2Z45A

Crystal structure of zn-bound orf134
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
109
structure length
109
Chain Sequence
FKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Crystal Structure of ORF134
rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 48
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2z45A00
2PEIA 2PEKA 2PEOA 2Z46A 3HYBA 5BS1A 2PY8A 3RG6C 5BS2A 2PEJA 4GR6A 2Z44A 4GR2A 3Q20A 2Z45A 2PEMA 2PEQA 2PENA
chains in the Genus database with same CATH superfamily
3G1IA 5HGMA 5KP6B 3CMEP 1VHNA 1M6EX 1CEIA 1OR5A 2AF8A 2GZEA 1L0IA 3RG6C 1VQ4P 2K2QA 3GKLC 5F2OA 1GXGA 2LF4A 1BAJA 2L6EA 2PY8A 3DS2A 2DNWA 4BPHA 5KP8B 2PEIA 3G6EP 2N50A 3B4QA 1Z6MA 2ERHA 2FADA 1A8OA 2JBGA 1GPJA 5HGOA 2FQ1A 4PXHB 1Q82Q 5EJDA 2JQ4A 4BPGA 1RO0A 2GZFA 4PWVB 2DGYA 2KORA 3G29A 4H2WC 2KOOA 2M5RA 1KD1Q 1YJ9P 1EOQA 3CCQP 3CCMP 4PH0A 3G21A 3EJEA 2K94A 5F2NA 2FAEA 1QVFO 1VQNP 2VLNA 2GZJA 2KOPA 3CCEP 1S72P 2CQ8A 2L9FA 2KGAA 1M1KQ 1VQMP 5HGLA 2GZIA 2GDWA 1VKUA 1KQSO 2AVAA 2QA4P 4PH1A 1VQ7P 3CCUP 2XV6A 3H47A 3DS3A 1UJZA 1EIAA 3H4EA 2EIAA 2M8NA 5I4TG 5EW5E 3CXCO 4GR6A 3CCVP 2EG5A 4U0DA 3E2DA 4R0MA 2FVEA 2VLOA 2PEOA 2PEKA 3HZQA 5HV8A 2AFEA 1K8AQ 1RNIA 3DS4A 2N98A 4M0IA 5DCKA 2VLPA 2XXMA 3CE7A 1ACPA 1EMVA 2L4BA 3DS5A 2FVAA 1K9MQ 5HVCA 2X2BA 3U43A 3HYBA 4QNBA 4U0CA 2GYKA 3I56P 4H2YC 3DTJA 3CCSP 3Q20A 3LRYA 1M6NA 3CC7P 4U0FA 1K30A 3CPWO 2PNGA 4XFZA 1NJIQ 1K73Q 2M8LA 2QEXP 7CEIA 2OTLP 4COPA 2JGPA 4QKOA 4HKGA 3B5IA 4BPFA 2PENA 5BS1A 1VQOP 1NQ4A 1YITP 1QVGO 2M8PA 3NY7B 4XRQA 2VSQA 2KOQA 2LIUA 4COCA 2KR5A 2Z44A 2P9XA 2JYLA 3WBHA 2LL8A 5BS2A 3G26A 2KGCA 3G71P 1ZMBA 2XT1A 3MGEA 4H2XC 2CGQA 4U0EA 2MVUA 3H0DA 1BXIA 1A43A 3CC2P 3G0VA 2K0DX 1D1DA 1YHQP 2N6ZA 2JYGA 2FQ0A 1N8RQ 1AUMA 2KG6A 4DG9A 3G28A 4CA3A 2EFJA 4XFYA 3EJBA 2BHVA 2VLQA 5F2KA 2GDYA 3P05A 3LMOA 2EHTA 2E1MA 2N5IA 1FR2A 2N6YA 4IZ6A 5JPAA 4NEOA 3DS1A 1VQ9P 2LKIA 2GDXA 4UHPB 1X3OA 2MVVA 1QRJA 2KGDA 2MR8A 3CCJP 2K93A 2CG5B 2K0XA 2ONTA 3CD6P 2XZ0D 2JO0A 1DNYA 1F80D 2JB0A 1L0HA 2LPKA 2JU1A 2KG8A 1IMPA 3DPHA 1VQKP 1KLPA 2L0QA 2XZ1C 4F37A 4GR2A 2K5XA 3G4SP 2LTEA 2KWLA 2LOLA 3RG2A 1E6JP 1MZ8A 3OW2O 1VQLP 2BUOA 1YJNP 1DV5A 3CC4P 2JU2A 3CCRP 1M90Q 1VQ8P 2CWOA 1HQBA 1GXHA 2MR7A 5CZDB 3VRLC 2PEQA 3I55P 2JAZA 2K0YA 1Q86Q 1Q7YQ 1JJ2O 3EJDA 2KOSA 4U0AA 2MD9A 3CCLP 2CNRA 1HY8A 2FVFA 2L22A 2Z46A 1IMQA 2OTJP 1VQ5P 2FHSC 2KODA 1M74A 3GZMA 3GZLA 2Z45A 1KC8Q 2MY5A 5KP7B 1AYIA 3DS0A 2AFDA 2ROQA 1T8KA 1YIJP 1YI2P 1UNKA 1IUQA 2EHSA 1YJWP 4U0BA 4XROA 2KGEA 4XFXA 2NO8A 3NTEA 1E0HA 1Q81Q 2KG9A 2OARA 2LIWA 1AF8A 2PEMA 2LMLA 3M1MA 2WPTA 1ZNVA 1RO2A 2PEJA 4WYMA 1VQPP 2K92A 2GZGA 2KW2A 1VQ6P 2N5HA 3GJNA 2FQ2A 2QNWA 4MRTC 2MF4A 4IPYA 5HGNA 3G1GA 3CMAP 1W2BO 2FACA
chains in the Genus database with same CATH topology
3G1IA 5HGMA 3CCRP 1M90Q 5BS2A 3G26A 1VQ8P 3CMEP 3CXCO 4GR6A 3CCVP 2CWOA 2EG5A 1M6EX 3G71P 1ZMBA 4U0DA 3E2DA 2XT1A 3RG6C 3VRLC 3MGEA 2PEQA 1VQ4P 2PEOA 2PEKA 3I55P 4U0EA 3HZQA 5F2OA 1Q86Q 3H0DA 1Q7YQ 1JJ2O 2LF4A 1BAJA 4U0AA 1A43A 1K8AQ 3CC2P 2L6EA 2PY8A 1RNIA 3G0VA 3DS2A 3DS4A 3CCLP 1D1DA 2PEIA 1YHQP 2Z46A 2OTJP 2JYGA 3G6EP 4M0IA 5DCKA 1VQ5P 2XXMA 1N8RQ 1AUMA 3G28A 2EFJA 2KODA 3DS5A 4XFYA 1M74A 1K9MQ 1A8OA 5HGOA 2BHVA 2Z45A 5F2KA 3HYBA 4QNBA 1KC8Q 4U0CA 1Q82Q 3I56P 1RO0A 3P05A 3DS0A 2E1MA 2DGYA 3DTJA 3CCSP 5JPAA 3G29A 3Q20A 1YIJP 3DS1A 1YI2P 1KD1Q 1YJ9P 1VQ9P 2JYLA 1EOQA 3LRYA 3CCQP 3CCMP 1M6NA 3CC7P 4U0FA 1QRJA 4PH0A 1IUQA 1K30A 3G21A 1YJWP 3CPWO 4XFZA 4U0BA 4XROA 1NJIQ 4XFXA 3CCJP 3NTEA 5F2NA 3CD6P 2ONTA 1K73Q 1Q81Q 2M8LA 2OARA 2QEXP 2JO0A 1QVFO 1VQNP 2OTLP 2PEMA 3M1MA 4COPA 3B5IA 3DPHA 1VQKP 3CCEP 2PENA 5BS1A 1RO2A 2PEJA 4WYMA 1S72P 1VQPP 1VQOP 1YITP 1QVGO 1VQ6P 2M8PA 1M1KQ 1VQMP 5HGLA 4GR2A 1KQSO 4XRQA 2QA4P 3G4SP 4PH1A 4COCA 4IPYA 5HGNA 1VQ7P 3G1GA 1E6JP 3CMAP 3CCUP 3OW2O 1VQLP 2BUOA 2XV6A 1YJNP 3H47A 1W2BO 3DS3A 3H4EA 1EIAA 2EIAA 3CC4P 2Z44A 2P9XA 2M8NA 5I4TG 3WBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEI A;  2PEK A;  2PEO A;  2Z46 A;  3HYB A;  5BS1 A;  2PY8 A;  3RG6 C;  5BS2 A;  2PEJ A;  4GR6 A;  2Z44 A;  4GR2 A;  3Q20 A;  2Z45 A;  2PEM A;  2PEQ A;  2PEN A; 
#chains in the Genus database with same CATH topology
 3G1I A;  5HGM A;  5KP6 B;  3CME P;  1VHN A;  1M6E X;  1CEI A;  1OR5 A;  2AF8 A;  2GZE A;  1L0I A;  3RG6 C;  1VQ4 P;  2K2Q A;  3GKL C;  5F2O A;  1GXG A;  2LF4 A;  1BAJ A;  2L6E A;  2PY8 A;  3DS2 A;  2DNW A;  4BPH A;  5KP8 B;  2PEI A;  3G6E P;  2N50 A;  3B4Q A;  1Z6M A;  2ERH A;  2FAD A;  1A8O A;  2JBG A;  1GPJ A;  5HGO A;  2FQ1 A;  4PXH B;  1Q82 Q;  5EJD A;  2JQ4 A;  4BPG A;  1RO0 A;  2GZF A;  4PWV B;  2DGY A;  2KOR A;  3G29 A;  4H2W C;  2KOO A;  2M5R A;  1KD1 Q;  1YJ9 P;  1EOQ A;  3CCQ P;  3CCM P;  4PH0 A;  3G21 A;  3EJE A;  2K94 A;  5F2N A;  2FAE A;  1QVF O;  1VQN P;  2VLN A;  2GZJ A;  2KOP A;  3CCE P;  1S72 P;  2CQ8 A;  2L9F A;  2KGA A;  1M1K Q;  1VQM P;  5HGL A;  2GZI A;  2GDW A;  1VKU A;  1KQS O;  2AVA A;  2QA4 P;  4PH1 A;  1VQ7 P;  3CCU P;  2XV6 A;  3H47 A;  3DS3 A;  1UJZ A;  1EIA A;  3H4E A;  2EIA A;  2M8N A;  5I4T G;  5EW5 E;  3CXC O;  4GR6 A;  3CCV P;  2EG5 A;  4U0D A;  3E2D A;  4R0M A;  2FVE A;  2VLO A;  2PEO A;  2PEK A;  3HZQ A;  5HV8 A;  2AFE A;  1K8A Q;  1RNI A;  3DS4 A;  2N98 A;  4M0I A;  5DCK A;  2VLP A;  2XXM A;  3CE7 A;  1ACP A;  1EMV A;  2L4B A;  3DS5 A;  2FVA A;  1K9M Q;  5HVC A;  2X2B A;  3U43 A;  3HYB A;  4QNB A;  4U0C A;  2GYK A;  3I56 P;  4H2Y C;  3DTJ A;  3CCS P;  3Q20 A;  3LRY A;  1M6N A;  3CC7 P;  4U0F A;  1K30 A;  3CPW O;  2PNG A;  4XFZ A;  1NJI Q;  1K73 Q;  2M8L A;  2QEX P;  7CEI A;  2OTL P;  4COP A;  2JGP A;  4QKO A;  4HKG A;  3B5I A;  4BPF A;  2PEN A;  5BS1 A;  1VQO P;  1NQ4 A;  1YIT P;  1QVG O;  2M8P A;  3NY7 B;  4XRQ A;  2VSQ A;  2KOQ A;  2LIU A;  4COC A;  2KR5 A;  2Z44 A;  2P9X A;  2JYL A;  3WBH A;  2LL8 A;  5BS2 A;  3G26 A;  2KGC A;  3G71 P;  1ZMB A;  2XT1 A;  3MGE A;  4H2X C;  2CGQ A;  4U0E A;  2MVU A;  3H0D A;  1BXI A;  1A43 A;  3CC2 P;  3G0V A;  2K0D X;  1D1D A;  1YHQ P;  2N6Z A;  2JYG A;  2FQ0 A;  1N8R Q;  1AUM A;  2KG6 A;  4DG9 A;  3G28 A;  4CA3 A;  2EFJ A;  4XFY A;  3EJB A;  2BHV A;  2VLQ A;  5F2K A;  2GDY A;  3P05 A;  3LMO A;  2EHT A;  2E1M A;  2N5I A;  1FR2 A;  2N6Y A;  4IZ6 A;  5JPA A;  4NEO A;  3DS1 A;  1VQ9 P;  2LKI A;  2GDX A;  4UHP B;  1X3O A;  2MVV A;  1QRJ A;  2KGD A;  2MR8 A;  3CCJ P;  2K93 A;  2CG5 B;  2K0X A;  2ONT A;  3CD6 P;  2XZ0 D;  2JO0 A;  1DNY A;  1F80 D;  2JB0 A;  1L0H A;  2LPK A;  2JU1 A;  2KG8 A;  1IMP A;  3DPH A;  1VQK P;  1KLP A;  2L0Q A;  2XZ1 C;  4F37 A;  4GR2 A;  2K5X A;  3G4S P;  2LTE A;  2KWL A;  2LOL A;  3RG2 A;  1E6J P;  1MZ8 A;  3OW2 O;  1VQL P;  2BUO A;  1YJN P;  1DV5 A;  3CC4 P;  2JU2 A;  3CCR P;  1M90 Q;  1VQ8 P;  2CWO A;  1HQB A;  1GXH A;  2MR7 A;  5CZD B;  3VRL C;  2PEQ A;  3I55 P;  2JAZ A;  2K0Y A;  1Q86 Q;  1Q7Y Q;  1JJ2 O;  3EJD A;  2KOS A;  4U0A A;  2MD9 A;  3CCL P;  2CNR A;  1HY8 A;  2FVF A;  2L22 A;  2Z46 A;  1IMQ A;  2OTJ P;  1VQ5 P;  2FHS C;  2KOD A;  1M74 A;  3GZM A;  3GZL A;  2Z45 A;  1KC8 Q;  2MY5 A;  5KP7 B;  1AYI A;  3DS0 A;  2AFD A;  2ROQ A;  1T8K A;  1YIJ P;  1YI2 P;  1UNK A;  1IUQ A;  2EHS A;  1YJW P;  4U0B A;  4XRO A;  2KGE A;  4XFX A;  2NO8 A;  3NTE A;  1E0H A;  1Q81 Q;  2KG9 A;  2OAR A;  2LIW A;  1AF8 A;  2PEM A;  2LML A;  3M1M A;  2WPT A;  1ZNV A;  1RO2 A;  2PEJ A;  4WYM A;  1VQP P;  2K92 A;  2GZG A;  2KW2 A;  1VQ6 P;  2N5H A;  3GJN A;  2FQ2 A;  2QNW A;  4MRT C;  2MF4 A;  4IPY A;  5HGN A;  3G1G A;  3CMA P;  1W2B O;  2FAC A; 
#chains in the Genus database with same CATH homology
 3G1I A;  5HGM A;  3CCR P;  1M90 Q;  5BS2 A;  3G26 A;  1VQ8 P;  3CME P;  3CXC O;  4GR6 A;  3CCV P;  2CWO A;  2EG5 A;  1M6E X;  3G71 P;  1ZMB A;  4U0D A;  3E2D A;  2XT1 A;  3RG6 C;  3VRL C;  3MGE A;  2PEQ A;  1VQ4 P;  2PEO A;  2PEK A;  3I55 P;  4U0E A;  3HZQ A;  5F2O A;  1Q86 Q;  3H0D A;  1Q7Y Q;  1JJ2 O;  2LF4 A;  1BAJ A;  4U0A A;  1A43 A;  1K8A Q;  3CC2 P;  2L6E A;  2PY8 A;  1RNI A;  3G0V A;  3DS2 A;  3DS4 A;  3CCL P;  1D1D A;  2PEI A;  1YHQ P;  2Z46 A;  2OTJ P;  2JYG A;  3G6E P;  4M0I A;  5DCK A;  1VQ5 P;  2XXM A;  1N8R Q;  1AUM A;  3G28 A;  2EFJ A;  2KOD A;  3DS5 A;  4XFY A;  1M74 A;  1K9M Q;  1A8O A;  5HGO A;  2BHV A;  2Z45 A;  5F2K A;  3HYB A;  4QNB A;  1KC8 Q;  4U0C A;  1Q82 Q;  3I56 P;  1RO0 A;  3P05 A;  3DS0 A;  2E1M A;  2DGY A;  3DTJ A;  3CCS P;  5JPA A;  3G29 A;  3Q20 A;  1YIJ P;  3DS1 A;  1YI2 P;  1KD1 Q;  1YJ9 P;  1VQ9 P;  2JYL A;  1EOQ A;  3LRY A;  3CCQ P;  3CCM P;  1M6N A;  3CC7 P;  4U0F A;  1QRJ A;  4PH0 A;  1IUQ A;  1K30 A;  3G21 A;  1YJW P;  3CPW O;  4XFZ A;  4U0B A;  4XRO A;  1NJI Q;  4XFX A;  3CCJ P;  3NTE A;  5F2N A;  3CD6 P;  2ONT A;  1K73 Q;  1Q81 Q;  2M8L A;  2OAR A;  2QEX P;  2JO0 A;  1QVF O;  1VQN P;  2OTL P;  2PEM A;  3M1M A;  4COP A;  3B5I A;  3DPH A;  1VQK P;  3CCE P;  2PEN A;  5BS1 A;  1RO2 A;  2PEJ A;  4WYM A;  1S72 P;  1VQP P;  1VQO P;  1YIT P;  1QVG O;  1VQ6 P;  2M8P A;  1M1K Q;  1VQM P;  5HGL A;  4GR2 A;  1KQS O;  4XRQ A;  2QA4 P;  3G4S P;  4PH1 A;  4COC A;  4IPY A;  5HGN A;  1VQ7 P;  3G1G A;  1E6J P;  3CMA P;  3CCU P;  3OW2 O;  1VQL P;  2BUO A;  2XV6 A;  1YJN P;  3H47 A;  1W2B O;  3DS3 A;  3H4E A;  1EIA A;  2EIA A;  3CC4 P;  2Z44 A;  2P9X A;  2M8N A;  5I4T G;  3WBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...