2Z45A

Crystal structure of zn-bound orf134
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
109
structure length
109
Chain Sequence
b'FKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Crystal Structure of ORF134
rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 48
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2z45A00
2PEIA 5BS2A 2PY8A 2PEMA 2PEOA 2PEQA 2Z44A 3HYBA 2Z46A 5BS1A 2PENA 4GR6A 2Z45A 3RG6C 4GR2A 2PEKA 2PEJA 3Q20A
chains in the Genus database with same CATH superfamily
2KG6A 1M6NA 3EJBA 1L0IA 4HKGA 1EOQA 3NY7B 2FQ1A 2KGDA 2KW2A 2LKIA 3CCRP 1T8KA 2K94A 1YJ9P 3CC7P 2FVFA 2LL8A 2GYKA 3CCEP 2LPKA 2FQ0A 1BXIA 5BS1A 4WYMA 2KOPA 1QVFO 5KP8B 2KOQA 3G1IA 3G26A 2M5RA 3G0VA 2BUOA 4U0CA 1HY8A 2CG5B 5HV8A 2N6YA 3LMOA 5F2NA 2NO8A 2JYLA 2KR5A 1UNKA 1W2BO 1UJZA 1X3OA 2MR7A 2N6ZA 2ROQA 5JPAA 2DGYA 2JYGA 2JQ4A 3G21A 2CWOA 1QVGO 1JJ2O 3M1MA 7CEIA 2MVVA 2WPTA 4XRQA 1DV5A 2GZEA 4H2WC 1M90Q 1VQLP 1F80D 5EW5E 1YJNP 1A8OA 1E6JP 2KODA 1KD1Q 5HGNA 3HYBA 1AYIA 2ONTA 1VQOP 2JBGA 5F2KA 3P05A 1VQNP 1E0HA 3E2DA 1ACPA 4GR6A 2MF4A 1YI2P 2L6EA 3U43A 4PXHB 2QEXP 1Q81Q 2P9XA 4QKOA 2XZ0D 1VHNA 1AUMA 1Q7YQ 2VLQA 3CCJP 3EJDA 1K73Q 4PH1A 4R0MA 1DNYA 2MR8A 2JGPA 2N98A 1M1KQ 2XV6A 4PWVB 3DTJA 2K0DX 1YHQP 3H47A 1RO0A 3CMAP 2PEIA 2KOOA 3CCUP 2EHTA 2FHSC 1GXHA 2Z44A 3H0DA 2M8LA 2FADA 1VQ6P 3RG2A 2JU2A 3B4QA 3G71P 3CE7A 2L22A 2GZIA 1A43A 2LIUA 3CXCO 2GDYA 4BPFA 3CCVP 3OW2O 2XZ1C 4F37A 2FAEA 1IMQA 2N50A 5KP7B 2Z46A 2KGCA 2L9FA 2VLNA 5HGMA 1K9MQ 2MY5A 2ERHA 1K30A 1S72P 3G6EP 3CCSP 4CA3A 2LTEA 1VQ4P 4COPA 3GZLA 1NQ4A 2GDXA 3CCMP 2PEJA 2MVUA 3LRYA 2EG5A 2FQ2A 3DS0A 4QNBA 5HGLA 4U0AA 1MZ8A 5HVCA 1OR5A 3CMEP 2OARA 2L0QA 1YJWP 4BPHA 3G29A 3CCLP 4H2YC 1VQMP 3MGEA 2K5XA 2LMLA 2KGEA 1M6EX 4IPYA 3CC2P 2K93A 2LF4A 1KLPA 2GZGA 4XFYA 2FVAA 2EIAA 1Q82Q 2GZFA 1VKUA 2PEKA 1K8AQ 4BPGA 3CC4P 1FR2A 2MD9A 2KORA 2Z45A 2GZJA 2KWLA 2JU1A 2AVAA 3RG6C 4UHPB 3DPHA 2KG8A 2CQ8A 2CNRA 1ZNVA 3GZMA 3DS2A 2BHVA 3CPWO 2PNGA 5DCKA 1HQBA 2JO0A 2X2BA 2GDWA 1KC8Q 1EMVA 2VLOA 4MRTC 1D1DA 4IZ6A 2EFJA 1IUQA 2JB0A 3WBHA 4COCA 2K0XA 2L4BA 1EIAA 2PEOA 1GXGA 3G4SP 4U0DA 2VSQA 3G1GA 3GKLC 2QNWA 3CCQP 2FVEA 4M0IA 3DS1A 1CEIA 5F2OA 3I55P 1YIJP 2LIWA 2M8NA 2AFEA 1Z6MA 2LOLA 1VQ8P 2AF8A 5I4TG 1L0HA 1N8RQ 3H4EA 2FACA 1BAJA 2KG9A 4H2XC 3NTEA 4U0FA 5CZDB 3VRLC 3Q20A 2AFDA 1M74A 1RNIA 2DNWA 1RO2A 4NEOA 1VQKP 1VQ7P 2KGAA 1AF8A 2VLPA 5EJDA 2N5IA 4XROA 2JAZA 2OTLP 2KOSA 1ZMBA 1VQ9P 2XXMA 2CGQA 1NJIQ 3EJEA 5KP6B 1Q86Q 3HZQA 3I56P 4XFZA 2PEQA 3GJNA 3G28A 2QA4P 2PY8A 2PEMA 4PH0A 4U0BA 2K2QA 1YITP 2E1MA 3CD6P 2K92A 1GPJA 3DS4A 3DS3A 3B5IA 2N5HA 2M8PA 2XT1A 2PENA 4GR2A 5BS2A 1VQ5P 1KQSO 1QRJA 2EHSA 5HGOA 4DG9A 2OTJP 4U0EA 2K0YA 1VQPP 4XFXA 1IMPA 3DS5A
chains in the Genus database with same CATH topology
1M6NA 2QEXP 3CMEP 3CCQP 1Q81Q 4M0IA 2P9XA 3DS1A 2OARA 1EOQA 1YJWP 3G29A 5F2OA 3CCLP 3I55P 1YIJP 1AUMA 1Q7YQ 1VQMP 3CCJP 3MGEA 2M8NA 3CCRP 1YJ9P 3CC7P 1K73Q 1VQ8P 1M6EX 4PH1A 4IPYA 5I4TG 1N8RQ 3H4EA 3CC2P 1M1KQ 2LF4A 2XV6A 3CCEP 1BAJA 3DTJA 4XFYA 1YHQP 3NTEA 3H47A 4U0FA 2EIAA 5BS1A 4WYMA 1RO0A 1Q82Q 2PEKA 1K8AQ 3VRLC 3CMAP 3CC4P 1QVFO 3Q20A 2PEIA 3G1IA 3G26A 3CCUP 2Z45A 3G0VA 2BUOA 4U0CA 1M74A 1RNIA 2Z44A 1RO2A 5F2NA 3H0DA 2M8LA 2JYLA 1VQ6P 1VQKP 1VQ7P 1W2BO 3G71P 3RG6C 4XROA 3DPHA 5JPAA 1A43A 3CXCO 2OTLP 2DGYA 3CCVP 3OW2O 2JYGA 1ZMBA 1VQ9P 2XXMA 3G21A 2CWOA 1QVGO 1NJIQ 1JJ2O 3M1MA 1Q86Q 2Z46A 4XRQA 3DS2A 3HZQA 3I56P 4XFZA 2PEQA 5HGMA 2BHVA 1M90Q 3G28A 2QA4P 2PY8A 2PEMA 5DCKA 4PH0A 4U0BA 3CPWO 1YITP 1VQLP 2E1MA 3CD6P 1K9MQ 1YJNP 2JO0A 1A8OA 1E6JP 2KODA 1KD1Q 5HGNA 3DS4A 3DS3A 1K30A 3B5IA 1S72P 1KC8Q 3HYBA 3DS5A 2ONTA 3G6EP 1VQOP 2M8PA 2XT1A 3CCSP 2PENA 1D1DA 4GR2A 1VQ4P 2EFJA 4COPA 5BS2A 1IUQA 5F2KA 1VQ5P 3P05A 3WBHA 4COCA 1VQNP 1KQSO 1QRJA 3E2DA 5HGOA 3CCMP 2PEJA 2OTJP 4U0EA 1EIAA 2PEOA 3LRYA 2EG5A 3DS0A 4GR6A 3G4SP 4QNBA 1VQPP 4XFXA 5HGLA 4U0DA 3G1GA 4U0AA 1YI2P 2L6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEI A;  5BS2 A;  2PY8 A;  2PEM A;  2PEO A;  2PEQ A;  2Z44 A;  3HYB A;  2Z46 A;  5BS1 A;  2PEN A;  4GR6 A;  2Z45 A;  3RG6 C;  4GR2 A;  2PEK A;  2PEJ A;  3Q20 A; 
#chains in the Genus database with same CATH topology
 2KG6 A;  1M6N A;  3EJB A;  1L0I A;  4HKG A;  1EOQ A;  3NY7 B;  2FQ1 A;  2KGD A;  2KW2 A;  2LKI A;  3CCR P;  1T8K A;  2K94 A;  1YJ9 P;  3CC7 P;  2FVF A;  2LL8 A;  2GYK A;  3CCE P;  2LPK A;  2FQ0 A;  1BXI A;  5BS1 A;  4WYM A;  2KOP A;  1QVF O;  5KP8 B;  2KOQ A;  3G1I A;  3G26 A;  2M5R A;  3G0V A;  2BUO A;  4U0C A;  1HY8 A;  2CG5 B;  5HV8 A;  2N6Y A;  3LMO A;  5F2N A;  2NO8 A;  2JYL A;  2KR5 A;  1UNK A;  1W2B O;  1UJZ A;  1X3O A;  2MR7 A;  2N6Z A;  2ROQ A;  5JPA A;  2DGY A;  2JYG A;  2JQ4 A;  3G21 A;  2CWO A;  1QVG O;  1JJ2 O;  3M1M A;  7CEI A;  2MVV A;  2WPT A;  4XRQ A;  1DV5 A;  2GZE A;  4H2W C;  1M90 Q;  1VQL P;  1F80 D;  5EW5 E;  1YJN P;  1A8O A;  1E6J P;  2KOD A;  1KD1 Q;  5HGN A;  3HYB A;  1AYI A;  2ONT A;  1VQO P;  2JBG A;  5F2K A;  3P05 A;  1VQN P;  1E0H A;  3E2D A;  1ACP A;  4GR6 A;  2MF4 A;  1YI2 P;  2L6E A;  3U43 A;  4PXH B;  2QEX P;  1Q81 Q;  2P9X A;  4QKO A;  2XZ0 D;  1VHN A;  1AUM A;  1Q7Y Q;  2VLQ A;  3CCJ P;  3EJD A;  1K73 Q;  4PH1 A;  4R0M A;  1DNY A;  2MR8 A;  2JGP A;  2N98 A;  1M1K Q;  2XV6 A;  4PWV B;  3DTJ A;  2K0D X;  1YHQ P;  3H47 A;  1RO0 A;  3CMA P;  2PEI A;  2KOO A;  3CCU P;  2EHT A;  2FHS C;  1GXH A;  2Z44 A;  3H0D A;  2M8L A;  2FAD A;  1VQ6 P;  3RG2 A;  2JU2 A;  3B4Q A;  3G71 P;  3CE7 A;  2L22 A;  2GZI A;  1A43 A;  2LIU A;  3CXC O;  2GDY A;  4BPF A;  3CCV P;  3OW2 O;  2XZ1 C;  4F37 A;  2FAE A;  1IMQ A;  2N50 A;  5KP7 B;  2Z46 A;  2KGC A;  2L9F A;  2VLN A;  5HGM A;  1K9M Q;  2MY5 A;  2ERH A;  1K30 A;  1S72 P;  3G6E P;  3CCS P;  4CA3 A;  2LTE A;  1VQ4 P;  4COP A;  3GZL A;  1NQ4 A;  2GDX A;  3CCM P;  2PEJ A;  2MVU A;  3LRY A;  2EG5 A;  2FQ2 A;  3DS0 A;  4QNB A;  5HGL A;  4U0A A;  1MZ8 A;  5HVC A;  1OR5 A;  3CME P;  2OAR A;  2L0Q A;  1YJW P;  4BPH A;  3G29 A;  3CCL P;  4H2Y C;  1VQM P;  3MGE A;  2K5X A;  2LML A;  2KGE A;  1M6E X;  4IPY A;  3CC2 P;  2K93 A;  2LF4 A;  1KLP A;  2GZG A;  4XFY A;  2FVA A;  2EIA A;  1Q82 Q;  2GZF A;  1VKU A;  2PEK A;  1K8A Q;  4BPG A;  3CC4 P;  1FR2 A;  2MD9 A;  2KOR A;  2Z45 A;  2GZJ A;  2KWL A;  2JU1 A;  2AVA A;  3RG6 C;  4UHP B;  3DPH A;  2KG8 A;  2CQ8 A;  2CNR A;  1ZNV A;  3GZM A;  3DS2 A;  2BHV A;  3CPW O;  2PNG A;  5DCK A;  1HQB A;  2JO0 A;  2X2B A;  2GDW A;  1KC8 Q;  1EMV A;  2VLO A;  4MRT C;  1D1D A;  4IZ6 A;  2EFJ A;  1IUQ A;  2JB0 A;  3WBH A;  4COC A;  2K0X A;  2L4B A;  1EIA A;  2PEO A;  1GXG A;  3G4S P;  4U0D A;  2VSQ A;  3G1G A;  3GKL C;  2QNW A;  3CCQ P;  2FVE A;  4M0I A;  3DS1 A;  1CEI A;  5F2O A;  3I55 P;  1YIJ P;  2LIW A;  2M8N A;  2AFE A;  1Z6M A;  2LOL A;  1VQ8 P;  2AF8 A;  5I4T G;  1L0H A;  1N8R Q;  3H4E A;  2FAC A;  1BAJ A;  2KG9 A;  4H2X C;  3NTE A;  4U0F A;  5CZD B;  3VRL C;  3Q20 A;  2AFD A;  1M74 A;  1RNI A;  2DNW A;  1RO2 A;  4NEO A;  1VQK P;  1VQ7 P;  2KGA A;  1AF8 A;  2VLP A;  5EJD A;  2N5I A;  4XRO A;  2JAZ A;  2OTL P;  2KOS A;  1ZMB A;  1VQ9 P;  2XXM A;  2CGQ A;  1NJI Q;  3EJE A;  5KP6 B;  1Q86 Q;  3HZQ A;  3I56 P;  4XFZ A;  2PEQ A;  3GJN A;  3G28 A;  2QA4 P;  2PY8 A;  2PEM A;  4PH0 A;  4U0B A;  2K2Q A;  1YIT P;  2E1M A;  3CD6 P;  2K92 A;  1GPJ A;  3DS4 A;  3DS3 A;  3B5I A;  2N5H A;  2M8P A;  2XT1 A;  2PEN A;  4GR2 A;  5BS2 A;  1VQ5 P;  1KQS O;  1QRJ A;  2EHS A;  5HGO A;  4DG9 A;  2OTJ P;  4U0E A;  2K0Y A;  1VQP P;  4XFX A;  1IMP A;  3DS5 A; 
#chains in the Genus database with same CATH homology
 1M6N A;  2QEX P;  3CME P;  3CCQ P;  1Q81 Q;  4M0I A;  2P9X A;  3DS1 A;  2OAR A;  1EOQ A;  1YJW P;  3G29 A;  5F2O A;  3CCL P;  3I55 P;  1YIJ P;  1AUM A;  1Q7Y Q;  1VQM P;  3CCJ P;  3MGE A;  2M8N A;  3CCR P;  1YJ9 P;  3CC7 P;  1K73 Q;  1VQ8 P;  1M6E X;  4PH1 A;  4IPY A;  5I4T G;  1N8R Q;  3H4E A;  3CC2 P;  1M1K Q;  2LF4 A;  2XV6 A;  3CCE P;  1BAJ A;  3DTJ A;  4XFY A;  1YHQ P;  3NTE A;  3H47 A;  4U0F A;  2EIA A;  5BS1 A;  4WYM A;  1RO0 A;  1Q82 Q;  2PEK A;  1K8A Q;  3VRL C;  3CMA P;  3CC4 P;  1QVF O;  3Q20 A;  2PEI A;  3G1I A;  3G26 A;  3CCU P;  2Z45 A;  3G0V A;  2BUO A;  4U0C A;  1M74 A;  1RNI A;  2Z44 A;  1RO2 A;  5F2N A;  3H0D A;  2M8L A;  2JYL A;  1VQ6 P;  1VQK P;  1VQ7 P;  1W2B O;  3G71 P;  3RG6 C;  4XRO A;  3DPH A;  5JPA A;  1A43 A;  3CXC O;  2OTL P;  2DGY A;  3CCV P;  3OW2 O;  2JYG A;  1ZMB A;  1VQ9 P;  2XXM A;  3G21 A;  2CWO A;  1QVG O;  1NJI Q;  1JJ2 O;  3M1M A;  1Q86 Q;  2Z46 A;  4XRQ A;  3DS2 A;  3HZQ A;  3I56 P;  4XFZ A;  2PEQ A;  5HGM A;  2BHV A;  1M90 Q;  3G28 A;  2QA4 P;  2PY8 A;  2PEM A;  5DCK A;  4PH0 A;  4U0B A;  3CPW O;  1YIT P;  1VQL P;  2E1M A;  3CD6 P;  1K9M Q;  1YJN P;  2JO0 A;  1A8O A;  1E6J P;  2KOD A;  1KD1 Q;  5HGN A;  3DS4 A;  3DS3 A;  1K30 A;  3B5I A;  1S72 P;  1KC8 Q;  3HYB A;  3DS5 A;  2ONT A;  3G6E P;  1VQO P;  2M8P A;  2XT1 A;  3CCS P;  2PEN A;  1D1D A;  4GR2 A;  1VQ4 P;  2EFJ A;  4COP A;  5BS2 A;  1IUQ A;  5F2K A;  1VQ5 P;  3P05 A;  3WBH A;  4COC A;  1VQN P;  1KQS O;  1QRJ A;  3E2D A;  5HGO A;  3CCM P;  2PEJ A;  2OTJ P;  4U0E A;  1EIA A;  2PEO A;  3LRY A;  2EG5 A;  3DS0 A;  4GR6 A;  3G4S P;  4QNB A;  1VQP P;  4XFX A;  5HGL A;  4U0D A;  3G1G A;  4U0A A;  1YI2 P;  2L6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...