 4V2LA 3GL5A 4PQIA 3KJYA 3APSA 2YJHA 1G0TA 3IOSA 1A2LA 1V9WA 2FWHA 2K6VA 2XPDA 4DSSB 5KOXA 3DVXA 2FHEA 2B7JA 4ZB8A 3O3TA 3CRTA 3KP8A 1YQ1A 2DSAA 5G2ZA 2VM1A 3TJKA 1GSFA 4FYBA 2YV7A 1MDKA 1K0OA 4ML6A 3IAM2 1OE8A 2IMIA 2H6YA 2VCXA 4NHZA 5D9XA 2HZFA 3L78A 5H5RA 4IGJA 2H8LA 1Z3EA 3TGZA 3CSIA 4GWRA 5HQPA 2X4AA 1TXXA 1T4YA 1UVZA 1GUKA 1GLQA 2FWEA 4Z7XA 3M9KA 5CRDA 2AJQB 4TVEA 4G19A 2MBTA 2DLXA 1YF1A 1EV4A 4ECIA 2H6XA 4USSA 2HLSA 5F0GA 4HQSA 3TJJA 3LXZA 7GSSA 3DKSA 2I4AA 2B1KA 1T3BA 3L9SA 1J9BA 3CXGA 5D73A 2XBQA 2R0GA 2GQKA 3E9JB 2YPMA 3I43A 2MYGA 2AB6A 3TOTA 4N0ZA 3H8QA 1NSWA 1AQXA 2PMTA 2V2GA 4MF7A 2R0PA 3C1RA 1JZOA 2TRCP 1K0CA 3HJPA 2WULA 4POMA 5IPHA 3W8SA 2VIMA 4PXOA 4XS6A 3H1NA 1GSDA 4MF5A 2L6CA 4LL4B 2GS3A 4EKZA 3PGTA 3GV1A 3GMFA 2KP2A 3R2QA 2E0QA 4L0UA 1JHBA 2H76A 2C3QA 5J41A 2WS2A 1YJ6A 1BQ7A 3FW2A 3LW9A 5ELAA 4AF2A 1A8LA 4TR4A 1R5AA 5B6MA 3W6GA 3FR3A 3N9JA 1O7UA 4MLYA 1B4PA 3US3A 1WPIA 4I2UA 1FVJA 3L0HA 1V58A 2P5QA 5B7CA 5ECIB 3TRQA 2HNLA 4OFNA 4AJ6A 3LGCA 1OAZA 4TXVA 5B8AA 5IIZA 1THXA 4OWYA 2ES7A 1A8YA 4QQ7A 1VF2A 3I9V2 4HU9A 3LYPA 5JCWA 2B5YA 2NBSA 5D8IA 2V1MA 4K2XA 4KA0A 5L71A 4WKWA 3FK8A 5DCHA 2R3XA 3UEMA 2DC5A 4RI7A 2C3TA 1SKRB 4K7OA 4HJMA 3FZAA 3E3EA 4HU7A 2KLXA 5D9VA 1EGOA 2WDUA 5F06A 3BJ5A 3LEFA 3ZLPA 4TXOA 2D2ZA 2FLSA 2PVOC 3RAZA 5HFGA 3KIJA 2VCTA 4OMVA 2A2SA 3U6VA 1NHOA 5J9BA 2HZEA 5JWOB 4G9HA 3QAGA 4ILFA 19GSA 3D6IA 2AAWA 3L9VA 5IOWA 1J0FA 3H79A 4EO3A 3JCML 5D96A 3GL3A 2PU9C 2GSRA 1LU4A 2OA7A 2VLTA 3UJ1A 2DJ0A 4L5LA 3D0ZA 5IQYA 1N2AA 2WCIA 3F63A 1X5CA 1WE0A 2JZRA 5CO3A 3VWUA 4X0XA 3APQA 6GSUA 1F37A 5DJMA 4K6XA 3GN3A 3HJMA 4GSTA 3L9UA 1TI1A 2FA4A 22GSA 3CYNA 4NMUA 1R4WA 6GSXA 2QGVA 2P0GA 2VM2A 1YY7A 2OADA 3GRXA 2VAFA 4OFMA 5G5EA 2V6OA 4TKYA 4MCUA 2QC7A 4LA1A 1THOA 4MDCA 4ML1A 3DVWA 4Q5QA 3HD5A 1K3YA 2R4VA 1F3BA 1TI3A 3HA9A 5LNKe 4X43A 2DMMA 3A2XA 2CVBA 4KSOA 4CY6A 1TU8A 2DJ2A 5IMVA 5G5FA 1R26A 3QOUA 6GSVA 1U87A 1ERVA 2WRTA 1W4VA 1K0AA 3HXSA 4JEDA 4DSQA 3H93A 2CZ3A 4XHMA 1TU7A 2K8VA 4BL7A 3EURA 4MH2A 2C1YA 3DWVA 1XPVA 1GUHA 3H4KA 1FOHA 4BVXB 4KDYA 2C80A 1HNBA 1FB6A 1XWAA 2RIIA 2KUCA 4AGSA 4A5PA 13GSA 1Z6MA 5JCGA 1HD2A 2M46A 3GKMA 3EC3A 3TCOA 3GHAA 2LUSA 5A5KA 2N5AA 5HR2A 1RW1A 2YJ7A 4V2MA 3FYGA 5GSSA 3QMXA 3F4SA 4QL7A 1YZXA 2H19A 1O8XA 1E6BA 5DJLA 2WJUA 1EEMA 3KEBA 2GLRA 2GSSA 2P5RA 4BVYA 4TR0A 2BMXA 2FCHA 2VCVA 1TK8B 3GKKA 3FKFA 1EGRA 1ZYNA 1K0BA 3KGKA 1WWJA 1YEPA 5ID2A 3Q6OA 5D9WA 3E0UA 3IK9A 2H1DA 3CBUA 1LJRA 2IMKA 1NM3A 3A5WA 4F82A 1KNGA 2FD3A 4KCEA 4LMVA 1W89A 3K8NA 1GP1A 2VUPA 3F3QA 2K18A 1ZYEA 3LSZA 1OKDA 1T7PB 4Q5RA 4MABA 1SK0A 4KCAA 4LLRA 3Q18A 2CVKA 1QMVA 5CNWA 2H72A 5JCUA 2RUEA 3VI7A 3GKXA 1VF4A 2FWGA 3D22A 4ECJA 4KB3A 1AIUA 2CAIA 1Z5YE 2X8GA 4JE1A 2HRNA 2GT5A 3TDGA 3I69A 2YP6A 4NXIA 8GSSA 1CQGA 1PSQA 1TKDB 2BJXA 2ZNMA 3VLNA 4FYCA 4FO5A 1X5DA 4KNDA 1EEJA 1HNCA 1Y25A 3VK9A 1TRWA 3KMNA 2WFCA 2NPBA 3GX0A 4AJ8A 2CZ2A 2CQ9A 4POKA 3D5JA 4JR4A 1TTZA 5DQYA 2O89A 5E59A 2FWFA 3F3RA 5FHIA 1OE7A 1KBNA 2DBCA 1M9BA 3IAS2 9GSSA 1M2DA 1BX9A 3KMOA 2L4QA 4BWSA 5KN1A 1GH2A 3EYTA 1QK8A 1OYJA 3EMPA 3Q19A 3TB2A 1GSEA 1OVNA 3WD6A 1BJXA 4L5OA 4MNNA 3RHCA 3LXTA 1VF3A 2LV3A 2DJJA 2J23A 3U5RE 2C3NA 2E7PA 5J5NA 4H86A 2C0DA 3F9UA 5CRWA 5FWGA 4OO4A 1GNEA 4FQUA 3V1WA 4PX1A 3CTFA 4Z2UA 2E2MA 4OFTA 2RLIA 3A2VA 4IJIA 1GNWA 1SK2A 2MMAA 3LFLA 2C4JA 4NHWA 2AUVA 2Z9SA 2VO4A 1T00A 1PMTA 2J9HA 4GXZA 3QAWA 3HY2A 4O92A 3S9FA 3GTUA 5GSTA 1TP9A 1Z6NA 2XC2A 4O5RA 2GVPA 1VF1A 2MZCA 2E2GA 4HOJA 1SL2B 1ZCPA 4D73A 2LJAA 1ERWA 3VFIA 5ECNB 1NW2A 3P8WA 4HQZA 2REMA 3HDCA 3GX8A 3IA1A 5A4VA 2JL4A 2I3YA 4WR4A 3F4RA 1RQMA 2L59A 4X1UA 2A4HA 4EL1A 5LD0A 2IMFA 2GZPA 2PUKC 4POLA 5LCZA 4O5UA 5GAND 1SYRA 2LRTA 3ZVJD 4EUYA 1WIKA 3ERWA 1X9MB 4WF4A 3ZITA 3KP9A 2CT6A 2RUFA 2CAQA 2UZ8A 5KOWA 1MD3A 1B9YC 4CHSA 1YF0A 5HR1A 3TKPA 3HZ8A 4TOPA 3ZL5A 5KEJA 4XRAA 1YDKA 2HE3A 2VL2A 2IWTA 3GYKA 4O32A 1MEKA 3AY8A 20GSA 1JZWA 4F0CA 3P2AA 1E2YA 1GL8A 2FA8A 3IR4A 2X49A 2YOIA 3M0FA 4I8BA 2H01A 3ME7A 1K3OA 5H5QA 2AHEA 2L4CA 4Q5NA 2C8UA 5ECPB 4PTSA 3NZNA 4PGTA 5HR3A 4K0GA 2ON7A 4TXOB 2MMZA 1AXDA 2RM6A 1EZKA 2DJKA 4ZB6A 3IPZA 4N30A 3WGDA 3UBKA 3CSJA 4YAVA 5COHA 1V40A 1DBYA 1ERUA 1VRSD 2HZEB 1N8JA 1V2AA 2LTKA 2WB9A 3QAVA 5ELGA 2I1UA 1EWXA 1H75A 3FZ4A 3FEUA 4Z2RA 2ZCTA 4NPBA 2DKHA 4IQ1A 4BPYA 2VCWA 1GLPA 3KZQA 4K9ZA 1FB0A 3G9BA 1ON4A 2C0FA 3HYPA 4ICYA 1FOVA 2FGXA 5KN3A 2TRXA 4POBA 1UN2A 1K0DA 3TKSA 3MDKA 3KH9A 4F03A 1ST9A 3CSHA 2IMDA 4AJ7A 2LQQA 1GSYA 2F51A 2VL2C 2R2JA 1EOGA 3DGQA 1R7HA 3QDNA 3L4NA 4N0VA 5EY6A 1T1VA 1DE2A 2C0EA 2LJRA 2YZUA 4GQCA 5J9CA 4V1Ag 2YWNA 5DALA 2R37A 1OC8A 3ISOA 3M3MA 2H1GA 1F6MC 3EU3A 1HNAA 1SJ6A 2IIYA 4LL1B 2I9HA 5CREA 3TJBA 1AUCA 2QA1A 1XVQA 1BAYA 1YEXA 5IOXA 1QUWA 3FMWA 5BRTA 2OACA 3QFAC 5JWRB 5GAPD 1JLWA 3IC8A 5ECMB 4G10A 4K7IA 1ZGNA 4EE0A 5J4UA 3ZREA 3FR9A 4ZB9A 5AISA 4K8MA 1G7EA 1MTCA 5IMFA 4EIPA 2VCQA 4NAXA 4E8HA 4MPGA 1SJIA 5CYYA 5ECLB 2N5FA 4G0IA 5INYA 4G0LA 4I6XA 1G6WA 2B5EA 1BG5A 5B8BA 1TJDA 3ZIJA 3TKSC 3ZRDA 2LRNA 16GSA 1VGLA 3F6DA 4BL7B 3A3TA 3GH9A 2O8VB 3VWVA 2LQOA 5HR0A 3MIXA 2JZTA 4KDUA 3QR6A 3UBLA 3FHKA 3PINA 3RDWA 1GSQA 4PQHA 1M7TA 4ECCA 5ECHB 4KF9A 2DJ3A 2X8CA 5AN1A 1F9MA 4DSRA 2OE1A 2NTOA 2L57A 3O76A 3DYRA 2L5LA 4JBBA 4FYUA 5DAKA 5KN0A 2AYTA 2H70A 4WBRD 2LRCA 2GZZA 4KUNA 1U3IA 1PN0A 4PUFC 4FH8A 2YCDA 1YKCA 5F05A 3NOFA 2H0GA 4IP1A 4ZIJA 1A0FA 1B9XC 1GSSA 2LKUA 1C72A 1RK4A 3C1SA 4HDEA 5ECRB 4IBPA 1PA3A 1JZRA 1HYUA 3TRXA 4G0KA 5ID2B 3GUSA 1ERTA 2GQMA 3QFBC 1WMJA 3QCPA 3C8EA 6GSWA 4NWYA 3G7IA 1M2BA 3N5OA 5B6NA 1XZOA 1GWCA 3VPQA 1R5PA 4GSNA 4EIQA 1XW9A 3FZ5A 2LS5A 2A2RA 3CMIA 4XCSA 3G7YA 3MYDA 3ZMKA 5CAXA 2P31A 4OO5A 4NV5A 2X99A 5EPFA 3P90A 2V6KA 1I5GA 1V57A 1G6YA 4GSSA 3ERFA 4BA7A 4PNGA 4ECBA 2VL9A 5IMCA 5AGYA 1A24A 1ZYQB 4PNFA 5ECOB 1GTUA 4WEYA 1T8EB 2IL3A 1XWGA 1ACVA 3HHVA 4PUAA 5DDLA 1MD4A 1Y6EA 3ME8A 2HSYA 4K1FA 4KGIA 2YNXA 3GIXA 1PRXA 1S3DA 4MZCA 3PR8A 3KXOA 4KAEA 4QL9A 1ZMAA 2VD1A 1OC3A 4GCIA 4XS4A 1T4ZA 3CRUA 2FNOA 5DQSA 4TW5A 3IXRA 2BTOT 1O8WA 1DSBA 3RBTA 1F3AA 3TRPA 1OC9A 4EVMA 1PQNA 4MH3A 4MZWA 3J7Yk 4WF5A 1PL2A 2H73A 1A2MA 1S3AA 17GSA 2LEGA 1SYXA 4ZBBA 4L8EA 3EPTA 3HVVA 2ON5A 1AQVA 3IHQA 2MMOA 3FZ9A 3VPTA 4V2NA 4MMMA 4TN8A 3O6TA 2PN8A 1MDIA 4OCEA 4KE3A 4YQUA 3VWXA 4IW9A 1WOUA 2H30A 2VLVA 3M8NA 2H71A 2IN3A 3EVIA 4I97A 2YANA 3ZFLA 4EF0A 3PPUA 2F8AA 2WGRA 5CRGA 5ENUA 5C00A 1FW1A 2H66A 1MDJA 4HZ2A 3IRAA 1WP0A 1B4QA 3KM6A 3IK7A 4IVFA 2XBIA 1HQOA 2DKIA 5HFIA 4MJEA 1K0NA 4ZBAA 2VL3A 2YWOA 3TJFA 4ZL8A 2DIYA 4YAPA 2G0FA 2OE3A 3EINA 4Z2TA 3FR6A 4EC0A 5F8BA 1WJKA 1DUGA 3IHGA 1Z7RA 3W8JA 3FRCA 5G1LA 3WT1A 1URMA 5DVBA 3MSZA 2QKEA 2GQLA 1ML6A 4TR1A 2N5BA 4ZL9A 2IFQA 3GKNA 2XPEA 4MJAA 1WRYA 4K0NA 2PGTA 4OD7A 5J3RA 3VWWA 4YKGA 3TJGA 4Q5FA 4K7NA 2PVQA 1Z9HA 3FY7A 3BBYA 1UA5A 3DMLA 3ZYWA 4G2EA 4MPFA 1FAAA 2HRKA 3IDVA 1PKWA 1O81A 2OJLA 2HRFA 4ZL7A 1SL0B 2V41A 5G1KA 5IM9A 2YZHA 1PN9A 1KTEA 2YV9A 2HSHA 1F2EA 1M9AA 1XCCA 3GSSA 3GSTA 4IP6A 4IKHA 1A0RP 2B1LA 3J7Yb 4HI7A 2OE0A 1GTIA 12GSA 4GF0A 1CQHA 3KH7A 5DBQA 2V32A 2HYXA 2FY6A 5GZZB 2R6KA 3D21A 1X9SB 2JU5A 3EWLA 4WETA 5HFKA 3IBHA 2KHPA 2B7KA 5IMDA 2X8HA 2RM5A 4ULXA 1XBSA 1DE1A 1USBA 5G30A 2TIRA 1QXHA 4N10A 4KX4A 3EMXA 1SKSB 2QA2A 1TOFA 2O7KA 4DSSA 3M9JA 4DVCA 5BMUA 3TUEA 1K0MA 3UVTA 3KCMA 1A2JA 3GURA 1Z7PA 2CX4A 3DXBA 2JZSA 4HJ2A 4XIHA 5DALB 3QPMA 3ZZXA 1JLVA 1PKZA 2I81A 4ZXGA 2B5XA 3VI5A 3GNJA 2O85A 5C04A 5ECSA 1EV9A 2F3MA 4MP4A 2CA8A 1LBKA 5EL8A 1FVKA 4J2FA 3HVXA 5DCGA 2H1BA 4YQMA 2H75A 2PERA 3DD3A 6GSYA 4FIWA 2VCZA 1PGTA 3MAKA 2CVDA 4NV2A 1SJZA 3MWHA 2NDOA 1TK0B 4HUAA 1B48A 3F4TA 3LORA 3ERGA 1XIYA 1JZDA 1O6JA 5A4WA 4BWQA 2GTUA 4XTSA 1AW9A 2VLUA 2GSQA 1M2AA 4RUVA 3BD2A 2VD0A 4YKFA 2LJKA 4O7HA 1FHEA 5F07A 1XFLA 3Q74A 3TOUA 4DEJA 2G2QA 5AIXA 3WT2A 3SWLA 1I9DA 4X4JA 2L5OA 4KW6A 3R3EA 2R0CA 4KH7A 3A5IA 2KP1A 5JWQB 1V98A 4KDXA 3TKSE 1TRVA 2EIOA 1TW9A 1S3CA 1ZYPA 1FG4A 3GH6A 4GLTA 2ALBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOK A;  1IYI A;  5DAK B;  1A23 A;  2HFD A;  2JAC A;  4ZIL A;  1GTB A;  2OKA A;  3M1G A;  1XWC A;  4P3Y B;  1QQ2 A;  1XWB A;  6GST A;  3OR5 A;  4IEL A;  1PX6 A;  4J57 E;  3LQ7 A;  1AC1 A;  3IC4 A;  5E4W A;  1ZZY A;  3UMA A;  4RI6 A;  4J56 E;  5IO2 A;  2DJ1 A;  3D4T A;  1XW5 A;  2MMN A;  3HZ4 A;  4WR5 A;  3ZIV A;  5IO0 A;  5A4U A;  1IYH A;  1G7O A;  2F8F A;  1NHY A;  2EIQ A;  2IPA A;  2IME A;  4TR3 A;  3EE2 A;  5AIV A;  2A4V A;  3LJR A;  3UAP A;  2L6D A;  1M0U A;  3D4M A;  4RQR A;  4EDZ A;  3KTL A;  5FT3 A;  1TRS A;  4LMW A;  1GUL A;  3BCI A;  4I5Q A;  3LYK A;  2YWM A;  1EP7 A;  1QGV A;  4WXT A;  5D9T A;  3IE3 A;  1SK1 A;  2C0G A;  1SD8 A;  4TRX A;  3EU4 A;  4HZ4 A;  4CW9 A;  3DEX A;  4MJC A;  1PD2 1;  1X0R A;  3ED3 A;  2EC4 A;  4IQA A;  2H6Z A;  2JAD A;  1BED A;  3GFK A;  3DIE A;  3UIW A;  3HVS A;  3WGX A;  1K3L A;  4I2T A;  2H0I A;  3CTG A;  4MJB A;  2YWI A;  3PH9 A;  6GSS A;  1O73 A;  1XOA A;  3KTB A;  3C71 A;  1Q98 A;  3C7M A;  3RPP A;  3QD9 A;  2M80 A;  1UC7 A;  3C73 A;  3F8U A;  1AQW A;  2R5G A;  1ZOF A;  4YQV A;  3UOM A;  2HXK A;  3UL3 A;  1Q4J A;  5D93 A;  4L0W A;  4IN0 A;  4F9Z A;  1X9W B;  1TK5 B;  5IMZ A;  4MK3 A;  1ABA A;  4IHU A;  3ZML A;  1GSU A;  2B6M A;  4XS4 B;  3UAR A;  3TKQ A;  2JSY A;  4GQF A;  2K8S A;  2PWJ A;  1SL1 B;  3BOA A;  1OC9 B;  4KSM A;  14GS A;  11GS A;  4K2D A;  3DRN A;  4EDY A;  3F0I A;  4F2I A;  2GST A;  2PPT A;  1M99 A;  3HCZ A;  1X5E A;  3LG6 A;  4JU5 A;  2B3S A;  4XRD A;  2HI7 A;  2LST A;  1TDI A;  4IS0 A;  4CDO A;  5ECK B;  1GRX A;  5CRH A;  1XXU A;  5ABR A;  2K9F A;  4PQ1 A;  2XHF A;  5G31 A;  2OBK A;  3WGE A;  4EXJ A;  4OCF A;  4MZB A;  2PBJ A;  3TKR A;  4PUR A;  2H0H A;  1XVW A;  1SKW B;  1U3A A;  1EOH A;  1SU9 A;  2NVL A;  2O87 A;  1EP8 A;  3F6F A;  3BCK A;  3UVH A;  3LWA A;  2GT6 A;  3HKR A;  4HEA 2;  2EIR A;  2ZUP A;  4ZBD A;  3G7J A;  2GZY A;  2JSZ A;  1PX7 A;  5IMA A;  3SBC A;  2CX3 A;  2X64 A;  2AV4 A;  1YKA A;  4XS1 A;  4WBJ A;  3MNG A;  3ZTL A;  4F0B A;  5IPG A;  1KEB A;  1QFN A;  1U88 A;  2IJY A;  1GTA A;  1SD9 A;  1PL1 A;  3WYW A;  4BVX A;  10GS A;  4GRF A;  4MF6 A;  2DML A;  1AAZ A;  2H74 A;  4ISD A;  4TR1 B;  3GTU B;  5ECQ B;  2IFQ B;  2F9S A;  1XWK A;  3RPN A;  2VOC A;  2H1A A;  3IV4 A;  3ZFB A;  3VUR A;  3I6A A;  5KN2 A;  4D73 B;  3GA4 A;  1ILO A;  4MA9 A;  4RQX A;  4ID0 A;  5EVO A;  3ZVJ A;  3RHB A;  4YH2 A;  4N11 A;  1JFU A;  1ZL9 A;  4ACS A;  1GUM A;  4JZQ A;  3APO A;  4HS1 A;  3NIV A;  2M72 A;  1J08 A;  1OKT A;  4JR6 A;  2HT9 A;  1XOB A;  1XW6 A;  5H5S A;  2YN1 A;  1O85 A;  2QSI A;  4GTU A;  2OBI A;  3HJO A;  4E8E A;  2LNS A;  2CV4 A;  4V1A p;  1SEN A;  5CP1 A;  1TRU A;  1H4O A;  1B8X A;  4JRR A;  4IJ3 A;  18GS A;  2DIZ A;  1BYE A;  1FO5 A;  2WZ9 A;  2GGT A;  3A2W A;  2GDR A;  3KD0 A;  1U6T A;  2LNT A;  2FUG 2;  2MBS A;  3P7X A;  4V2L A;  3GL5 A;  4PQI A;  3KJY A;  3APS A;  2YJH A;  1G0T A;  3IOS A;  1A2L A;  1V9W A;  2FWH A;  2K6V A;  2XPD A;  4DSS B;  3DVX A;  2FHE A;  2B7J A;  4ZB8 A;  3O3T A;  3CRT A;  3KP8 A;  1YQ1 A;  2DSA A;  5G2Z A;  2VM1 A;  3TJK A;  1GSF A;  4FYB A;  2YV7 A;  1MDK A;  1K0O A;  4ML6 A;  3IAM 2;  1OE8 A;  2IMI A;  2H6Y A;  2VCX A;  4NHZ A;  5D9X A;  2HZF A;  3L78 A;  5H5R A;  4IGJ A;  2H8L A;  1Z3E A;  3TGZ A;  3CSI A;  4GWR A;  5HQP A;  1TXX A;  1T4Y A;  1UVZ A;  1GUK A;  1GLQ A;  2FWE A;  4Z7X A;  3M9K A;  5CRD A;  2AJQ B;  4TVE A;  4G19 A;  2MBT A;  2DLX A;  1YF1 A;  1EV4 A;  4ECI A;  2H6X A;  2HLS A;  5F0G A;  4HQS A;  3TJJ A;  3LXZ A;  7GSS A;  3DKS A;  2I4A A;  2B1K A;  1T3B A;  3L9S A;  1J9B A;  3CXG A;  5D73 A;  2XBQ A;  2GQK A;  3E9J B;  2YPM A;  3I43 A;  2MYG A;  2AB6 A;  3TOT A;  4N0Z A;  3H8Q A;  1NSW A;  1AQX A;  2PMT A;  2V2G A;  4MF7 A;  3C1R A;  1JZO A;  2TRC P;  1K0C A;  3HJP A;  2WUL A;  4POM A;  5IPH A;  3W8S A;  2VIM A;  4PXO A;  4XS6 A;  3H1N A;  1GSD A;  4MF5 A;  2L6C A;  4LL4 B;  2GS3 A;  4EKZ A;  3PGT A;  3GV1 A;  3GMF A;  2KP2 A;  3R2Q A;  2E0Q A;  4L0U A;  1JHB A;  2H76 A;  2C3Q A;  5J41 A;  2WS2 A;  1YJ6 A;  1BQ7 A;  3FW2 A;  5ELA A;  4AF2 A;  1A8L A;  4TR4 A;  1R5A A;  5B6M A;  3W6G A;  3FR3 A;  3N9J A;  1O7U A;  4MLY A;  1B4P A;  3US3 A;  1WPI A;  4I2U A;  1FVJ A;  3L0H A;  1V58 A;  2P5Q A;  5B7C A;  5ECI B;  3TRQ A;  2HNL A;  4OFN A;  4AJ6 A;  3LGC A;  1OAZ A;  4TXV A;  5B8A A;  5IIZ A;  1THX A;  4OWY A;  2ES7 A;  1A8Y A;  4QQ7 A;  1VF2 A;  3I9V 2;  4HU9 A;  3LYP A;  5JCW A;  2B5Y A;  2NBS A;  5D8I A;  2V1M A;  4KA0 A;  5L71 A;  4WKW A;  3FK8 A;  5DCH A;  2R3X A;  3UEM A;  2DC5 A;  4RI7 A;  2C3T A;  1SKR B;  4K7O A;  4HJM A;  3FZA A;  3E3E A;  4HU7 A;  2KLX A;  5D9V A;  1EGO A;  2WDU A;  5F06 A;  3BJ5 A;  3LEF A;  3ZLP A;  4TXO A;  2D2Z A;  2FLS A;  2PVO C;  3RAZ A;  5HFG A;  3KIJ A;  2VCT A;  4OMV A;  2A2S A;  3U6V A;  1NHO A;  5J9B A;  2HZE A;  5JWO B;  4G9H A;  3QAG A;  4ILF A;  19GS A;  3D6I A;  2AAW A;  3L9V A;  5IOW A;  1J0F A;  3H79 A;  4EO3 A;  3JCM L;  5D96 A;  3GL3 A;  2PU9 C;  2GSR A;  1LU4 A;  2OA7 A;  2VLT A;  3UJ1 A;  2DJ0 A;  4L5L A;  3D0Z A;  5IQY A;  1N2A A;  2WCI A;  3F63 A;  1X5C A;  1WE0 A;  2JZR A;  5CO3 A;  3VWU A;  4X0X A;  3APQ A;  6GSU A;  1F37 A;  5DJM A;  4K6X A;  3GN3 A;  3HJM A;  4GST A;  3L9U A;  1TI1 A;  2FA4 A;  22GS A;  3CYN A;  4NMU A;  1R4W A;  6GSX A;  2QGV A;  2P0G A;  2VM2 A;  1YY7 A;  2OAD A;  3GRX A;  2VAF A;  4OFM A;  5G5E A;  2V6O A;  4TKY A;  4MCU A;  2QC7 A;  4LA1 A;  1THO A;  4MDC A;  4ML1 A;  3DVW A;  4Q5Q A;  3HD5 A;  1K3Y A;  2R4V A;  1F3B A;  1TI3 A;  3HA9 A;  5LNK e;  4X43 A;  2DMM A;  3A2X A;  2CVB A;  4KSO A;  1TU8 A;  2DJ2 A;  5IMV A;  5G5F A;  1R26 A;  3QOU A;  6GSV A;  1U87 A;  1ERV A;  2WRT A;  1W4V A;  1K0A A;  3HXS A;  4JED A;  4DSQ A;  3H93 A;  2CZ3 A;  4XHM A;  1TU7 A;  2K8V A;  4BL7 A;  3EUR A;  4MH2 A;  2C1Y A;  3DWV A;  1XPV A;  1GUH A;  3H4K A;  4KDY A;  2C80 A;  1HNB A;  1FB6 A;  1XWA A;  2RII A;  2KUC A;  4AGS A;  13GS A;  1Z6M A;  5JCG A;  1HD2 A;  2M46 A;  3GKM A;  3EC3 A;  3TCO A;  3GHA A;  2LUS A;  5A5K A;  2N5A A;  5HR2 A;  1RW1 A;  2YJ7 A;  4V2M A;  3FYG A;  5GSS A;  3QMX A;  3F4S A;  4QL7 A;  1YZX A;  2H19 A;  1O8X A;  1E6B A;  5DJL A;  2WJU A;  1EEM A;  3KEB A;  2GLR A;  2GSS A;  2P5R A;  4BVY A;  4TR0 A;  2BMX A;  2FCH A;  2VCV A;  1TK8 B;  3GKK A;  3FKF A;  1EGR A;  1K0B A;  3KGK A;  1WWJ A;  1YEP A;  5ID2 A;  3Q6O A;  5D9W A;  3E0U A;  3IK9 A;  2H1D A;  3CBU A;  1LJR A;  2IMK A;  1NM3 A;  3A5W A;  4F82 A;  1KNG A;  2FD3 A;  4KCE A;  4LMV A;  1W89 A;  3K8N A;  1GP1 A;  2VUP A;  3F3Q A;  2K18 A;  1ZYE A;  3LSZ A;  1OKD A;  1T7P B;  4Q5R A;  4MAB A;  1SK0 A;  4KCA A;  4LLR A;  3Q18 A;  2CVK A;  1QMV A;  5CNW A;  2H72 A;  5JCU A;  2RUE A;  3VI7 A;  3GKX A;  1VF4 A;  2FWG A;  3D22 A;  4ECJ A;  4KB3 A;  1AIU A;  2CAI A;  1Z5Y E;  2X8G A;  4JE1 A;  2HRN A;  2GT5 A;  3TDG A;  3I69 A;  2YP6 A;  4NXI A;  8GSS A;  1CQG A;  1PSQ A;  1TKD B;  2BJX A;  2ZNM A;  3VLN A;  4FYC A;  4FO5 A;  1X5D A;  4KND A;  1EEJ A;  1HNC A;  1Y25 A;  3VK9 A;  1TRW A;  3KMN A;  2WFC A;  2NPB A;  3GX0 A;  4AJ8 A;  2CZ2 A;  2CQ9 A;  4POK A;  3D5J A;  4JR4 A;  1TTZ A;  5DQY A;  2O89 A;  5E59 A;  2FWF A;  3F3R A;  5FHI A;  1OE7 A;  1KBN A;  2DBC A;  1M9B A;  3IAS 2;  9GSS A;  1M2D A;  1BX9 A;  3KMO A;  2L4Q A;  4BWS A;  5KN1 A;  1GH2 A;  3EYT A;  1QK8 A;  1OYJ A;  3EMP A;  3Q19 A;  3TB2 A;  1GSE A;  1OVN A;  3WD6 A;  1BJX A;  4L5O A;  3RHC A;  3LXT A;  1VF3 A;  2LV3 A;  2DJJ A;  2J23 A;  3U5R E;  2C3N A;  2E7P A;  5J5N A;  4H86 A;  2C0D A;  3F9U A;  5CRW A;  5FWG A;  4OO4 A;  1GNE A;  3V1W A;  4PX1 A;  3CTF A;  2E2M A;  4OFT A;  2RLI A;  3A2V A;  4IJI A;  1GNW A;  1SK2 A;  2MMA A;  3LFL A;  2C4J A;  4NHW A;  2AUV A;  2Z9S A;  2VO4 A;  1T00 A;  1PMT A;  2J9H A;  4GXZ A;  3QAW A;  3HY2 A;  4O92 A;  3S9F A;  3GTU A;  5GST A;  1TP9 A;  1Z6N A;  2XC2 A;  4O5R A;  2GVP A;  1VF1 A;  2MZC A;  2E2G A;  4HOJ A;  1SL2 B;  1ZCP A;  4D73 A;  2LJA A;  1ERW A;  3VFI A;  5ECN B;  1NW2 A;  3P8W A;  4HQZ A;  2REM A;  3HDC A;  3GX8 A;  3IA1 A;  5A4V A;  2JL4 A;  2I3Y A;  4WR4 A;  3F4R A;  1RQM A;  2L59 A;  4X1U A;  4EL1 A;  5LD0 A;  2IMF A;  2GZP A;  2PUK C;  4POL A;  5LCZ A;  5GAN D;  1SYR A;  2LRT A;  3ZVJ D;  4EUY A;  1WIK A;  3ERW A;  1X9M B;  4WF4 A;  3ZIT A;  3KP9 A;  2CT6 A;  2RUF A;  2CAQ A;  1MD3 A;  1B9Y C;  4CHS A;  1YF0 A;  5HR1 A;  3TKP A;  3HZ8 A;  4TOP A;  3ZL5 A;  5KEJ A;  4XRA A;  1YDK A;  2HE3 A;  2VL2 A;  2IWT A;  3GYK A;  4O32 A;  1MEK A;  3AY8 A;  20GS A;  1JZW A;  4F0C A;  3P2A A;  1E2Y A;  1GL8 A;  2FA8 A;  3IR4 A;  2YOI A;  3M0F A;  4I8B A;  2H01 A;  3ME7 A;  1K3O A;  5H5Q A;  2AHE A;  2L4C A;  4Q5N A;  2C8U A;  5ECP B;  3NZN A;  4PGT A;  5HR3 A;  4K0G A;  2ON7 A;  4TXO B;  2MMZ A;  1AXD A;  2RM6 A;  1EZK A;  2DJK A;  4ZB6 A;  3IPZ A;  4N30 A;  3WGD A;  3UBK A;  3CSJ A;  4YAV A;  5COH A;  1V40 A;  1DBY A;  1ERU A;  1VRS D;  2HZE B;  1N8J A;  1V2A A;  2LTK A;  2WB9 A;  3QAV A;  5ELG A;  2I1U A;  1EWX A;  1H75 A;  3FZ4 A;  3FEU A;  2ZCT A;  4NPB A;  4IQ1 A;  4BPY A;  2VCW A;  1GLP A;  3KZQ A;  4K9Z A;  1FB0 A;  3G9B A;  1ON4 A;  2C0F A;  3HYP A;  1FOV A;  2FGX A;  5KN3 A;  2TRX A;  4POB A;  1UN2 A;  1K0D A;  3TKS A;  3MDK A;  3KH9 A;  4F03 A;  1ST9 A;  3CSH A;  2IMD A;  4AJ7 A;  2LQQ A;  1GSY A;  2F51 A;  2VL2 C;  2R2J A;  1EOG A;  3DGQ A;  1R7H A;  3QDN A;  3L4N A;  4N0V A;  5EY6 A;  1T1V A;  1DE2 A;  2C0E A;  2LJR A;  2YZU A;  4GQC A;  5J9C A;  4V1A g;  2YWN A;  5DAL A;  2R37 A;  1OC8 A;  3ISO A;  3M3M A;  2H1G A;  1F6M C;  3EU3 A;  1HNA A;  1SJ6 A;  2IIY A;  4LL1 B;  2I9H A;  5CRE A;  3TJB A;  1AUC A;  1XVQ A;  1BAY A;  1YEX A;  5IOX A;  1QUW A;  2OAC A;  3QFA C;  5JWR B;  5GAP D;  1JLW A;  5ECM B;  4G10 A;  4K7I A;  1ZGN A;  4EE0 A;  5J4U A;  3ZRE A;  3FR9 A;  4ZB9 A;  5AIS A;  4K8M A;  1G7E A;  1MTC A;  5IMF A;  2VCQ A;  4NAX A;  4E8H A;  4MPG A;  1SJI A;  5CYY A;  5ECL B;  2N5F A;  5INY A;  4I6X A;  1G6W A;  2B5E A;  1BG5 A;  5B8B A;  1TJD A;  3ZIJ A;  3TKS C;  3ZRD A;  2LRN A;  16GS A;  1VGL A;  3F6D A;  3A3T A;  3GH9 A;  2O8V B;  3VWV A;  2LQO A;  5HR0 A;  2JZT A;  4KDU A;  3QR6 A;  3UBL A;  3FHK A;  3PIN A;  3RDW A;  1GSQ A;  4PQH A;  1M7T A;  4ECC A;  5ECH B;  2DJ3 A;  2X8C A;  5AN1 A;  1F9M A;  4DSR A;  2OE1 A;  2NTO A;  2L57 A;  3O76 A;  3DYR A;  2L5L A;  4JBB A;  4FYU A;  5DAK A;  5KN0 A;  2AYT A;  2H70 A;  4WBR D;  2LRC A;  2GZZ A;  4KUN A;  1U3I A;  4PUF C;  4FH8 A;  2YCD A;  1YKC A;  5F05 A;  3NOF A;  2H0G A;  4IP1 A;  4ZIJ A;  1A0F A;  1B9X C;  1GSS A;  2LKU A;  1C72 A;  1RK4 A;  3C1S A;  4HDE A;  5ECR B;  4IBP A;  1PA3 A;  1JZR A;  1HYU A;  3TRX A;  5ID2 B;  3GUS A;  1ERT A;  2GQM A;  3QFB C;  1WMJ A;  3QCP A;  3C8E A;  6GSW A;  4NWY A;  3G7I A;  1M2B A;  3N5O A;  5B6N A;  1XZO A;  1GWC A;  3VPQ A;  1R5P A;  4GSN A;  1XW9 A;  3FZ5 A;  2LS5 A;  2A2R A;  3CMI A;  4XCS A;  3G7Y A;  5CAX A;  3ZMK A;  2P31 A;  4OO5 A;  4NV5 A;  2X99 A;  5EPF A;  3P90 A;  2V6K A;  1I5G A;  1V57 A;  1G6Y A;  4GSS A;  3ERF A;  4BA7 A;  4PNG A;  4ECB A;  2VL9 A;  5IMC A;  5AGY A;  1A24 A;  1ZYQ B;  4PNF A;  5ECO B;  1GTU A;  4WEY A;  1T8E B;  2IL3 A;  1XWG A;  1ACV A;  3HHV A;  4PUA A;  5DDL A;  1MD4 A;  1Y6E A;  3ME8 A;  2HSY A;  4K1F A;  4KGI A;  2YNX A;  3GIX A;  1PRX A;  1S3D A;  4MZC A;  3PR8 A;  3KXO A;  4KAE A;  4QL9 A;  1ZMA A;  2VD1 A;  1OC3 A;  4GCI A;  4XS4 A;  1T4Z A;  3CRU A;  2FNO A;  5DQS A;  4TW5 A;  3IXR A;  2BTO T;  1O8W A;  1DSB A;  3RBT A;  1F3A A;  3TRP A;  1OC9 A;  4EVM A;  1PQN A;  4MH3 A;  4MZW A;  3J7Y k;  4WF5 A;  1PL2 A;  2H73 A;  1A2M A;  1S3A A;  17GS A;  2LEG A;  1SYX A;  4ZBB A;  4L8E A;  3HVV A;  2ON5 A;  1AQV A;  3IHQ A;  2MMO A;  3FZ9 A;  3VPT A;  4V2N A;  4MMM A;  4TN8 A;  3O6T A;  2PN8 A;  1MDI A;  4OCE A;  4KE3 A;  4YQU A;  3VWX A;  4IW9 A;  1WOU A;  2H30 A;  2VLV A;  3M8N A;  2H71 A;  2IN3 A;  3EVI A;  4I97 A;  2YAN A;  3ZFL A;  4EF0 A;  2F8A A;  2WGR A;  5CRG A;  5ENU A;  5C00 A;  1FW1 A;  2H66 A;  1MDJ A;  4HZ2 A;  3IRA A;  1WP0 A;  1B4Q A;  3KM6 A;  3IK7 A;  4IVF A;  2XBI A;  1HQO A;  5HFI A;  4MJE A;  1K0N A;  4ZBA A;  2VL3 A;  2YWO A;  3TJF A;  4ZL8 A;  2DIY A;  4YAP A;  2G0F A;  2OE3 A;  3EIN A;  3FR6 A;  4EC0 A;  5F8B A;  1WJK A;  1DUG A;  1Z7R A;  3W8J A;  3FRC A;  5G1L A;  3WT1 A;  1URM A;  5DVB A;  3MSZ A;  2QKE A;  2GQL A;  1ML6 A;  4TR1 A;  2N5B A;  4ZL9 A;  2IFQ A;  3GKN A;  2XPE A;  4MJA A;  1WRY A;  4K0N A;  2PGT A;  4OD7 A;  5J3R A;  3VWW A;  3TJG A;  4Q5F A;  4K7N A;  2PVQ A;  1Z9H A;  3FY7 A;  3BBY A;  1UA5 A;  3DML A;  3ZYW A;  4G2E A;  4MPF A;  1FAA A;  3IDV A;  1PKW A;  1O81 A;  2OJL A;  2HRF A;  4ZL7 A;  1SL0 B;  2V41 A;  5G1K A;  5IM9 A;  2YZH A;  1PN9 A;  1KTE A;  2YV9 A;  2HSH A;  1F2E A;  1M9A A;  1XCC A;  3GSS A;  3GST A;  4IP6 A;  4IKH A;  1A0R P;  2B1L A;  3J7Y b;  4HI7 A;  2OE0 A;  1GTI A;  12GS A;  4GF0 A;  1CQH A;  3KH7 A;  5DBQ A;  2V32 A;  2HYX A;  2FY6 A;  5GZZ B;  2R6K A;  3D21 A;  1X9S B;  2JU5 A;  3EWL A;  4WET A;  5HFK A;  3IBH A;  2KHP A;  2B7K A;  5IMD A;  2X8H A;  2RM5 A;  4ULX A;  1XBS A;  1DE1 A;  1USB A;  5G30 A;  2TIR A;  1QXH A;  4N10 A;  4KX4 A;  3EMX A;  1SKS B;  1TOF A;  2O7K A;  4DSS A;  3M9J A;  4DVC A;  3TUE A;  1K0M A;  3UVT A;  3KCM A;  1A2J A;  3GUR A;  1Z7P A;  2CX4 A;  3DXB A;  2JZS A;  4HJ2 A;  4XIH A;  5DAL B;  3QPM A;  3ZZX A;  1JLV A;  1PKZ A;  2I81 A;  4ZXG A;  2B5X A;  3VI5 A;  3GNJ A;  2O85 A;  5C04 A;  5ECS A;  1EV9 A;  2F3M A;  4MP4 A;  2CA8 A;  1LBK A;  5EL8 A;  1FVK A;  4J2F A;  3HVX A;  5DCG A;  2H1B A;  4YQM A;  2H75 A;  2PER A;  3DD3 A;  6GSY A;  4FIW A;  2VCZ A;  1PGT A;  3MAK A;  2CVD A;  1SJZ A;  3MWH A;  4NV2 A;  2NDO A;  1TK0 B;  4HUA A;  1B48 A;  3F4T A;  3LOR A;  3ERG A;  1XIY A;  1JZD A;  1O6J A;  5A4W A;  4BWQ A;  2GTU A;  4XTS A;  1AW9 A;  2VLU A;  2GSQ A;  1M2A A;  4RUV A;  3BD2 A;  2VD0 A;  2LJK A;  4O7H A;  1FHE A;  5F07 A;  1XFL A;  3Q74 A;  3TOU A;  4DEJ A;  2G2Q A;  5AIX A;  3WT2 A;  3SWL A;  1I9D A;  2L5O A;  4KW6 A;  4KH7 A;  2KP1 A;  5JWQ B;  1V98 A;  4KDX A;  3TKS E;  1TRV A;  2EIO A;  1TW9 A;  1S3C A;  1FG4 A;  3GH6 A;  4GLT A;  2ALB A; 
#chains in the Genus database with same CATH topology
 2KOK A;  1IYI A;  4K5S A;  2EG5 A;  5DAK B;  1A23 A;  2HFD A;  2JAC A;  4ZIL A;  1GTB A;  2OKA A;  3M1G A;  1XWC A;  4P3Y B;  1QQ2 A;  1XWB A;  6GST A;  1IMP A;  3OR5 A;  2A2P A;  1AUM A;  4IEL A;  1PX6 A;  7CEI A;  4J57 E;  3LQ7 A;  3OW2 O;  1AC1 A;  3IC4 A;  3RG2 A;  5E4W A;  1ZZY A;  4UHP B;  3UMA A;  3G4S P;  4RI6 A;  2KGA A;  4J56 E;  5IO2 A;  2DJ1 A;  3D4T A;  1XW5 A;  2MMN A;  3HZ4 A;  4WR5 A;  3ZIV A;  5IO0 A;  5A4U A;  1UJZ A;  1IYH A;  1G7O A;  2F8F A;  1NHY A;  2EIQ A;  2IPA A;  2IME A;  4TR3 A;  2Z44 A;  3EE2 A;  5AIV A;  2A4V A;  3LJR A;  3UAP A;  2L6D A;  1M0U A;  3D4M A;  4RQR A;  4EDZ A;  3KTL A;  5FT3 A;  1TRS A;  4LMW A;  1GUL A;  3BCI A;  4I5Q A;  3LYK A;  2YWM A;  4HSC X;  1EP7 A;  4DG9 A;  1QGV A;  4WXT A;  5D9T A;  3IE3 A;  2PEK A;  1SK1 A;  5BS2 A;  2C0G A;  1SD8 A;  4CY8 A;  4TRX A;  3EU4 A;  2KOR A;  4HZ4 A;  4CW9 A;  3DEX A;  4MJC A;  1PD2 1;  1X0R A;  3ED3 A;  2EC4 A;  4IQA A;  2H6Z A;  2JAD A;  1BED A;  3GFK A;  3DIE A;  3UIW A;  3HVS A;  2GZI A;  1K3L A;  3WGX A;  4I2T A;  2H0I A;  3CTG A;  4MJB A;  4IZ6 A;  2M8L A;  2YWI A;  3PH9 A;  6GSS A;  1D1D A;  1O73 A;  1VQ5 P;  1XOA A;  3KTB A;  3C71 A;  4BVY B;  1Q98 A;  3C7M A;  3RPP A;  3QD9 A;  2M80 A;  1UC7 A;  3C73 A;  2WPT A;  2HSM A;  3F8U A;  1AQW A;  2R5G A;  1ZOF A;  4YQV A;  3UOM A;  2HXK A;  3UL3 A;  1Q4J A;  5D93 A;  4L0W A;  4IN0 A;  4F9Z A;  2AF8 A;  1X9W B;  1TK5 B;  2L22 A;  5IMZ A;  4MK3 A;  1ABA A;  4IHU A;  4K5R A;  3ZML A;  1GSU A;  2B6M A;  4XS4 B;  3CCR P;  3UAR A;  3U43 A;  3TKQ A;  2JSY A;  4GQF A;  1M6N A;  1YHQ P;  2K8S A;  2PWJ A;  1SL1 B;  1GPJ A;  3BOA A;  1OC9 B;  4KSM A;  14GS A;  11GS A;  4K2D A;  3DRN A;  4EDY A;  3F0I A;  4F2I A;  2GST A;  2PPT A;  1M99 A;  3HCZ A;  1X5E A;  3LG6 A;  4JU5 A;  2B3S A;  4XRD A;  2HI7 A;  2LST A;  1TDI A;  4IS0 A;  4CDO A;  2AVA A;  5ECK B;  2DNW A;  3HZQ A;  1GRX A;  5CRH A;  2CGQ A;  1XXU A;  5ABR A;  2K9F A;  2MD9 A;  4PQ1 A;  2XHF A;  5G31 A;  3I55 P;  2OBK A;  3WGE A;  4EXJ A;  4OCF A;  4MZB A;  2PBJ A;  3TKR A;  4PUR A;  2H0H A;  1XVW A;  1SKW B;  1U3A A;  1EOH A;  2NVL A;  2O87 A;  2LIU A;  1EP8 A;  1BAJ A;  3F6F A;  3BCK A;  2HRA A;  3UVH A;  2MVU A;  3LWA A;  3NTE A;  2GT6 A;  3HKR A;  1N8R Q;  2MR7 A;  4HEA 2;  2EIR A;  2ZUP A;  4ZBD A;  3G7J A;  2GDW A;  2GZY A;  2JSZ A;  1PX7 A;  5IMA A;  3SBC A;  2AFE A;  2CX3 A;  2X64 A;  2AV4 A;  5F2K A;  1YKA A;  4XS1 A;  5HGO A;  4WBJ A;  3MNG A;  2NO8 A;  3ZTL A;  4F0B A;  5IPG A;  1VQ9 P;  2KG9 A;  1KEB A;  2KOD A;  1QFN A;  2LKI A;  1U88 A;  2IJY A;  1GTA A;  1SD9 A;  3VRL C;  4O5Q A;  1PL1 A;  1E0H A;  3WYW A;  4BVX A;  10GS A;  4GRF A;  4MF6 A;  2DML A;  2JYG A;  1AAZ A;  2H74 A;  4ISD A;  4TR1 B;  1KC8 Q;  3GTU B;  1VHN A;  5ECQ B;  2IFQ B;  2F9S A;  1XWK A;  3RPN A;  1VQ7 P;  2VOC A;  2H1A A;  2M8N A;  3IV4 A;  3ZFB A;  3VUR A;  5HVC A;  3I6A A;  5KN2 A;  4D73 B;  3GA4 A;  1ILO A;  4MA9 A;  4RQX A;  4ID0 A;  5EVO A;  3ZVJ A;  3H47 A;  3RHB A;  4YH2 A;  4N11 A;  1JFU A;  1ZL9 A;  4ACS A;  1KQS O;  3CCJ P;  1GUM A;  4JZQ A;  3APO A;  4HS1 A;  3NIV A;  2M72 A;  1J08 A;  1OKT A;  4JR6 A;  2HT9 A;  1XOB A;  1XW6 A;  5H5S A;  2YN1 A;  1O85 A;  2QSI A;  4GTU A;  2OBI A;  3HJO A;  4E8E A;  2LNS A;  2CV4 A;  4V1A p;  1SEN A;  5CP1 A;  1VQM P;  1TRU A;  1H4O A;  1B8X A;  4JRR A;  3H4E A;  4IJ3 A;  18GS A;  2DIZ A;  1BYE A;  1FO5 A;  2WZ9 A;  2GGT A;  3A2W A;  2GDR A;  3KD0 A;  1U6T A;  1A8O A;  2FAD A;  2LNT A;  2FUG 2;  2MBS A;  3P7X A;  4PXH B;  4V2L A;  3GL5 A;  4PQI A;  3KJY A;  3APS A;  2PEN A;  2YJH A;  2JB0 A;  1G0T A;  3IOS A;  1A2L A;  1M1K Q;  1V9W A;  2FWH A;  1UNK A;  2K6V A;  2XPD A;  4DSS B;  5KOX A;  3DVX A;  2FHE A;  2B7J A;  4ZB8 A;  3O3T A;  3CRT A;  3KP8 A;  1YQ1 A;  2DSA A;  5G2Z A;  2VM1 A;  3TJK A;  3I56 P;  1GSF A;  2K0Y A;  4FYB A;  2JU1 A;  2YV7 A;  1MDK A;  1K0O A;  4ML6 A;  3IAM 2;  1OE8 A;  2IMI A;  2H6Y A;  2VCX A;  4NHZ A;  5D9X A;  2HZF A;  3L78 A;  5H5R A;  4IGJ A;  2H8L A;  1Z3E A;  3TGZ A;  3CSI A;  4GWR A;  5HQP A;  2X4A A;  1TXX A;  1T4Y A;  1UVZ A;  1GUK A;  1GLQ A;  2FWE A;  4Z7X A;  3M9K A;  5CRD A;  2AJQ B;  4TVE A;  4G19 A;  2MBT A;  2DLX A;  1YF1 A;  1Q81 Q;  1EV4 A;  4HKG A;  2H6X A;  4ECI A;  4USS A;  2LPK A;  2HLS A;  5F0G A;  4HQS A;  3TJJ A;  3LXZ A;  7GSS A;  3DKS A;  2I4A A;  2B1K A;  1T3B A;  3L9S A;  1J9B A;  3CXG A;  5D73 A;  2XBQ A;  2R0G A;  2GQK A;  3E9J B;  2YPM A;  3I43 A;  2MYG A;  2AB6 A;  1EOQ A;  3TOT A;  4COC A;  4N0Z A;  3H8Q A;  1NSW A;  1AQX A;  5F2O A;  2PMT A;  1YJW P;  2V2G A;  5HGL A;  4MF7 A;  1RO2 A;  1F80 D;  2JU2 A;  4XFY A;  2R0P A;  3C1R A;  1JZO A;  2TRC P;  3DS5 A;  1K0C A;  3HJP A;  2WUL A;  1K9M Q;  4POM A;  3DS2 A;  5IPH A;  3W8S A;  4QKO A;  2VIM A;  5CZD B;  4PXO A;  4XS6 A;  3H1N A;  2Z45 A;  1GSD A;  4MF5 A;  2L6C A;  4LL4 B;  2GS3 A;  4EKZ A;  3PGT A;  3GV1 A;  2JYL A;  3GMF A;  2KP2 A;  3R2Q A;  2E0Q A;  4L0U A;  1JHB A;  2H76 A;  2C3Q A;  5EW5 E;  5J41 A;  2WS2 A;  1YJ6 A;  1BQ7 A;  3FW2 A;  3LW9 A;  2M8P A;  5ELA A;  4AF2 A;  1A8L A;  1VQK P;  1R5A A;  4TR4 A;  5B6M A;  3W6G A;  1FR2 A;  3FR3 A;  3N9J A;  1O7U A;  4MLY A;  1B4P A;  3US3 A;  1WPI A;  4I2U A;  1KLP A;  1FVJ A;  1IMQ A;  3L0H A;  1V58 A;  2P5Q A;  5B7C A;  5ECI B;  2K93 A;  3TRQ A;  2HNL A;  4OFN A;  4AJ6 A;  3LGC A;  3LMO A;  1OAZ A;  4TXV A;  5B8A A;  5IIZ A;  1THX A;  4OWY A;  2QNW A;  2ES7 A;  1A8Y A;  4QQ7 A;  1VF2 A;  3Q20 A;  3I9V 2;  2OTJ P;  1VKU A;  4HU9 A;  3LYP A;  5JCW A;  2B5Y A;  2NBS A;  5D8I A;  4MRT C;  2V1M A;  4K2X A;  4KA0 A;  5L71 A;  5BS1 A;  4WKW A;  4COP A;  3RG6 C;  3FK8 A;  1Q86 Q;  5DCH A;  2R3X A;  3G21 A;  3UEM A;  2DC5 A;  4RI7 A;  2C3T A;  1SKR B;  4K7O A;  4HJM A;  3FZA A;  3E3E A;  4GLT A;  4HU7 A;  2KLX A;  5D9V A;  1EGO A;  2WDU A;  5F06 A;  3BJ5 A;  3LEF A;  3ZLP A;  4TXO A;  2K2Q A;  2BHV A;  1KD1 Q;  3CC7 P;  2D2Z A;  2FLS A;  2PVO C;  3RAZ A;  5HFG A;  3CCQ P;  3KIJ A;  2VCT A;  2FQ0 A;  4OMV A;  2A2S A;  3U6V A;  1NHO A;  5J9B A;  2EHT A;  2HZE A;  5JWO B;  4M0I A;  4G9H A;  3QAG A;  4ILF A;  19GS A;  3D6I A;  2AAW A;  3L9V A;  4BIK A;  5IOW A;  1J0F A;  1VQ6 P;  3H79 A;  4XRO A;  4EO3 A;  3JCM L;  5D96 A;  3GL3 A;  2PU9 C;  2KOQ A;  2GSR A;  2PEI A;  2ROQ A;  1LU4 A;  2OA7 A;  3CME P;  2VLT A;  3UJ1 A;  2DJ0 A;  4L5L A;  3D0Z A;  5IQY A;  1N2A A;  2WCI A;  3F63 A;  1RO0 A;  5KP7 B;  1X5C A;  1WE0 A;  2JZR A;  5CO3 A;  3VWU A;  4X0X A;  3APQ A;  6GSU A;  2MVV A;  1F37 A;  5DJM A;  4K6X A;  3GN3 A;  3HJM A;  4GST A;  3L9U A;  1TI1 A;  2FA4 A;  22GS A;  3CYN A;  4NMU A;  1R4W A;  1M6E X;  6GSX A;  2QGV A;  2P0G A;  2VM2 A;  1YY7 A;  2OAD A;  3GRX A;  2CNR A;  2VAF A;  4OFM A;  5G5E A;  2V6O A;  4TKY A;  4MCU A;  2QC7 A;  4LA1 A;  3B5I A;  1THO A;  1M74 A;  4MDC A;  4ML1 A;  3GKL C;  3DVW A;  4Q5Q A;  3HD5 A;  1K3Y A;  2R4V A;  1F3B A;  2GZE A;  1TI3 A;  3HA9 A;  5LNK e;  3CCE P;  4X43 A;  2DMM A;  3A2X A;  2CVB A;  4KSO A;  4CY6 A;  1TU8 A;  2DJ2 A;  5IMV A;  5G5F A;  1R26 A;  2Z46 A;  3QOU A;  6GSV A;  1U87 A;  3G6E P;  1ERV A;  2WRT A;  1W4V A;  1T8K A;  1K0A A;  3HXS A;  4JED A;  4DSQ A;  3H93 A;  2LIW A;  3CCU P;  2CZ3 A;  2KR5 A;  4XHM A;  1TU7 A;  2KW2 A;  2K8V A;  1S3R A;  4BL7 A;  3EUR A;  4MH2 A;  4U0F A;  2C1Y A;  3DWV A;  1XPV A;  1GUH A;  3H4K A;  2LF4 A;  1FOH A;  4BVX B;  4KDY A;  2C80 A;  2XT1 A;  1HNB A;  1FB6 A;  1XWA A;  2RII A;  2KUC A;  4AGS A;  2PEJ A;  4A5P A;  1YIT P;  13GS A;  1Z6M A;  5JCG A;  1HD2 A;  2M46 A;  3GKM A;  3EC3 A;  3TCO A;  3GHA A;  2LUS A;  2KGD A;  5A5K A;  2N5A A;  2GDX A;  5HR2 A;  1RW1 A;  2YJ7 A;  1OR5 A;  4V2M A;  3DS3 A;  3FYG A;  5HV8 A;  5GSS A;  3QMX A;  3F4S A;  4QL7 A;  1YZX A;  2H19 A;  1O8X A;  1E6B A;  5DJL A;  2WJU A;  1Q7Y Q;  1EEM A;  3KEB A;  2GLR A;  2GSS A;  2P5R A;  4BVY A;  4TR0 A;  2BMX A;  2FCH A;  2VCV A;  1TK8 B;  3GKK A;  3FKF A;  1EGR A;  1M3I A;  2L9F A;  1HQB A;  1K0B A;  1ZYN A;  3KGK A;  1WWJ A;  1YEP A;  5ID2 A;  3Q6O A;  3G29 A;  5D9W A;  3E0U A;  3IK9 A;  2H1D A;  3CBU A;  1LJR A;  3EJE A;  2IMK A;  1NM3 A;  3A5W A;  4F82 A;  1KNG A;  2FD3 A;  4KCE A;  4LMV A;  1W89 A;  3K8N A;  1GP1 A;  2VUP A;  3F3Q A;  2K18 A;  1ZYE A;  3LSZ A;  1OKD A;  1T7P B;  1GXG A;  4Q5R A;  4MAB A;  1SK0 A;  4KCA A;  4LLR A;  2MF4 A;  2CVK A;  3Q18 A;  3DTJ A;  1QMV A;  5CNW A;  2H72 A;  5JCU A;  2RUE A;  3VI7 A;  3GKX A;  3DS0 A;  1VF4 A;  2FWG A;  3D22 A;  4ECJ A;  4KB3 A;  1AIU A;  1ACP A;  2CAI A;  1Z5Y E;  2X8G A;  4JE1 A;  2HRN A;  2GT5 A;  3TDG A;  3I69 A;  2YP6 A;  4NXI A;  3EJB A;  8GSS A;  1CQG A;  1PSQ A;  2EHS A;  1TKD B;  2BJX A;  2ZNM A;  3VLN A;  4FYC A;  4FO5 A;  1X5D A;  4KND A;  1EEJ A;  1HNC A;  1Y25 A;  3VK9 A;  1TRW A;  3KMN A;  2WFC A;  2NPB A;  3GX0 A;  4AJ8 A;  2CZ2 A;  2CQ9 A;  1M90 Q;  4POK A;  3D5J A;  4JR4 A;  1TTZ A;  5DQY A;  2KGC A;  2O89 A;  3CCL P;  5E59 A;  2FWF A;  3F3R A;  5I4T G;  5FHI A;  1OE7 A;  5JPA A;  1K8A Q;  2LOL A;  1KBN A;  2DBC A;  1M9B A;  3IAS 2;  9GSS A;  2VLO A;  1M2D A;  1BX9 A;  3KMO A;  2L4Q A;  4BWS A;  5KN1 A;  3EJD A;  1GH2 A;  3EYT A;  1QK8 A;  2FVF A;  2EFJ A;  1OYJ A;  3EMP A;  3Q19 A;  3TB2 A;  1GSE A;  4U0A A;  1OVN A;  3M1M A;  3WD6 A;  4L5O A;  1BJX A;  4MNN A;  2LTE A;  3RHC A;  3LXT A;  1VF3 A;  2LV3 A;  2DJJ A;  2J23 A;  3GJN A;  3U5R E;  2C3N A;  2E7P A;  3NY7 B;  5J5N A;  4H86 A;  2C0D A;  3F9U A;  2KGE A;  5CRW A;  5FWG A;  4OO4 A;  1GNE A;  4FQU A;  2KG6 A;  3V1W A;  2XZ0 D;  4PX1 A;  3CTF A;  4Z2U A;  2E2M A;  4OFT A;  2RLI A;  3A2V A;  4IJI A;  1GNW A;  1SK2 A;  1RNI A;  1VQO P;  2MMA A;  3LFL A;  2C4J A;  4NHW A;  2AUV A;  2Z9S A;  2P9X A;  2JO0 A;  1T00 A;  2VO4 A;  1PMT A;  2J9H A;  4GXZ A;  3QAW A;  3HY2 A;  4O92 A;  3S9F A;  4PH0 A;  3GTU A;  5GST A;  1YJ9 P;  1TP9 A;  1Z6N A;  2XC2 A;  4O5R A;  2GVP A;  1VF1 A;  2MZC A;  2E2G A;  4HOJ A;  1SL2 B;  1ZCP A;  4D73 A;  2LJA A;  1ERW A;  3VFI A;  5ECN B;  1NW2 A;  3P8W A;  4HQZ A;  2REM A;  3HDC A;  3GX8 A;  4CA3 A;  3IA1 A;  4U0E A;  5A4V A;  2K0D X;  2JL4 A;  2I3Y A;  4F37 A;  4WR4 A;  3DS4 A;  1RQM A;  3F4R A;  2L59 A;  4X1U A;  2A4H A;  2FQ2 A;  4PWV B;  4EL1 A;  5LD0 A;  2IMF A;  2GZP A;  2PUK C;  4POL A;  5LCZ A;  4O5U A;  5GAN D;  1VQP P;  1SYR A;  2LRT A;  3ZVJ D;  4EUY A;  2K5X A;  1WIK A;  3CQF A;  3ERW A;  1X9M B;  4WF4 A;  3ZIT A;  2GZG A;  3KP9 A;  1VQL P;  2CT6 A;  2RUF A;  2CAQ A;  2UZ8 A;  5KOW A;  1MD3 A;  1B9Y C;  4CHS A;  1DV5 A;  1YF0 A;  5HR1 A;  3TKP A;  3HZ8 A;  4TOP A;  3ZL5 A;  5KEJ A;  3G1G A;  4XRA A;  1YDK A;  2HE3 A;  2VL2 A;  2IWT A;  3GYK A;  2FHS C;  4O32 A;  1MEK A;  2VSQ A;  3AY8 A;  20GS A;  1JZW A;  4F0C A;  3P2A A;  1E2Y A;  1GL8 A;  2XXM A;  2FA8 A;  3IR4 A;  2X49 A;  2YOI A;  1DNY A;  2KOS A;  3M0F A;  4I8B A;  2H01 A;  3ME7 A;  1K3O A;  2CG5 B;  5H5Q A;  2BUO A;  3WBH A;  2AHE A;  1ZMB A;  2L4C A;  1W2B O;  4Q5N A;  2C8U A;  5ECP B;  4PTS A;  3NZN A;  4PGT A;  5HR3 A;  4K0G A;  2ON7 A;  4TXO B;  2KOO A;  2L4B A;  2MMZ A;  1AXD A;  2RM6 A;  1EZK A;  2DJK A;  4ZB6 A;  3IPZ A;  4N30 A;  3WGD A;  3UBK A;  1NJI Q;  4XFX A;  3CSJ A;  1JJ2 O;  5COH A;  1V40 A;  4YAV A;  4U0B A;  1DBY A;  1ERU A;  1VRS D;  2HZE B;  1N8J A;  1V2A A;  2LTK A;  2WB9 A;  3QAV A;  5ELG A;  2I1U A;  1EWX A;  1H75 A;  3FZ4 A;  3FEU A;  4Z2R A;  2ZCT A;  4NPB A;  2DKH A;  4IQ1 A;  2KOP A;  4BPY A;  5KP8 B;  2VCW A;  1XG8 A;  1GLP A;  3KZQ A;  4K9Z A;  1FB0 A;  3G9B A;  1L0I A;  1ON4 A;  2C0F A;  3HYP A;  4ICY A;  1FOV A;  2FGX A;  5KN3 A;  2TRX A;  2FAC A;  4POB A;  1UN2 A;  1K0D A;  3TKS A;  3MDK A;  3KH9 A;  4F03 A;  1ST9 A;  3CSH A;  2IMD A;  4AJ7 A;  2LQQ A;  1GSY A;  2F51 A;  2VL2 C;  2R2J A;  2FVE A;  1EOG A;  3MGE A;  3DGQ A;  1R7H A;  3QDN A;  3L4N A;  4N0V A;  4NEO A;  5EY6 A;  1T1V A;  1DE2 A;  4U0C A;  2C0E A;  2GDY A;  3LRY A;  2LJR A;  2YZU A;  4GQC A;  4V1A g;  5J9C A;  2YWN A;  5DAL A;  2R37 A;  2JAZ A;  1OC8 A;  3ISO A;  3M3M A;  2H1G A;  1F6M C;  3EU3 A;  1HNA A;  1SJ6 A;  2IIY A;  4LL1 B;  2I9H A;  5CRE A;  3TJB A;  1AUC A;  2QA1 A;  1XVQ A;  1BAY A;  1YEX A;  3DS1 A;  5IOX A;  4H2X C;  1QUW A;  3FMW A;  5BRT A;  2OAC A;  3QFA C;  5JWR B;  2OAR A;  5GAP D;  1JLW A;  3IC8 A;  5ECM B;  4G10 A;  4K7I A;  1ZGN A;  4EE0 A;  5J4U A;  3ZRE A;  3FR9 A;  3CC4 P;  4ZB9 A;  5AIS A;  3G1I A;  4K8M A;  1G7E A;  1MTC A;  5IMF A;  1L0H A;  4EIP A;  2VCQ A;  4NAX A;  3CCM P;  2N6Z A;  4E8H A;  3H0D A;  4MPG A;  1SJI A;  5CYY A;  5ECL B;  2N5F A;  4G0I A;  5INY A;  4G0L A;  4I6X A;  1G6W A;  2B5E A;  1BG5 A;  5B8B A;  1TJD A;  3ZIJ A;  3TKS C;  3ZRD A;  2LRN A;  2PY8 A;  16GS A;  1VGL A;  3F6D A;  4BL7 B;  3A3T A;  3GH9 A;  5HGM A;  2M5R A;  2O8V B;  3VWV A;  2LQO A;  2FAE A;  5HR0 A;  3MIX A;  2JZT A;  4KDU A;  3QR6 A;  3UBL A;  3FHK A;  1YI2 P;  3PIN A;  3RDW A;  1GSQ A;  4PQH A;  1M7T A;  4ECC A;  3G28 A;  5ECH B;  4KF9 A;  2DJ3 A;  2X8C A;  5AN1 A;  1F9M A;  2L6E A;  4DSR A;  2OE1 A;  2NTO A;  1BXI A;  2L57 A;  3O76 A;  2VLN A;  3DYR A;  2L5L A;  4JBB A;  4FYU A;  5DAK A;  5KN0 A;  2AYT A;  2H70 A;  4WBR D;  2LRC A;  3CXC O;  3G0V A;  3CCS P;  2GZZ A;  4KUN A;  4BPG A;  1U3I A;  1PN0 A;  4PUF C;  4FH8 A;  2GZJ A;  2YCD A;  1YKC A;  5F05 A;  3NOF A;  2H0G A;  4IP1 A;  1VQ4 P;  4ZIJ A;  1A0F A;  1B9X C;  1GSS A;  2LKU A;  1C72 A;  1RK4 A;  3C1S A;  1M3J A;  4HDE A;  5ECR B;  4IBP A;  1PA3 A;  2PEQ A;  1JZR A;  1HYU A;  3TRX A;  2JQ4 A;  1AYI A;  4G0K A;  5ID2 B;  3GUS A;  2GQM A;  1ERT A;  2VLP A;  3QFB C;  3G26 A;  1WMJ A;  3QCP A;  2QEX P;  3C8E A;  6GSW A;  4NWY A;  3G7I A;  1M2B A;  1K30 A;  3N5O A;  3CMA P;  5B6N A;  1XZO A;  1GWC A;  3VPQ A;  1R5P A;  4GSN A;  4EIQ A;  3DPH A;  1YIJ P;  3CE7 A;  1XW9 A;  3FZ5 A;  2LS5 A;  2A2R A;  3CMI A;  4XCS A;  3G7Y A;  3MYD A;  3ZMK A;  5CAX A;  2P31 A;  2E1M A;  4OO5 A;  4NV5 A;  2X99 A;  5EPF A;  3P90 A;  2V6K A;  1I5G A;  1V57 A;  1G6Y A;  4GSS A;  2PNG A;  3ERF A;  4BA7 A;  4PNG A;  4ECB A;  2VL9 A;  5IMC A;  5AGY A;  1A24 A;  1ZYQ B;  4PNF A;  5ECO B;  1GTU A;  3E2D A;  4WYM A;  4WEY A;  1T8E B;  2IL3 A;  1XWG A;  1ACV A;  3HHV A;  4PUA A;  5DDL A;  1MD4 A;  1Y6E A;  3ME8 A;  2PEM A;  2HSY A;  4K1F A;  4KGI A;  2YNX A;  2OTL P;  3GIX A;  1PRX A;  2X2B A;  1S3D A;  4MZC A;  3PR8 A;  3KXO A;  2JBG A;  4KAE A;  4QL9 A;  1ZMA A;  2VD1 A;  1OC3 A;  4GCI A;  4XS4 A;  2XV6 A;  1T4Z A;  3CRU A;  2FNO A;  5DQS A;  4TW5 A;  4QNB A;  3IXR A;  2BTO T;  1O8W A;  1DSB A;  1IUQ A;  3RBT A;  1F3A A;  3TRP A;  1OC9 A;  4EVM A;  1PQN A;  4MH3 A;  4MZW A;  3J7Y k;  4WF5 A;  4BPF A;  1PL2 A;  2H73 A;  1A2M A;  1S3A A;  17GS A;  2LEG A;  1SYX A;  4ZBB A;  2MR8 A;  4L8E A;  3HVN A;  3EPT A;  3HVV A;  2ON5 A;  2LL8 A;  1AQV A;  3IHQ A;  1GXH A;  1YJN P;  2MMO A;  1AF8 A;  2CQ8 A;  3FZ9 A;  3VPT A;  4V2N A;  4MMM A;  3G71 P;  4TN8 A;  3O6T A;  2PN8 A;  1MDI A;  4OCE A;  4KE3 A;  4YQU A;  3VWX A;  4IW9 A;  2MY5 A;  1WOU A;  2H30 A;  2VLV A;  5F2N A;  2N5H A;  1S72 P;  2CWO A;  1E6J P;  3M8N A;  2H71 A;  2IN3 A;  3EVI A;  4I97 A;  2YAN A;  3ZFL A;  4EF0 A;  3PPU A;  2F8A A;  2WGR A;  5CRG A;  5ENU A;  5C00 A;  1FW1 A;  2H66 A;  1MDJ A;  4HZ2 A;  3IRA A;  1WP0 A;  1B4Q A;  3KM6 A;  3IK7 A;  4IVF A;  2XBI A;  3CCV P;  1X3O A;  1HQO A;  2DKI A;  5HFI A;  1A43 A;  1CEI A;  1QVF O;  4MJE A;  2DGY A;  1K0N A;  4ZBA A;  2VL3 A;  2YWO A;  3TJF A;  2L0Q A;  4H2W C;  4ZL8 A;  2DIY A;  4YAP A;  2G0F A;  2OE3 A;  3EIN A;  4Z2T A;  3FR6 A;  4EC0 A;  5F8B A;  1WJK A;  1DUG A;  3IHG A;  2K94 A;  1Z7R A;  3W8J A;  3FRC A;  5G1L A;  3WT1 A;  1URM A;  1Q82 Q;  5DVB A;  2N6Y A;  3MSZ A;  2QKE A;  1VQN P;  2GQL A;  1ML6 A;  4TR1 A;  2N5B A;  4ZL9 A;  2IFQ A;  3GKN A;  2XPE A;  4MJA A;  1WRY A;  5EJD A;  4K0N A;  2PGT A;  4OD7 A;  5J3R A;  3VWW A;  4YKG A;  3TJG A;  4Q5F A;  4K7N A;  2PVQ A;  1Z9H A;  1QVG O;  3FY7 A;  4R0M A;  3BBY A;  1UA5 A;  3DML A;  3ZYW A;  4G2E A;  4MPF A;  1FAA A;  2HRK A;  3IDV A;  1PKW A;  1O81 A;  2OJL A;  2HRF A;  4ZL7 A;  1SL0 B;  2V41 A;  5G1K A;  1HY8 A;  5IM9 A;  1EMV A;  2YZH A;  1PN9 A;  2N98 A;  1KTE A;  2YV9 A;  2HSH A;  1F2E A;  1M9A A;  1XCC A;  2K0X A;  1MZ8 A;  1K73 Q;  3GSS A;  3GST A;  4IP6 A;  1ZNV A;  4IKH A;  1A0R P;  2B1L A;  3J7Y b;  4HI7 A;  2OE0 A;  1GTI A;  12GS A;  4GF0 A;  2ERH A;  1CQH A;  3KH7 A;  5DBQ A;  2V32 A;  2HYX A;  1VQ8 P;  2FY6 A;  2VLQ A;  2R6K A;  3D21 A;  5GZZ B;  1X9S B;  2JU5 A;  3EWL A;  4WET A;  5HFK A;  3IBH A;  2KHP A;  2B7K A;  3P05 A;  5IMD A;  2X8H A;  2RM5 A;  4ULX A;  1XBS A;  4XRQ A;  1DE1 A;  1USB A;  2AFD A;  5G30 A;  2TIR A;  1QXH A;  2ONT A;  1PFO A;  3CC2 P;  4N10 A;  4KX4 A;  5HGN A;  3EMX A;  1SKS B;  2QA2 A;  1TOF A;  2O7K A;  4DSS A;  3M9J A;  4DVC A;  3GZL A;  5BMU A;  2KWL A;  4H2Y C;  3TUE A;  4U0D A;  2LML A;  2JGP A;  1K0M A;  3UVT A;  3KCM A;  1A2J A;  3GUR A;  1Z7P A;  2CX4 A;  2GYK A;  3DXB A;  4PH1 A;  2GZF A;  2JZS A;  2FQ1 A;  4HJ2 A;  4XIH A;  5DAL B;  3QPM A;  3ZZX A;  1JLV A;  1PKZ A;  2I81 A;  4XFZ A;  4ZXG A;  2B5X A;  3VI5 A;  3GNJ A;  2O85 A;  5C04 A;  5ECS A;  2N50 A;  3B4Q A;  3HYB A;  1EV9 A;  2F3M A;  4MP4 A;  2KG8 A;  2CA8 A;  1LBK A;  5EL8 A;  1FVK A;  4J2F A;  3HVX A;  5DCG A;  2H1B A;  4GR6 A;  4YQM A;  5KP6 B;  2H75 A;  2PER A;  3DD3 A;  2EIA A;  6GSY A;  4BPH A;  2VCZ A;  4FIW A;  2K92 A;  2N5I A;  3CD6 P;  1PGT A;  3MAK A;  2CVD A;  1SJZ A;  3MWH A;  4NV2 A;  2NDO A;  2PEO A;  1TK0 B;  1NQ4 A;  4HUA A;  1B48 A;  3GZM A;  1EIA A;  3F4T A;  3LOR A;  3ERG A;  1XIY A;  1JZD A;  4IPY A;  1O6J A;  5A4W A;  4BWQ A;  2GTU A;  4XTS A;  4GR2 A;  1AW9 A;  2VLU A;  2GSQ A;  1QRJ A;  1M2A A;  4RUV A;  3BD2 A;  2VD0 A;  4YKF A;  2LJK A;  4O7H A;  5DCK A;  1FHE A;  5F07 A;  1XFL A;  3Q74 A;  3TOU A;  2QA4 P;  4DEJ A;  3CPW O;  2G2Q A;  5AIX A;  3WT2 A;  3SWL A;  1I9D A;  2L5O A;  4X4J A;  4KW6 A;  3R3E A;  2R0C A;  2FVA A;  4KH7 A;  3A5I A;  2XZ1 C;  2KP1 A;  5JWQ B;  1V98 A;  4KDX A;  3TKS E;  1TRV A;  2EIO A;  1TW9 A;  1S3C A;  1ZYP A;  1FG4 A;  3GH6 A;  1SU9 A;  2ALB A; 
#chains in the Genus database with same CATH homology
 2KOK A;  1IYI A;  4K5S A;  5DAK B;  1A23 A;  2HFD A;  2JAC A;  4ZIL A;  1GTB A;  2OKA A;  3M1G A;  1XWC A;  4P3Y B;  1QQ2 A;  1XWB A;  6GST A;  3OR5 A;  2A2P A;  4IEL A;  1PX6 A;  4J57 E;  3LQ7 A;  1AC1 A;  3IC4 A;  5E4W A;  1ZZY A;  3UMA A;  4RI6 A;  4J56 E;  5IO2 A;  2DJ1 A;  3D4T A;  1XW5 A;  2MMN A;  3HZ4 A;  4WR5 A;  3ZIV A;  5IO0 A;  5A4U A;  1IYH A;  1G7O A;  2F8F A;  1NHY A;  2EIQ A;  2IPA A;  2IME A;  4TR3 A;  3EE2 A;  5AIV A;  2A4V A;  3LJR A;  3UAP A;  2L6D A;  1M0U A;  3D4M A;  4RQR A;  4EDZ A;  3KTL A;  5FT3 A;  1TRS A;  4LMW A;  1GUL A;  3BCI A;  4I5Q A;  3LYK A;  2YWM A;  1EP7 A;  1QGV A;  4WXT A;  5D9T A;  3IE3 A;  1SK1 A;  2C0G A;  1SD8 A;  4CY8 A;  4TRX A;  3EU4 A;  4HZ4 A;  4CW9 A;  3DEX A;  4MJC A;  1PD2 1;  1X0R A;  3ED3 A;  2EC4 A;  4IQA A;  2H6Z A;  2JAD A;  1BED A;  3GFK A;  3DIE A;  3UIW A;  3HVS A;  3WGX A;  1K3L A;  4I2T A;  2H0I A;  3CTG A;  4MJB A;  2YWI A;  3PH9 A;  6GSS A;  1O73 A;  1XOA A;  3KTB A;  3C71 A;  4BVY B;  1Q98 A;  3C7M A;  3RPP A;  3QD9 A;  2M80 A;  1UC7 A;  3C73 A;  2HSM A;  3F8U A;  1AQW A;  2R5G A;  1ZOF A;  4YQV A;  3UOM A;  2HXK A;  3UL3 A;  1Q4J A;  5D93 A;  4L0W A;  4IN0 A;  4F9Z A;  1X9W B;  1TK5 B;  5IMZ A;  4MK3 A;  1ABA A;  4IHU A;  4K5R A;  3ZML A;  1GSU A;  2B6M A;  4XS4 B;  3UAR A;  3TKQ A;  2JSY A;  4GQF A;  2K8S A;  2PWJ A;  1SL1 B;  3BOA A;  1OC9 B;  4KSM A;  14GS A;  11GS A;  4K2D A;  3DRN A;  4EDY A;  3F0I A;  4F2I A;  2GST A;  2PPT A;  1M99 A;  3HCZ A;  1X5E A;  3LG6 A;  4JU5 A;  2B3S A;  4XRD A;  2HI7 A;  2LST A;  1TDI A;  4IS0 A;  4CDO A;  5ECK B;  1GRX A;  5CRH A;  1XXU A;  5ABR A;  2K9F A;  4PQ1 A;  2XHF A;  5G31 A;  2OBK A;  3WGE A;  4EXJ A;  4OCF A;  4MZB A;  2PBJ A;  3TKR A;  4PUR A;  2H0H A;  1XVW A;  1SKW B;  1U3A A;  1EOH A;  1SU9 A;  2NVL A;  2O87 A;  1EP8 A;  3F6F A;  3BCK A;  2HRA A;  3UVH A;  3LWA A;  2GT6 A;  3HKR A;  4HEA 2;  2EIR A;  2ZUP A;  4ZBD A;  3G7J A;  2GZY A;  2JSZ A;  1PX7 A;  5IMA A;  3SBC A;  2CX3 A;  2X64 A;  2AV4 A;  1YKA A;  4XS1 A;  4WBJ A;  3MNG A;  3ZTL A;  4F0B A;  5IPG A;  1KEB A;  1QFN A;  1U88 A;  2IJY A;  1GTA A;  1SD9 A;  4O5Q A;  1PL1 A;  3WYW A;  4BVX A;  10GS A;  4GRF A;  4MF6 A;  2DML A;  1AAZ A;  2H74 A;  4ISD A;  4TR1 B;  3GTU B;  5ECQ B;  2IFQ B;  2F9S A;  1XWK A;  3RPN A;  2VOC A;  2H1A A;  3IV4 A;  3ZFB A;  3VUR A;  3I6A A;  5KN2 A;  4D73 B;  3GA4 A;  1ILO A;  4MA9 A;  4RQX A;  4ID0 A;  5EVO A;  3ZVJ A;  3RHB A;  4YH2 A;  4N11 A;  1JFU A;  1ZL9 A;  4ACS A;  1GUM A;  4JZQ A;  3APO A;  4HS1 A;  3NIV A;  2M72 A;  1J08 A;  1OKT A;  4JR6 A;  2HT9 A;  1XOB A;  1XW6 A;  5H5S A;  2YN1 A;  1O85 A;  2QSI A;  4GTU A;  2OBI A;  3HJO A;  4E8E A;  2LNS A;  2CV4 A;  4V1A p;  1SEN A;  5CP1 A;  1TRU A;  1H4O A;  1B8X A;  4JRR A;  4IJ3 A;  18GS A;  2DIZ A;  1BYE A;  1FO5 A;  2WZ9 A;  2GGT A;  3A2W A;  2GDR A;  3KD0 A;  1U6T A;  2LNT A;  2FUG 2;  2MBS A;  3P7X A;  4V2L A;  3GL5 A;  4PQI A;  3KJY A;  3APS A;  2YJH A;  1G0T A;  3IOS A;  1A2L A;  1V9W A;  2FWH A;  2K6V A;  2XPD A;  4DSS B;  5KOX A;  3DVX A;  2FHE A;  2B7J A;  4ZB8 A;  3O3T A;  3CRT A;  3KP8 A;  1YQ1 A;  2DSA A;  5G2Z A;  2VM1 A;  3TJK A;  1GSF A;  4FYB A;  2YV7 A;  1MDK A;  1K0O A;  4ML6 A;  3IAM 2;  1OE8 A;  2IMI A;  2H6Y A;  2VCX A;  4NHZ A;  5D9X A;  2HZF A;  3L78 A;  5H5R A;  4IGJ A;  2H8L A;  1Z3E A;  3TGZ A;  3CSI A;  4GWR A;  5HQP A;  2X4A A;  1TXX A;  1T4Y A;  1UVZ A;  1GUK A;  1GLQ A;  2FWE A;  4Z7X A;  3M9K A;  5CRD A;  2AJQ B;  4TVE A;  4G19 A;  2MBT A;  2DLX A;  1YF1 A;  1EV4 A;  4ECI A;  2H6X A;  4USS A;  2HLS A;  5F0G A;  4HQS A;  3TJJ A;  3LXZ A;  7GSS A;  3DKS A;  2I4A A;  2B1K A;  1T3B A;  3L9S A;  1J9B A;  3CXG A;  5D73 A;  2XBQ A;  2R0G A;  2GQK A;  3E9J B;  2YPM A;  3I43 A;  2MYG A;  2AB6 A;  3TOT A;  4N0Z A;  3H8Q A;  1NSW A;  1AQX A;  2PMT A;  2V2G A;  4MF7 A;  2R0P A;  3C1R A;  1JZO A;  2TRC P;  1K0C A;  3HJP A;  2WUL A;  4POM A;  5IPH A;  3W8S A;  2VIM A;  4PXO A;  4XS6 A;  3H1N A;  1GSD A;  4MF5 A;  2L6C A;  4LL4 B;  2GS3 A;  4EKZ A;  3PGT A;  3GV1 A;  3GMF A;  2KP2 A;  3R2Q A;  2E0Q A;  4L0U A;  1JHB A;  2H76 A;  2C3Q A;  5J41 A;  2WS2 A;  1YJ6 A;  1BQ7 A;  3FW2 A;  3LW9 A;  5ELA A;  4AF2 A;  1A8L A;  4TR4 A;  1R5A A;  5B6M A;  3W6G A;  3FR3 A;  3N9J A;  1O7U A;  4MLY A;  1B4P A;  3US3 A;  1WPI A;  4I2U A;  1FVJ A;  3L0H A;  1V58 A;  2P5Q A;  5B7C A;  5ECI B;  3TRQ A;  2HNL A;  4OFN A;  4AJ6 A;  3LGC A;  1OAZ A;  4TXV A;  5B8A A;  5IIZ A;  1THX A;  4OWY A;  2ES7 A;  1A8Y A;  4QQ7 A;  1VF2 A;  3I9V 2;  4HU9 A;  3LYP A;  5JCW A;  2B5Y A;  2NBS A;  5D8I A;  2V1M A;  4K2X A;  4KA0 A;  5L71 A;  4WKW A;  3FK8 A;  5DCH A;  2R3X A;  3UEM A;  2DC5 A;  4RI7 A;  2C3T A;  1SKR B;  4K7O A;  4HJM A;  3FZA A;  3E3E A;  4HU7 A;  2KLX A;  5D9V A;  1EGO A;  2WDU A;  5F06 A;  3BJ5 A;  3LEF A;  3ZLP A;  4TXO A;  2D2Z A;  2FLS A;  2PVO C;  3RAZ A;  5HFG A;  3KIJ A;  2VCT A;  4OMV A;  2A2S A;  3U6V A;  1NHO A;  5J9B A;  2HZE A;  5JWO B;  4G9H A;  3QAG A;  4ILF A;  19GS A;  3D6I A;  2AAW A;  3L9V A;  5IOW A;  1J0F A;  3H79 A;  4EO3 A;  3JCM L;  5D96 A;  3GL3 A;  2PU9 C;  2GSR A;  1LU4 A;  2OA7 A;  2VLT A;  3UJ1 A;  2DJ0 A;  4L5L A;  3D0Z A;  5IQY A;  1N2A A;  2WCI A;  3F63 A;  1X5C A;  1WE0 A;  2JZR A;  5CO3 A;  3VWU A;  4X0X A;  3APQ A;  6GSU A;  1F37 A;  5DJM A;  4K6X A;  3GN3 A;  3HJM A;  4GST A;  3L9U A;  1TI1 A;  2FA4 A;  22GS A;  3CYN A;  4NMU A;  1R4W A;  6GSX A;  2QGV A;  2P0G A;  2VM2 A;  1YY7 A;  2OAD A;  3GRX A;  2VAF A;  4OFM A;  5G5E A;  2V6O A;  4TKY A;  4MCU A;  2QC7 A;  4LA1 A;  1THO A;  4MDC A;  4ML1 A;  3DVW A;  4Q5Q A;  3HD5 A;  1K3Y A;  2R4V A;  1F3B A;  1TI3 A;  3HA9 A;  5LNK e;  4X43 A;  2DMM A;  3A2X A;  2CVB A;  4KSO A;  4CY6 A;  1TU8 A;  2DJ2 A;  5IMV A;  5G5F A;  1R26 A;  3QOU A;  6GSV A;  1U87 A;  1ERV A;  2WRT A;  1W4V A;  1K0A A;  3HXS A;  4JED A;  4DSQ A;  3H93 A;  2CZ3 A;  4XHM A;  1TU7 A;  2K8V A;  4BL7 A;  3EUR A;  4MH2 A;  2C1Y A;  3DWV A;  1XPV A;  1GUH A;  3H4K A;  1FOH A;  4BVX B;  4KDY A;  2C80 A;  1HNB A;  1FB6 A;  1XWA A;  2RII A;  2KUC A;  4AGS A;  4A5P A;  13GS A;  1Z6M A;  5JCG A;  1HD2 A;  2M46 A;  3GKM A;  3EC3 A;  3TCO A;  3GHA A;  2LUS A;  5A5K A;  2N5A A;  5HR2 A;  1RW1 A;  2YJ7 A;  4V2M A;  3FYG A;  5GSS A;  3QMX A;  3F4S A;  4QL7 A;  1YZX A;  2H19 A;  1O8X A;  1E6B A;  5DJL A;  2WJU A;  1EEM A;  3KEB A;  2GLR A;  2GSS A;  2P5R A;  4BVY A;  4TR0 A;  2BMX A;  2FCH A;  2VCV A;  1TK8 B;  3GKK A;  3FKF A;  1EGR A;  1ZYN A;  1K0B A;  3KGK A;  1WWJ A;  1YEP A;  5ID2 A;  3Q6O A;  5D9W A;  3E0U A;  3IK9 A;  2H1D A;  3CBU A;  1LJR A;  2IMK A;  1NM3 A;  3A5W A;  4F82 A;  1KNG A;  2FD3 A;  4KCE A;  4LMV A;  1W89 A;  3K8N A;  1GP1 A;  2VUP A;  3F3Q A;  2K18 A;  1ZYE A;  3LSZ A;  1OKD A;  1T7P B;  4Q5R A;  4MAB A;  1SK0 A;  4KCA A;  4LLR A;  3Q18 A;  2CVK A;  1QMV A;  5CNW A;  2H72 A;  5JCU A;  2RUE A;  3VI7 A;  3GKX A;  1VF4 A;  2FWG A;  3D22 A;  4ECJ A;  4KB3 A;  1AIU A;  2CAI A;  1Z5Y E;  2X8G A;  4JE1 A;  2HRN A;  2GT5 A;  3TDG A;  3I69 A;  2YP6 A;  4NXI A;  8GSS A;  1CQG A;  1PSQ A;  1TKD B;  2BJX A;  2ZNM A;  3VLN A;  4FYC A;  4FO5 A;  1X5D A;  4KND A;  1EEJ A;  1HNC A;  1Y25 A;  3VK9 A;  1TRW A;  3KMN A;  2WFC A;  2NPB A;  3GX0 A;  4AJ8 A;  2CZ2 A;  2CQ9 A;  4POK A;  3D5J A;  4JR4 A;  1TTZ A;  5DQY A;  2O89 A;  5E59 A;  2FWF A;  3F3R A;  5FHI A;  1OE7 A;  1KBN A;  2DBC A;  1M9B A;  3IAS 2;  9GSS A;  1M2D A;  1BX9 A;  3KMO A;  2L4Q A;  4BWS A;  5KN1 A;  1GH2 A;  3EYT A;  1QK8 A;  1OYJ A;  3EMP A;  3Q19 A;  3TB2 A;  1GSE A;  1OVN A;  3WD6 A;  1BJX A;  4L5O A;  4MNN A;  3RHC A;  3LXT A;  1VF3 A;  2LV3 A;  2DJJ A;  2J23 A;  3U5R E;  2C3N A;  2E7P A;  5J5N A;  4H86 A;  2C0D A;  3F9U A;  5CRW A;  5FWG A;  4OO4 A;  1GNE A;  4FQU A;  3V1W A;  4PX1 A;  3CTF A;  4Z2U A;  2E2M A;  4OFT A;  2RLI A;  3A2V A;  4IJI A;  1GNW A;  1SK2 A;  2MMA A;  3LFL A;  2C4J A;  4NHW A;  2AUV A;  2Z9S A;  2VO4 A;  1T00 A;  1PMT A;  2J9H A;  4GXZ A;  3QAW A;  3HY2 A;  4O92 A;  3S9F A;  3GTU A;  5GST A;  1TP9 A;  1Z6N A;  2XC2 A;  4O5R A;  2GVP A;  1VF1 A;  2MZC A;  2E2G A;  4HOJ A;  1SL2 B;  1ZCP A;  4D73 A;  2LJA A;  1ERW A;  3VFI A;  5ECN B;  1NW2 A;  3P8W A;  4HQZ A;  2REM A;  3HDC A;  3GX8 A;  3IA1 A;  5A4V A;  2JL4 A;  2I3Y A;  4WR4 A;  3F4R A;  1RQM A;  2L59 A;  4X1U A;  2A4H A;  4EL1 A;  5LD0 A;  2IMF A;  2GZP A;  2PUK C;  4POL A;  5LCZ A;  4O5U A;  5GAN D;  1SYR A;  2LRT A;  3ZVJ D;  4EUY A;  1WIK A;  3ERW A;  1X9M B;  4WF4 A;  3ZIT A;  3KP9 A;  2CT6 A;  2RUF A;  2CAQ A;  2UZ8 A;  5KOW A;  1MD3 A;  1B9Y C;  4CHS A;  1YF0 A;  5HR1 A;  3TKP A;  3HZ8 A;  4TOP A;  3ZL5 A;  5KEJ A;  4XRA A;  1YDK A;  2HE3 A;  2VL2 A;  2IWT A;  3GYK A;  4O32 A;  1MEK A;  3AY8 A;  20GS A;  1JZW A;  4F0C A;  3P2A A;  1E2Y A;  1GL8 A;  2FA8 A;  3IR4 A;  2X49 A;  2YOI A;  3M0F A;  4I8B A;  2H01 A;  3ME7 A;  1K3O A;  5H5Q A;  2AHE A;  2L4C A;  4Q5N A;  2C8U A;  5ECP B;  4PTS A;  3NZN A;  4PGT A;  5HR3 A;  4K0G A;  2ON7 A;  4TXO B;  2MMZ A;  1AXD A;  2RM6 A;  1EZK A;  2DJK A;  4ZB6 A;  3IPZ A;  4N30 A;  3WGD A;  3UBK A;  3CSJ A;  4YAV A;  5COH A;  1V40 A;  1DBY A;  1ERU A;  1VRS D;  2HZE B;  1N8J A;  1V2A A;  2LTK A;  2WB9 A;  3QAV A;  5ELG A;  2I1U A;  1EWX A;  1H75 A;  3FZ4 A;  3FEU A;  4Z2R A;  2ZCT A;  4NPB A;  2DKH A;  4IQ1 A;  4BPY A;  2VCW A;  1GLP A;  3KZQ A;  4K9Z A;  1FB0 A;  3G9B A;  1ON4 A;  2C0F A;  3HYP A;  4ICY A;  1FOV A;  2FGX A;  5KN3 A;  2TRX A;  4POB A;  1UN2 A;  1K0D A;  3TKS A;  3MDK A;  3KH9 A;  4F03 A;  1ST9 A;  3CSH A;  2IMD A;  4AJ7 A;  2LQQ A;  1GSY A;  2F51 A;  2VL2 C;  2R2J A;  1EOG A;  3DGQ A;  1R7H A;  3QDN A;  3L4N A;  4N0V A;  5EY6 A;  1T1V A;  1DE2 A;  2C0E A;  2LJR A;  2YZU A;  4GQC A;  5J9C A;  4V1A g;  2YWN A;  5DAL A;  2R37 A;  1OC8 A;  3ISO A;  3M3M A;  2H1G A;  1F6M C;  3EU3 A;  1HNA A;  1SJ6 A;  2IIY A;  4LL1 B;  2I9H A;  5CRE A;  3TJB A;  1AUC A;  2QA1 A;  1XVQ A;  1BAY A;  1YEX A;  5IOX A;  1QUW A;  3FMW A;  5BRT A;  2OAC A;  3QFA C;  5JWR B;  5GAP D;  1JLW A;  3IC8 A;  5ECM B;  4G10 A;  4K7I A;  1ZGN A;  4EE0 A;  5J4U A;  3ZRE A;  3FR9 A;  4ZB9 A;  5AIS A;  4K8M A;  1G7E A;  1MTC A;  5IMF A;  4EIP A;  2VCQ A;  4NAX A;  4E8H A;  4MPG A;  1SJI A;  5CYY A;  5ECL B;  2N5F A;  4G0I A;  5INY A;  4G0L A;  4I6X A;  1G6W A;  2B5E A;  1BG5 A;  5B8B A;  1TJD A;  3ZIJ A;  3TKS C;  3ZRD A;  2LRN A;  16GS A;  1VGL A;  3F6D A;  4BL7 B;  3A3T A;  3GH9 A;  2O8V B;  3VWV A;  2LQO A;  5HR0 A;  3MIX A;  2JZT A;  4KDU A;  3QR6 A;  3UBL A;  3FHK A;  3PIN A;  3RDW A;  1GSQ A;  4PQH A;  1M7T A;  4ECC A;  5ECH B;  4KF9 A;  2DJ3 A;  2X8C A;  5AN1 A;  1F9M A;  4DSR A;  2OE1 A;  2NTO A;  2L57 A;  3O76 A;  3DYR A;  2L5L A;  4JBB A;  4FYU A;  5DAK A;  5KN0 A;  2AYT A;  2H70 A;  4WBR D;  2LRC A;  2GZZ A;  4KUN A;  1U3I A;  1PN0 A;  4PUF C;  4FH8 A;  2YCD A;  1YKC A;  5F05 A;  3NOF A;  2H0G A;  4IP1 A;  4ZIJ A;  1A0F A;  1B9X C;  1GSS A;  2LKU A;  1C72 A;  1RK4 A;  3C1S A;  4HDE A;  5ECR B;  4IBP A;  1PA3 A;  1JZR A;  1HYU A;  3TRX A;  4G0K A;  5ID2 B;  3GUS A;  1ERT A;  2GQM A;  3QFB C;  1WMJ A;  3QCP A;  3C8E A;  6GSW A;  4NWY A;  3G7I A;  1M2B A;  3N5O A;  5B6N A;  1XZO A;  1GWC A;  3VPQ A;  1R5P A;  4GSN A;  4EIQ A;  1XW9 A;  3FZ5 A;  2LS5 A;  2A2R A;  3CMI A;  4XCS A;  3G7Y A;  3MYD A;  3ZMK A;  5CAX A;  2P31 A;  4OO5 A;  4NV5 A;  2X99 A;  5EPF A;  3P90 A;  2V6K A;  1I5G A;  1V57 A;  1G6Y A;  4GSS A;  3ERF A;  4BA7 A;  4PNG A;  4ECB A;  2VL9 A;  5IMC A;  5AGY A;  1A24 A;  1ZYQ B;  4PNF A;  5ECO B;  1GTU A;  4WEY A;  1T8E B;  2IL3 A;  1XWG A;  1ACV A;  3HHV A;  4PUA A;  5DDL A;  1MD4 A;  1Y6E A;  3ME8 A;  2HSY A;  4K1F A;  4KGI A;  2YNX A;  3GIX A;  1PRX A;  1S3D A;  4MZC A;  3PR8 A;  3KXO A;  4KAE A;  4QL9 A;  1ZMA A;  2VD1 A;  1OC3 A;  4GCI A;  4XS4 A;  1T4Z A;  3CRU A;  2FNO A;  5DQS A;  4TW5 A;  3IXR A;  2BTO T;  1O8W A;  1DSB A;  3RBT A;  1F3A A;  3TRP A;  1OC9 A;  4EVM A;  1PQN A;  4MH3 A;  4MZW A;  3J7Y k;  4WF5 A;  1PL2 A;  2H73 A;  1A2M A;  1S3A A;  17GS A;  2LEG A;  1SYX A;  4ZBB A;  4L8E A;  3EPT A;  3HVV A;  2ON5 A;  1AQV A;  3IHQ A;  2MMO A;  3FZ9 A;  3VPT A;  4V2N A;  4MMM A;  4TN8 A;  3O6T A;  2PN8 A;  1MDI A;  4OCE A;  4KE3 A;  4YQU A;  3VWX A;  4IW9 A;  1WOU A;  2H30 A;  2VLV A;  3M8N A;  2H71 A;  2IN3 A;  3EVI A;  4I97 A;  2YAN A;  3ZFL A;  4EF0 A;  3PPU A;  2F8A A;  2WGR A;  5CRG A;  5ENU A;  5C00 A;  1FW1 A;  2H66 A;  1MDJ A;  4HZ2 A;  3IRA A;  1WP0 A;  1B4Q A;  3KM6 A;  3IK7 A;  4IVF A;  2XBI A;  1HQO A;  2DKI A;  5HFI A;  4MJE A;  1K0N A;  4ZBA A;  2VL3 A;  2YWO A;  3TJF A;  4ZL8 A;  2DIY A;  4YAP A;  2G0F A;  2OE3 A;  3EIN A;  4Z2T A;  3FR6 A;  4EC0 A;  5F8B A;  1WJK A;  1DUG A;  3IHG A;  1Z7R A;  3W8J A;  3FRC A;  5G1L A;  3WT1 A;  1URM A;  5DVB A;  3MSZ A;  2QKE A;  2GQL A;  1ML6 A;  4TR1 A;  2N5B A;  4ZL9 A;  2IFQ A;  3GKN A;  2XPE A;  4MJA A;  1WRY A;  4K0N A;  2PGT A;  4OD7 A;  5J3R A;  3VWW A;  4YKG A;  3TJG A;  4Q5F A;  4K7N A;  2PVQ A;  1Z9H A;  3FY7 A;  3BBY A;  1UA5 A;  3DML A;  3ZYW A;  4G2E A;  4MPF A;  1FAA A;  2HRK A;  3IDV A;  1PKW A;  1O81 A;  2OJL A;  2HRF A;  4ZL7 A;  1SL0 B;  2V41 A;  5G1K A;  5IM9 A;  2YZH A;  1PN9 A;  1KTE A;  2YV9 A;  2HSH A;  1F2E A;  1M9A A;  1XCC A;  3GSS A;  3GST A;  4IP6 A;  4IKH A;  1A0R P;  2B1L A;  3J7Y b;  4HI7 A;  2OE0 A;  1GTI A;  12GS A;  4GF0 A;  1CQH A;  3KH7 A;  5DBQ A;  2V32 A;  2HYX A;  2FY6 A;  5GZZ B;  2R6K A;  3D21 A;  1X9S B;  2JU5 A;  3EWL A;  4WET A;  5HFK A;  3IBH A;  2KHP A;  2B7K A;  5IMD A;  2X8H A;  2RM5 A;  4ULX A;  1XBS A;  1DE1 A;  1USB A;  5G30 A;  2TIR A;  1QXH A;  4N10 A;  4KX4 A;  3EMX A;  1SKS B;  2QA2 A;  1TOF A;  2O7K A;  4DSS A;  3M9J A;  4DVC A;  5BMU A;  3TUE A;  1K0M A;  3UVT A;  3KCM A;  1A2J A;  3GUR A;  1Z7P A;  2CX4 A;  3DXB A;  2JZS A;  4HJ2 A;  4XIH A;  5DAL B;  3QPM A;  3ZZX A;  1JLV A;  1PKZ A;  2I81 A;  4ZXG A;  2B5X A;  3VI5 A;  3GNJ A;  2O85 A;  5C04 A;  5ECS A;  1EV9 A;  2F3M A;  4MP4 A;  2CA8 A;  1LBK A;  5EL8 A;  1FVK A;  4J2F A;  3HVX A;  5DCG A;  2H1B A;  4YQM A;  2H75 A;  2PER A;  3DD3 A;  6GSY A;  4FIW A;  2VCZ A;  1PGT A;  3MAK A;  2CVD A;  4NV2 A;  1SJZ A;  3MWH A;  2NDO A;  1TK0 B;  4HUA A;  1B48 A;  3F4T A;  3LOR A;  3ERG A;  1XIY A;  1JZD A;  1O6J A;  5A4W A;  4BWQ A;  2GTU A;  4XTS A;  1AW9 A;  2VLU A;  2GSQ A;  1M2A A;  4RUV A;  3BD2 A;  2VD0 A;  4YKF A;  2LJK A;  4O7H A;  1FHE A;  5F07 A;  1XFL A;  3Q74 A;  3TOU A;  4DEJ A;  2G2Q A;  5AIX A;  3WT2 A;  3SWL A;  1I9D A;  4X4J A;  2L5O A;  4KW6 A;  3R3E A;  2R0C A;  4KH7 A;  3A5I A;  2KP1 A;  5JWQ B;  1V98 A;  4KDX A;  3TKS E;  1TRV A;  2EIO A;  1TW9 A;  1S3C A;  1ZYP A;  1FG4 A;  3GH6 A;  4GLT A;  2ALB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...