2Z45A

Crystal structure of zn-bound orf134
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
109
structure length
109
Chain Sequence
FKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Crystal Structure of ORF134
rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 48
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2z45A00
2PEQA 5BS2A 2PEMA 2Z46A 4GR2A 2PENA 2PEKA 2PEJA 2PEOA 3HYBA 4GR6A 2PY8A 2PEIA 2Z45A 3Q20A 2Z44A 3RG6C 5BS1A
chains in the Genus database with same CATH superfamily
3CCSP 1E6JP 1N8RQ 1Q86Q 1AYIA 2BUOA 2JU1A 3RG2A 2MD9A 1IMQA 1KLPA 2N50A 2GZGA 1F80D 1Z6MA 2XV6A 1E0HA 1NJIQ 2KOOA 5F2NA 3DS3A 4XFZA 2PEKA 1VQNP 2VLNA 1YJ9P 1S72P 2K94A 2ONTA 4QNBA 2FAEA 2PEOA 2KGDA 2LMLA 3GZLA 3GZMA 1ACPA 2JGPA 2JYGA 3CPWO 5HV8A 2GZJA 2OTJP 1BAJA 2GZEA 2LPKA 2QA4P 2AVAA 4XRQA 2FVAA 2N6ZA 3B4QA 3G21A 4H2YC 1L0HA 2GDWA 2P9XA 1CEIA 2DNWA 3CXCO 3GJNA 1EMVA 2MR7A 3G29A 1VQ4P 1T8KA 3CE7A 2N5HA 2M8LA 3G6EP 2L0QA 1K73Q 4XFYA 1GXGA 1OR5A 2AFEA 2LTEA 2EHTA 3G71P 1FR2A 4U0EA 4COCA 2KR5A 3CCLP 4R0MA 5HGLA 1AF8A 1YHQP 1VQKP 2L22A 1VQ8P 5EW5E 4IPYA 3WBHA 1VQ9P 4U0FA 3CMAP 2PY8A 3DS0A 1K9MQ 2K0YA 1Q82Q 3NTEA 2LIUA 1GXHA 5HGOA 2LIWA 3DS1A 4CA3A 3CC2P 1X3OA 3CCEP 2MVVA 3CMEP 2KODA 2JAZA 5I4TG 3MGEA 4U0AA 4WYMA 2XZ0D 3H0DA 4DG9A 2JBGA 1VQ7P 2JO0A 2K92A 4XROA 2L4BA 3VRLC 2MR8A 2EG5A 5BS2A 5HGNA 1RO2A 7CEIA 2GZFA 1GPJA 3E2DA 4U0CA 2WPTA 2N6YA 1UNKA 1ZNVA 2K93A 3H4EA 1L0IA 3EJEA 1DNYA 1RO0A 2PEQA 2PNGA 2L6EA 1MZ8A 1DV5A 1M6NA 5KP6B 2JU2A 1W2BO 3LMOA 4UHPB 1IMPA 1YJWP 2CNRA 2Z44A 2EFJA 4HKGA 1IUQA 1QVFO 3HYBA 2DGYA 2K5XA 2KORA 2ROQA 2XXMA 4BPHA 2CG5B 1EIAA 2Z46A 3CC7P 2FHSC 2MY5A 2N98A 1YI2P 2KGCA 2GYKA 2KWLA 4MRTC 3NY7B 1Q81Q 5F2OA 3CCVP 2LL8A 2KOPA 4M0IA 2MF4A 3G4SP 4PXHB 1JJ2O 2KOSA 1YITP 5F2KA 3I56P 1Q7YQ 2QNWA 2X2BA 2GZIA 5CZDB 2VLOA 2LF4A 3CC4P 2BHVA 2KW2A 3DS2A 2FQ2A 3DS5A 2VLPA 2KG8A 2JQ4A 3RG6C 3G0VA 2M5RA 3HZQA 2LKIA 3CD6P 1VKUA 2EIAA 1HQBA 2OARA 3CCMP 1M74A 4H2WC 1YJNP 3DTJA 1KC8Q 2ERHA 2E1MA 2K2QA 4COPA 3G28A 4XFXA 3I55P 2KG9A 2KGEA 2CQ8A 3DS4A 4PWVB 4PH1A 5BS1A 2M8PA 1VQOP 2K0XA 3U43A 1BXIA 1UJZA 4IZ6A 2PEIA 2XT1A 1D1DA 1NQ4A 1VQ6P 1A43A 1KD1Q 1M1KQ 2OTLP 2QEXP 1K30A 4GR2A 5HVCA 1A8OA 2LOLA 3M1MA 2M8NA 3G1IA 2GDYA 3H47A 1VQPP 4U0DA 2VSQA 2L9FA 1YIJP 2K0DX 2CGQA 1M90Q 2PENA 3CCRP 2CWOA 2KGAA 1KQSO 3EJBA 4F37A 5HGMA 4PH0A 3Q20A 1VHNA 2KG6A 1AUMA 2AFDA 4NEOA 3P05A 2GDXA 1VQ5P 1QRJA 2FVFA 2JYLA 5EJDA 2FADA 3G1GA 5KP8B 2KOQA 3G26A 1VQMP 1K8AQ 2VLQA 1RNIA 1EOQA 3GKLC 4GR6A 3EJDA 4QKOA 4BPFA 3CCUP 2FQ1A 2AF8A 2EHSA 3DPHA 1M6EX 2PEMA 3CCJP 2PEJA 5KP7B 2XZ1C 4BPGA 2Z45A 1QVGO 2FACA 2N5IA 4H2XC 4U0BA 2JB0A 3OW2O 2MVUA 5JPAA 1HY8A 3B5IA 3CCQP 2FQ0A 3LRYA 5DCKA 1ZMBA 1VQLP 2NO8A 2FVEA
chains in the Genus database with same CATH topology
1K30A 1YHQP 1VQKP 3CCSP 1E6JP 4GR2A 1N8RQ 1Q86Q 2BUOA 1A8OA 3M1MA 2M8NA 3G1IA 1Q81Q 1VQ8P 5F2OA 4IPYA 3WBHA 3CCVP 1VQ9P 3H47A 1VQPP 4U0DA 4U0FA 3CMAP 2PY8A 3DS0A 1YIJP 1K9MQ 4M0IA 3G4SP 2XV6A 1Q82Q 3NTEA 1M90Q 2PENA 3CCRP 2CWOA 1KQSO 1JJ2O 5HGOA 3DS1A 1YITP 5F2KA 1NJIQ 5F2NA 3I56P 3DS3A 4XFZA 2PEKA 1Q7YQ 3CC2P 5HGMA 4PH0A 3Q20A 3CCEP 1VQNP 3CMEP 1AUMA 1YJ9P 2KODA 2LF4A 1S72P 2BHVA 3CC4P 3P05A 3DS2A 1QRJA 1VQ5P 2ONTA 2JYLA 5I4TG 4QNBA 3DS5A 3MGEA 2PEOA 4U0AA 4WYMA 3RG6C 3G1GA 3G0VA 3G26A 3H0DA 3HZQA 1VQMP 2JYGA 3CPWO 1K8AQ 1VQ7P 2JO0A 3CD6P 1RNIA 4XROA 1EOQA 2OTJP 4GR6A 3VRLC 1BAJA 2EG5A 2EIAA 2QA4P 2OARA 5BS2A 5HGNA 1RO2A 3CCMP 4XRQA 1M74A 3G21A 3E2DA 3CCUP 4U0CA 2P9XA 3CXCO 3H4EA 1YJNP 3DPHA 1RO0A 1M6EX 2PEQA 2L6EA 2PEMA 3DTJA 3CCJP 2PEJA 3G29A 1KC8Q 2E1MA 2Z45A 4COPA 3G28A 1VQ4P 1M6NA 4XFXA 1QVGO 1W2BO 3I55P 2M8LA 3G6EP 1YJWP 1K73Q 4U0BA 4XFYA 3DS4A 2Z44A 2EFJA 4PH1A 5BS1A 1IUQA 3OW2O 1QVFO 2M8PA 3HYBA 1VQOP 2DGYA 5JPAA 3B5IA 3CCQP 3G71P 2XXMA 4U0EA 2PEIA 2XT1A 4COCA 1D1DA 1EIAA 1VQ6P 1A43A 3LRYA 1KD1Q 2Z46A 5DCKA 2QEXP 1M1KQ 3CCLP 3CC7P 1ZMBA 2OTLP 1YI2P 5HGLA 1VQLP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEQ A;  5BS2 A;  2PEM A;  2Z46 A;  4GR2 A;  2PEN A;  2PEK A;  2PEJ A;  2PEO A;  3HYB A;  4GR6 A;  2PY8 A;  2PEI A;  2Z45 A;  3Q20 A;  2Z44 A;  3RG6 C;  5BS1 A; 
#chains in the Genus database with same CATH topology
 3CCS P;  1E6J P;  1N8R Q;  1Q86 Q;  1AYI A;  2BUO A;  2JU1 A;  3RG2 A;  2MD9 A;  1IMQ A;  1KLP A;  2N50 A;  2GZG A;  1F80 D;  1Z6M A;  2XV6 A;  1E0H A;  1NJI Q;  2KOO A;  5F2N A;  3DS3 A;  4XFZ A;  2PEK A;  1VQN P;  2VLN A;  1YJ9 P;  1S72 P;  2K94 A;  2ONT A;  4QNB A;  2FAE A;  2PEO A;  2KGD A;  2LML A;  3GZL A;  3GZM A;  1ACP A;  2JGP A;  2JYG A;  3CPW O;  5HV8 A;  2GZJ A;  2OTJ P;  1BAJ A;  2GZE A;  2LPK A;  2QA4 P;  2AVA A;  4XRQ A;  2FVA A;  2N6Z A;  3B4Q A;  3G21 A;  4H2Y C;  1L0H A;  2GDW A;  2P9X A;  1CEI A;  2DNW A;  3CXC O;  3GJN A;  1EMV A;  2MR7 A;  3G29 A;  1VQ4 P;  1T8K A;  3CE7 A;  2N5H A;  2M8L A;  3G6E P;  2L0Q A;  1K73 Q;  4XFY A;  1GXG A;  1OR5 A;  2AFE A;  2LTE A;  2EHT A;  3G71 P;  1FR2 A;  4U0E A;  4COC A;  2KR5 A;  3CCL P;  4R0M A;  5HGL A;  1AF8 A;  1YHQ P;  1VQK P;  2L22 A;  1VQ8 P;  5EW5 E;  4IPY A;  3WBH A;  1VQ9 P;  4U0F A;  3CMA P;  2PY8 A;  3DS0 A;  1K9M Q;  2K0Y A;  1Q82 Q;  3NTE A;  2LIU A;  1GXH A;  5HGO A;  2LIW A;  3DS1 A;  4CA3 A;  3CC2 P;  1X3O A;  3CCE P;  2MVV A;  3CME P;  2KOD A;  2JAZ A;  5I4T G;  3MGE A;  4U0A A;  4WYM A;  2XZ0 D;  3H0D A;  4DG9 A;  2JBG A;  1VQ7 P;  2JO0 A;  2K92 A;  4XRO A;  2L4B A;  3VRL C;  2MR8 A;  2EG5 A;  5BS2 A;  5HGN A;  1RO2 A;  7CEI A;  2GZF A;  1GPJ A;  3E2D A;  4U0C A;  2WPT A;  2N6Y A;  1UNK A;  1ZNV A;  2K93 A;  3H4E A;  1L0I A;  3EJE A;  1DNY A;  1RO0 A;  2PEQ A;  2PNG A;  2L6E A;  1MZ8 A;  1DV5 A;  1M6N A;  5KP6 B;  2JU2 A;  1W2B O;  3LMO A;  4UHP B;  1IMP A;  1YJW P;  2CNR A;  2Z44 A;  2EFJ A;  4HKG A;  1IUQ A;  1QVF O;  3HYB A;  2DGY A;  2K5X A;  2KOR A;  2ROQ A;  2XXM A;  4BPH A;  2CG5 B;  1EIA A;  2Z46 A;  3CC7 P;  2FHS C;  2MY5 A;  2N98 A;  1YI2 P;  2KGC A;  2GYK A;  2KWL A;  4MRT C;  3NY7 B;  1Q81 Q;  5F2O A;  3CCV P;  2LL8 A;  2KOP A;  4M0I A;  2MF4 A;  3G4S P;  4PXH B;  1JJ2 O;  2KOS A;  1YIT P;  5F2K A;  3I56 P;  1Q7Y Q;  2QNW A;  2X2B A;  2GZI A;  5CZD B;  2VLO A;  2LF4 A;  3CC4 P;  2BHV A;  2KW2 A;  3DS2 A;  2FQ2 A;  3DS5 A;  2VLP A;  2KG8 A;  2JQ4 A;  3RG6 C;  3G0V A;  2M5R A;  3HZQ A;  2LKI A;  3CD6 P;  1VKU A;  2EIA A;  1HQB A;  2OAR A;  3CCM P;  1M74 A;  4H2W C;  1YJN P;  3DTJ A;  1KC8 Q;  2ERH A;  2E1M A;  2K2Q A;  4COP A;  3G28 A;  4XFX A;  3I55 P;  2KG9 A;  2KGE A;  2CQ8 A;  3DS4 A;  4PWV B;  4PH1 A;  5BS1 A;  2M8P A;  1VQO P;  2K0X A;  3U43 A;  1BXI A;  1UJZ A;  4IZ6 A;  2PEI A;  2XT1 A;  1D1D A;  1NQ4 A;  1VQ6 P;  1A43 A;  1KD1 Q;  1M1K Q;  2OTL P;  2QEX P;  1K30 A;  4GR2 A;  5HVC A;  1A8O A;  2LOL A;  3M1M A;  2M8N A;  3G1I A;  2GDY A;  3H47 A;  1VQP P;  4U0D A;  2VSQ A;  2L9F A;  1YIJ P;  2K0D X;  2CGQ A;  1M90 Q;  2PEN A;  3CCR P;  2CWO A;  2KGA A;  1KQS O;  3EJB A;  4F37 A;  5HGM A;  4PH0 A;  3Q20 A;  1VHN A;  2KG6 A;  1AUM A;  2AFD A;  4NEO A;  3P05 A;  2GDX A;  1VQ5 P;  1QRJ A;  2FVF A;  2JYL A;  5EJD A;  2FAD A;  3G1G A;  5KP8 B;  2KOQ A;  3G26 A;  1VQM P;  1K8A Q;  2VLQ A;  1RNI A;  1EOQ A;  3GKL C;  4GR6 A;  3EJD A;  4QKO A;  4BPF A;  3CCU P;  2FQ1 A;  2AF8 A;  2EHS A;  3DPH A;  1M6E X;  2PEM A;  3CCJ P;  2PEJ A;  5KP7 B;  2XZ1 C;  4BPG A;  2Z45 A;  1QVG O;  2FAC A;  2N5I A;  4H2X C;  4U0B A;  2JB0 A;  3OW2 O;  2MVU A;  5JPA A;  1HY8 A;  3B5I A;  3CCQ P;  2FQ0 A;  3LRY A;  5DCK A;  1ZMB A;  1VQL P;  2NO8 A;  2FVE A; 
#chains in the Genus database with same CATH homology
 1K30 A;  1YHQ P;  1VQK P;  3CCS P;  1E6J P;  4GR2 A;  1N8R Q;  1Q86 Q;  2BUO A;  1A8O A;  3M1M A;  2M8N A;  3G1I A;  1Q81 Q;  1VQ8 P;  5F2O A;  4IPY A;  3WBH A;  3CCV P;  1VQ9 P;  3H47 A;  1VQP P;  4U0D A;  4U0F A;  3CMA P;  2PY8 A;  3DS0 A;  1YIJ P;  1K9M Q;  4M0I A;  3G4S P;  2XV6 A;  1Q82 Q;  3NTE A;  1M90 Q;  2PEN A;  3CCR P;  2CWO A;  1KQS O;  1JJ2 O;  5HGO A;  3DS1 A;  1YIT P;  5F2K A;  1NJI Q;  5F2N A;  3I56 P;  3DS3 A;  4XFZ A;  2PEK A;  1Q7Y Q;  3CC2 P;  5HGM A;  4PH0 A;  3Q20 A;  3CCE P;  1VQN P;  3CME P;  1AUM A;  1YJ9 P;  2KOD A;  2LF4 A;  1S72 P;  2BHV A;  3CC4 P;  3P05 A;  3DS2 A;  1QRJ A;  1VQ5 P;  2ONT A;  2JYL A;  5I4T G;  4QNB A;  3DS5 A;  3MGE A;  2PEO A;  4U0A A;  4WYM A;  3RG6 C;  3G1G A;  3G0V A;  3G26 A;  3H0D A;  3HZQ A;  1VQM P;  2JYG A;  3CPW O;  1K8A Q;  1VQ7 P;  2JO0 A;  3CD6 P;  1RNI A;  4XRO A;  1EOQ A;  2OTJ P;  4GR6 A;  3VRL C;  1BAJ A;  2EG5 A;  2EIA A;  2QA4 P;  2OAR A;  5BS2 A;  5HGN A;  1RO2 A;  3CCM P;  4XRQ A;  1M74 A;  3G21 A;  3E2D A;  3CCU P;  4U0C A;  2P9X A;  3CXC O;  3H4E A;  1YJN P;  3DPH A;  1RO0 A;  1M6E X;  2PEQ A;  2L6E A;  2PEM A;  3DTJ A;  3CCJ P;  2PEJ A;  3G29 A;  1KC8 Q;  2E1M A;  2Z45 A;  4COP A;  3G28 A;  1VQ4 P;  1M6N A;  4XFX A;  1QVG O;  1W2B O;  3I55 P;  2M8L A;  3G6E P;  1YJW P;  1K73 Q;  4U0B A;  4XFY A;  3DS4 A;  2Z44 A;  2EFJ A;  4PH1 A;  5BS1 A;  1IUQ A;  3OW2 O;  1QVF O;  2M8P A;  3HYB A;  1VQO P;  2DGY A;  5JPA A;  3B5I A;  3CCQ P;  3G71 P;  2XXM A;  4U0E A;  2PEI A;  2XT1 A;  4COC A;  1D1D A;  1EIA A;  1VQ6 P;  1A43 A;  3LRY A;  1KD1 Q;  2Z46 A;  5DCK A;  2QEX P;  1M1K Q;  3CCL P;  3CC7 P;  1ZMB A;  2OTL P;  1YI2 P;  5HGL A;  1VQL P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...