2Z45A

Crystal structure of zn-bound orf134
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
109
structure length
109
Chain Sequence
FKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ORF134
publication title Crystal Structure of ORF134
rcsb
source organism Synechococcus sp.
total genus 48
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2z45A00
2PEMA 3HYBA 2PEQA 2PEJA 3Q20A 5BS1A 2Z46A 3RG6C 2PENA 2PEOA 4GR6A 5BS2A 2PY8A 2Z45A 2Z44A 2PEIA 2PEKA 4GR2A
chains in the Genus database with same CATH superfamily
4U0EA 2FAEA 5HVCA 3DS4A 3DS3A 2PEOA 1M90Q 2CQ8A 2DNWA 2X2BA 3CCQP 2MY5A 2GDYA 4H2XC 3CMEP 4U0DA 3G4SP 5F2OA 2GYKA 2K0YA 2GDWA 2AFEA 1IUQA 1E6JP 2FVEA 5KP8B 2K94A 3GZLA 3I56P 2K0DX 1DNYA 4QKOA 1EIAA 2VLPA 1K30A 2N5IA 3EJDA 2N5HA 3HYBA 2PEQA 3DTJA 1IMPA 2OTJP 2LMLA 1KQSO 1Q82Q 1X3OA 2KG9A 2FVAA 1ZNVA 2KG6A 1IMQA 3CC2P 4CA3A 1UNKA 2E1MA 3CCJP 2KW2A 2KOSA 2LTEA 2Z46A 1VQOP 2BUOA 2KGDA 4HKGA 3CC7P 2LPKA 3B4QA 2CWOA 5EW5E 1VQ7P 1L0HA 3RG6C 1ZMBA 4R0MA 4XFYA 1RO2A 1T8KA 4PXHB 1K8AQ 2LOLA 1QVGO 5HV8A 3B5IA 3GJNA 2FQ2A 2EFJA 3CCVP 2MVVA 1GPJA 2VLNA 3G1GA 5KP6B 4BPFA 3EJEA 5DCKA 2VLOA 2OTLP 3DPHA 2K0XA 3G0VA 2JQ4A 2PEIA 4GR2A 3G21A 5CZDB 2XT1A 2GDXA 4UHPB 3VRLC 3CCEP 1AF8A 1DV5A 2KOQA 2N6ZA 2BHVA 2N50A 3H47A 1M74A 1GXGA 2XZ1C 1JJ2O 1E0HA 2PEMA 3CE7A 1GXHA 2L0QA 1VQ6P 1Q86Q 2QEXP 3G26A 1YIJP 4PH1A 1AYIA 1BXIA 2N6YA 2EIAA 3CCUP 3CC4P 1A43A 2AF8A 2JAZA 2GZIA 2XV6A 2CG5B 1S72P 2EHSA 1CEIA 4U0FA 1M6EX 1YITP 2KGAA 1VQMP 2EG5A 3CCLP 3CCMP 2M5RA 4H2WC 3CCSP 4BPGA 4XRQA 2L4BA 5I4TG 1HQBA 2ROQA 4QNBA 2GZJA 3G6EP 2JBGA 5BS2A 4XFZA 3EJBA 2JU2A 3H4EA 3CXCO 1VQNP 3P05A 1Q81Q 2KR5A 4XFXA 5KP7B 1VKUA 1OR5A 4COCA 2P9XA 4MRTC 1M1KQ 4COPA 4WYMA 2KWLA 2JYLA 2MD9A 3G71P 4PWVB 2LIUA 3NY7B 3RG2A 5JPAA 1UJZA 2KGCA 2L9FA 2M8LA 5HGNA 2MF4A 2GZEA 2MVUA 2MR7A 1W2BO 2K2QA 2K5XA 4U0BA 3NTEA 2DGYA 2NO8A 2JGPA 1AUMA 2M8NA 2KOOA 2PENA 2N98A 1YJNP 1QVFO 4F37A 5BS1A 1Q7YQ 2KOPA 1F80D 2PY8A 4U0AA 2JYGA 1NQ4A 2WPTA 1EMVA 4U0CA 2LL8A 2CGQA 1Z6MA 5HGLA 4GR6A 3CPWO 1L0IA 2OARA 1YJWP 2PEJA 3DS0A 1VQ9P 3G28A 2KG8A 4BPHA 1KLPA 1VQKP 4DG9A 1VQ5P 3E2DA 1A8OA 2KODA 3U43A 2FQ1A 5EJDA 1YHQP 2EHTA 5HGMA 2LF4A 1YI2P 3GKLC 1BAJA 2K93A 1RO0A 1VQPP 4IZ6A 5F2KA 4H2YC 3HZQA 3I55P 5F2NA 1QRJA 1FR2A 3DS1A 1RNIA 2FQ0A 7CEIA 2PNGA 3LRYA 4IPYA 2JU1A 2QNWA 2L22A 1YJ9P 2FHSC 3CMAP 2JO0A 2ERHA 2CNRA 3DS5A 3M1MA 5HGOA 2GZGA 1N8RQ 3G1IA 3WBHA 1VQ8P 1K73Q 2AFDA 1VQLP 3G29A 1KD1Q 1K9MQ 3Q20A 2LKIA 2FACA 1VQ4P 2M8PA 3MGEA 2KORA 1VHNA 2FADA 1MZ8A 2VSQA 2KGEA 2Z44A 4NEOA 2GZFA 1NJIQ 3GZMA 2XZ0D 2JB0A 3CD6P 1D1DA 2XXMA 3OW2O 2AVAA 2K92A 4XROA 1KC8Q 2Z45A 3DS2A 4M0IA 2MR8A 2LIWA 4PH0A 2ONTA 2QA4P 3LMOA 1ACPA 1EOQA 1HY8A 2VLQA 2L6EA 3CCRP 3H0DA 2PEKA 1M6NA 2FVFA
chains in the Genus database with same CATH topology
5HGMA 4U0EA 2EFJA 3G6EP 2LF4A 5BS2A 1YI2P 1BAJA 4XFZA 1RO0A 1VQPP 3DS4A 3H4EA 3CCVP 3DS3A 2PEOA 3CXCO 1VQNP 3G1GA 3P05A 1Q81Q 1M90Q 5F2KA 4XFXA 3CCQP 5DCKA 3HZQA 3I55P 3CMEP 5F2NA 2OTLP 3DPHA 4U0DA 1QRJA 4COCA 2P9XA 3DS1A 1RNIA 3G0VA 3G4SP 1M1KQ 4COPA 2PEIA 4WYMA 4GR2A 5F2OA 2JYLA 3G21A 3LRYA 3G71P 4IPYA 2XT1A 1IUQA 1E6JP 3VRLC 3CCEP 1YJ9P 3CMAP 2JO0A 3I56P 3DS5A 1EIAA 3M1MA 5HGOA 5JPAA 1K30A 1N8RQ 2BHVA 3H47A 3G1IA 3WBHA 1VQ8P 1M74A 1K73Q 1JJ2O 2M8LA 3G29A 2PEMA 1KD1Q 3HYBA 2PEQA 3DTJA 3Q20A 1K9MQ 1VQLP 2OTJP 5HGNA 1KQSO 1W2BO 1VQ6P 1Q86Q 2QEXP 1Q82Q 3G26A 4U0BA 2M8PA 3NTEA 1VQ4P 1YIJP 2DGYA 4PH1A 3MGEA 3CC2P 2EIAA 1AUMA 2M8NA 3CCUP 2E1MA 3CC4P 1A43A 2PENA 3CCJP 1YJNP 2Z44A 1QVFO 1NJIQ 5BS1A 1Q7YQ 2Z46A 1VQOP 2XV6A 2PY8A 1S72P 4U0AA 2BUOA 2JYGA 4U0FA 1M6EX 1YITP 3CD6P 1D1DA 1VQMP 2XXMA 2EG5A 3CCLP 4U0CA 3CC7P 3OW2O 5HGLA 4GR6A 3CPWO 3CCMP 2CWOA 2OARA 4XROA 1KC8Q 1YJWP 2PEJA 1VQ7P 3CCSP 3RG6C 1ZMBA 2Z45A 3DS0A 3DS2A 4M0IA 1VQ9P 3G28A 1RO2A 2ONTA 4XFYA 4PH0A 1K8AQ 4XRQA 2QA4P 1VQKP 1VQ5P 3E2DA 5I4TG 1A8OA 1EOQA 2KODA 1QVGO 2L6EA 3CCRP 3B5IA 1YHQP 3H0DA 2PEKA 1M6NA 4QNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEM A;  3HYB A;  2PEQ A;  2PEJ A;  3Q20 A;  5BS1 A;  2Z46 A;  3RG6 C;  2PEN A;  2PEO A;  4GR6 A;  5BS2 A;  2PY8 A;  2Z45 A;  2Z44 A;  2PEI A;  2PEK A;  4GR2 A; 
#chains in the Genus database with same CATH topology
 4U0E A;  2FAE A;  5HVC A;  3DS4 A;  3DS3 A;  2PEO A;  1M90 Q;  2CQ8 A;  2DNW A;  2X2B A;  3CCQ P;  2MY5 A;  2GDY A;  4H2X C;  3CME P;  4U0D A;  3G4S P;  5F2O A;  2GYK A;  2K0Y A;  2GDW A;  2AFE A;  1IUQ A;  1E6J P;  2FVE A;  5KP8 B;  2K94 A;  3GZL A;  3I56 P;  2K0D X;  1DNY A;  4QKO A;  1EIA A;  2VLP A;  1K30 A;  2N5I A;  3EJD A;  2N5H A;  3HYB A;  2PEQ A;  3DTJ A;  1IMP A;  2OTJ P;  2LML A;  1KQS O;  1Q82 Q;  1X3O A;  2KG9 A;  2FVA A;  1ZNV A;  2KG6 A;  1IMQ A;  3CC2 P;  4CA3 A;  1UNK A;  2E1M A;  3CCJ P;  2KW2 A;  2KOS A;  2LTE A;  2Z46 A;  1VQO P;  2BUO A;  2KGD A;  4HKG A;  3CC7 P;  2LPK A;  3B4Q A;  2CWO A;  5EW5 E;  1VQ7 P;  1L0H A;  3RG6 C;  1ZMB A;  4R0M A;  4XFY A;  1RO2 A;  1T8K A;  4PXH B;  1K8A Q;  2LOL A;  1QVG O;  5HV8 A;  3B5I A;  3GJN A;  2FQ2 A;  2EFJ A;  3CCV P;  2MVV A;  1GPJ A;  2VLN A;  3G1G A;  5KP6 B;  4BPF A;  3EJE A;  5DCK A;  2VLO A;  2OTL P;  3DPH A;  2K0X A;  3G0V A;  2JQ4 A;  2PEI A;  4GR2 A;  3G21 A;  5CZD B;  2XT1 A;  2GDX A;  4UHP B;  3VRL C;  3CCE P;  1AF8 A;  1DV5 A;  2KOQ A;  2N6Z A;  2BHV A;  2N50 A;  3H47 A;  1M74 A;  1GXG A;  2XZ1 C;  1JJ2 O;  1E0H A;  2PEM A;  3CE7 A;  1GXH A;  2L0Q A;  1VQ6 P;  1Q86 Q;  2QEX P;  3G26 A;  1YIJ P;  4PH1 A;  1AYI A;  1BXI A;  2N6Y A;  2EIA A;  3CCU P;  3CC4 P;  1A43 A;  2AF8 A;  2JAZ A;  2GZI A;  2XV6 A;  2CG5 B;  1S72 P;  2EHS A;  1CEI A;  4U0F A;  1M6E X;  1YIT P;  2KGA A;  1VQM P;  2EG5 A;  3CCL P;  3CCM P;  2M5R A;  4H2W C;  3CCS P;  4BPG A;  4XRQ A;  2L4B A;  5I4T G;  1HQB A;  2ROQ A;  4QNB A;  2GZJ A;  3G6E P;  2JBG A;  5BS2 A;  4XFZ A;  3EJB A;  2JU2 A;  3H4E A;  3CXC O;  1VQN P;  3P05 A;  1Q81 Q;  2KR5 A;  4XFX A;  5KP7 B;  1VKU A;  1OR5 A;  4COC A;  2P9X A;  4MRT C;  1M1K Q;  4COP A;  4WYM A;  2KWL A;  2JYL A;  2MD9 A;  3G71 P;  4PWV B;  2LIU A;  3NY7 B;  3RG2 A;  5JPA A;  1UJZ A;  2KGC A;  2L9F A;  2M8L A;  5HGN A;  2MF4 A;  2GZE A;  2MVU A;  2MR7 A;  1W2B O;  2K2Q A;  2K5X A;  4U0B A;  3NTE A;  2DGY A;  2NO8 A;  2JGP A;  1AUM A;  2M8N A;  2KOO A;  2PEN A;  2N98 A;  1YJN P;  1QVF O;  4F37 A;  5BS1 A;  1Q7Y Q;  2KOP A;  1F80 D;  2PY8 A;  4U0A A;  2JYG A;  1NQ4 A;  2WPT A;  1EMV A;  4U0C A;  2LL8 A;  2CGQ A;  1Z6M A;  5HGL A;  4GR6 A;  3CPW O;  1L0I A;  2OAR A;  1YJW P;  2PEJ A;  3DS0 A;  1VQ9 P;  3G28 A;  2KG8 A;  4BPH A;  1KLP A;  1VQK P;  4DG9 A;  1VQ5 P;  3E2D A;  1A8O A;  2KOD A;  3U43 A;  2FQ1 A;  5EJD A;  1YHQ P;  2EHT A;  5HGM A;  2LF4 A;  1YI2 P;  3GKL C;  1BAJ A;  2K93 A;  1RO0 A;  1VQP P;  4IZ6 A;  5F2K A;  4H2Y C;  3HZQ A;  3I55 P;  5F2N A;  1QRJ A;  1FR2 A;  3DS1 A;  1RNI A;  2FQ0 A;  7CEI A;  2PNG A;  3LRY A;  4IPY A;  2JU1 A;  2QNW A;  2L22 A;  1YJ9 P;  2FHS C;  3CMA P;  2JO0 A;  2ERH A;  2CNR A;  3DS5 A;  3M1M A;  5HGO A;  2GZG A;  1N8R Q;  3G1I A;  3WBH A;  1VQ8 P;  1K73 Q;  2AFD A;  1VQL P;  3G29 A;  1KD1 Q;  1K9M Q;  3Q20 A;  2LKI A;  2FAC A;  1VQ4 P;  2M8P A;  3MGE A;  2KOR A;  1VHN A;  2FAD A;  1MZ8 A;  2VSQ A;  2KGE A;  2Z44 A;  4NEO A;  2GZF A;  1NJI Q;  3GZM A;  2XZ0 D;  2JB0 A;  3CD6 P;  1D1D A;  2XXM A;  3OW2 O;  2AVA A;  2K92 A;  4XRO A;  1KC8 Q;  2Z45 A;  3DS2 A;  4M0I A;  2MR8 A;  2LIW A;  4PH0 A;  2ONT A;  2QA4 P;  3LMO A;  1ACP A;  1EOQ A;  1HY8 A;  2VLQ A;  2L6E A;  3CCR P;  3H0D A;  2PEK A;  1M6N A;  2FVF A; 
#chains in the Genus database with same CATH homology
 5HGM A;  4U0E A;  2EFJ A;  3G6E P;  2LF4 A;  5BS2 A;  1YI2 P;  1BAJ A;  4XFZ A;  1RO0 A;  1VQP P;  3DS4 A;  3H4E A;  3CCV P;  3DS3 A;  2PEO A;  3CXC O;  1VQN P;  3G1G A;  3P05 A;  1Q81 Q;  1M90 Q;  5F2K A;  4XFX A;  3CCQ P;  5DCK A;  3HZQ A;  3I55 P;  3CME P;  5F2N A;  2OTL P;  3DPH A;  4U0D A;  1QRJ A;  4COC A;  2P9X A;  3DS1 A;  1RNI A;  3G0V A;  3G4S P;  1M1K Q;  4COP A;  2PEI A;  4WYM A;  4GR2 A;  5F2O A;  2JYL A;  3G21 A;  3LRY A;  3G71 P;  4IPY A;  2XT1 A;  1IUQ A;  1E6J P;  3VRL C;  3CCE P;  1YJ9 P;  3CMA P;  2JO0 A;  3I56 P;  3DS5 A;  1EIA A;  3M1M A;  5HGO A;  5JPA A;  1K30 A;  1N8R Q;  2BHV A;  3H47 A;  3G1I A;  3WBH A;  1VQ8 P;  1M74 A;  1K73 Q;  1JJ2 O;  2M8L A;  3G29 A;  2PEM A;  1KD1 Q;  3HYB A;  2PEQ A;  3DTJ A;  3Q20 A;  1K9M Q;  1VQL P;  2OTJ P;  5HGN A;  1KQS O;  1W2B O;  1VQ6 P;  1Q86 Q;  2QEX P;  1Q82 Q;  3G26 A;  4U0B A;  2M8P A;  3NTE A;  1VQ4 P;  1YIJ P;  2DGY A;  4PH1 A;  3MGE A;  3CC2 P;  2EIA A;  1AUM A;  2M8N A;  3CCU P;  2E1M A;  3CC4 P;  1A43 A;  2PEN A;  3CCJ P;  1YJN P;  2Z44 A;  1QVF O;  1NJI Q;  5BS1 A;  1Q7Y Q;  2Z46 A;  1VQO P;  2XV6 A;  2PY8 A;  1S72 P;  4U0A A;  2BUO A;  2JYG A;  4U0F A;  1M6E X;  1YIT P;  3CD6 P;  1D1D A;  1VQM P;  2XXM A;  2EG5 A;  3CCL P;  4U0C A;  3CC7 P;  3OW2 O;  5HGL A;  4GR6 A;  3CPW O;  3CCM P;  2CWO A;  2OAR A;  4XRO A;  1KC8 Q;  1YJW P;  2PEJ A;  1VQ7 P;  3CCS P;  3RG6 C;  1ZMB A;  2Z45 A;  3DS0 A;  3DS2 A;  4M0I A;  1VQ9 P;  3G28 A;  1RO2 A;  2ONT A;  4XFY A;  4PH0 A;  1K8A Q;  4XRQ A;  2QA4 P;  1VQK P;  1VQ5 P;  3E2D A;  5I4T G;  1A8O A;  1EOQ A;  2KOD A;  1QVG O;  2L6E A;  3CCR P;  3B5I A;  1YHQ P;  3H0D A;  2PEK A;  1M6N A;  4QNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...