2Z45A

Crystal structure of zn-bound orf134
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
109
structure length
109
Chain Sequence
FKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of ORF134
rcsb
source organism Synechococcus sp.
molecule tags Chaperone
molecule keywords ORF134
total genus 48
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2z45A00
2PEMA 2PENA 4GR6A 2PY8A 2PEJA 2Z44A 2PEQA 3Q20A 3RG6C 2PEIA 2PEKA 2Z46A 5BS1A 5BS2A 2Z45A 2PEOA 4GR2A 3HYBA
chains in the Genus database with same CATH superfamily
7CEIA 1RO2A 1AF8A 1VQLP 3RG2A 2BUOA 2N5IA 5HV8A 2KOOA 2MF4A 2JYLA 2GDWA 4R0MA 2K2QA 2VLOA 5HGLA 2LTEA 1GXGA 2L9FA 2K93A 4QNBA 4HKGA 1YHQP 1VQNP 1OR5A 1W2BO 3H0DA 2KODA 2P9XA 3G1GA 3H47A 1M90Q 2QA4P 4COCA 1A43A 1M6NA 3P05A 3HZQA 1UNKA 2KOPA 2K0DX 2JB0A 1K30A 5JPAA 2M8NA 2ERHA 1M6EX 2FQ1A 2LIUA 2PEQA 1Q7YQ 2JGPA 1VQ5P 1YIJP 4U0AA 2EG5A 4F37A 1KD1Q 5BS2A 3GZLA 1K8AQ 2AF8A 5HVCA 3GKLC 3DS5A 3I56P 2KG9A 4XROA 3CXCO 2L22A 2JYGA 2K94A 2KG6A 1QVGO 2PY8A 3LMOA 2KWLA 1CEIA 1Q82Q 3CCLP 3G71P 3U43A 4H2YC 2NO8A 1NQ4A 1F80D 3G1IA 2GZGA 3CCQP 1VQ4P 1GPJA 4M0IA 1GXHA 1L0IA 1X3OA 2MR7A 2FVAA 2QNWA 4BPHA 1M74A 2PEMA 2MD9A 1E6JP 2KORA 1YJ9P 4UHPB 2JQ4A 4MRTC 3CMAP 2Z44A 2KOQA 5KP6B 2L6EA 4U0BA 1VQMP 3DS2A 2JAZA 4WYMA 2GDYA 2FVFA 2GZFA 3Q20A 3CCMP 3WBHA 3DTJA 3OW2O 2OARA 2JO0A 4QKOA 2N98A 3NY7B 2Z46A 1EMVA 2AFEA 2CGQA 3M1MA 4U0EA 2KOSA 1K73Q 1KQSO 3CCJP 2EFJA 1AYIA 2XXMA 3RG6C 2KGEA 1Z6MA 3HYBA 3G0VA 1VHNA 1HQBA 3NTEA 2PNGA 4IPYA 2XV6A 2JU1A 3G6EP 1BAJA 2FAEA 2AFDA 2KG8A 1VQKP 2PEKA 3H4EA 2CNRA 2AVAA 2PEIA 2GZJA 1ACPA 1NJIQ 2E1MA 4BPFA 2VLQA 4H2WC 3CMEP 3G4SP 3I55P 5HGOA 1DV5A 2PEOA 2MR8A 5DCKA 3G28A 2LKIA 1KLPA 3EJDA 2KR5A 2M8LA 1FR2A 4BPGA 1VQ8P 2K5XA 2GYKA 3DS3A 2PEJA 1S72P 2FQ0A 3CC7P 2FACA 3CC2P 2XZ1C 2MVVA 1IMQA 4PH1A 3GZMA 4GR2A 2M8PA 2WPTA 2FVEA 2XT1A 3CCRP 1M1KQ 2EHSA 4PWVB 1VQOP 2KW2A 4PH0A 2LOLA 3LRYA 2CQ8A 2MY5A 2XZ0D 2VSQA 1Q81Q 2N6YA 5F2KA 3CD6P 3DPHA 2LMLA 4NEOA 3CCVP 3CPWO 1HY8A 4PXHB 1VQ7P 1D1DA 2FQ2A 2CWOA 3EJEA 1BXIA 4XFYA 1KC8Q 4XRQA 5KP7B 2KGDA 2K0YA 3GJNA 2OTJP 2EHTA 2KGCA 3DS0A 2CG5B 1MZ8A 2ONTA 1JJ2O 1VQPP 5EJDA 2FADA 2MVUA 3DS1A 1EOQA 2LF4A 2L4BA 2GDXA 1UJZA 4XFZA 1DNYA 2K0XA 5BS1A 1A8OA 1YJWP 1E0HA 1EIAA 1VQ6P 1ZMBA 5I4TG 5CZDB 4XFXA 1VKUA 1YJNP 2N50A 4CA3A 1T8KA 5KP8B 2M5RA 2X2BA 4DG9A 2GZIA 2JU2A 2N5HA 3CC4P 2QEXP 1VQ9P 2FHSC 2DGYA 2KGAA 4U0CA 1AUMA 3CE7A 5F2NA 1K9MQ 1ZNVA 3B5IA 5F2OA 4COPA 1QRJA 2Z45A 2OTLP 1RNIA 3CCEP 2VLNA 1N8RQ 2K92A 2ROQA 1RO0A 3MGEA 3G21A 2LL8A 2PENA 1YITP 4IZ6A 4U0DA 2BHVA 5HGMA 4GR6A 3E2DA 2N6ZA 3CCSP 3G26A 2JBGA 2VLPA 2DNWA 1L0HA 3EJBA 1Q86Q 1QVFO 1YI2P 1IMPA 2L0QA 3CCUP 5HGNA 2EIAA 3B4QA 4H2XC 2GZEA 1IUQA 3DS4A 2LPKA 3G29A 4U0FA 5EW5E 3VRLC 2LIWA
chains in the Genus database with same CATH topology
1RO2A 3CCQP 1VQLP 1VQ4P 4M0IA 1NJIQ 2E1MA 5BS1A 1A8OA 1YJWP 2BUOA 1EIAA 3CMEP 3G4SP 3I55P 5HGOA 1M74A 2PEOA 1VQ6P 1ZMBA 5I4TG 2PEMA 5DCKA 3G28A 4XFXA 1E6JP 1YJNP 1YJ9P 2M8LA 3CMAP 2Z44A 2JYLA 1VQ8P 3DS3A 5HGLA 3CC4P 2PEJA 2QEXP 1VQ9P 1S72P 3CC7P 2L6EA 4QNBA 4U0BA 2DGYA 1YHQP 1VQNP 4U0CA 3CC2P 1W2BO 3H0DA 1VQMP 3DS2A 2KODA 4PH1A 1AUMA 4GR2A 2P9XA 2M8PA 3G1GA 3H47A 1M90Q 5F2NA 2QA4P 1K9MQ 4WYMA 2XT1A 4COCA 3CCRP 1M1KQ 1A43A 1M6NA 3P05A 3B5IA 3HZQA 5F2OA 3Q20A 4COPA 1QRJA 1VQOP 3CCMP 3WBHA 3DTJA 3OW2O 2OARA 2JO0A 2Z45A 4PH0A 1K30A 5JPAA 2OTLP 2M8NA 2Z46A 1RNIA 3LRYA 3CCEP 1N8RQ 1M6EX 3M1MA 4U0EA 2PEQA 1RO0A 3MGEA 1Q7YQ 1Q81Q 5F2KA 3G21A 1VQ5P 4U0AA 1YIJP 1K73Q 3CD6P 3DPHA 2EG5A 2PENA 3CCJP 1KQSO 2EFJA 3CCVP 1YITP 2XXMA 4U0DA 3RG6C 1KD1Q 5BS2A 3CPWO 1K8AQ 1VQ7P 2BHVA 5HGMA 3HYBA 1D1DA 4GR6A 2CWOA 3E2DA 3CCSP 3G0VA 4XFYA 1KC8Q 3G26A 4XRQA 3DS5A 3I56P 4XROA 3NTEA 3CXCO 2JYGA 2OTJP 4IPYA 1Q86Q 1QVGO 1QVFO 1YI2P 2PY8A 2XV6A 3DS0A 3G6EP 3CCUP 5HGNA 1BAJA 2EIAA 2ONTA 1VQKP 1JJ2O 1VQPP 2PEKA 1Q82Q 3H4EA 1IUQA 3DS4A 3CCLP 3G29A 4U0FA 3G71P 3DS1A 1EOQA 2PEIA 2LF4A 3VRLC 3G1IA 4XFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEM A;  2PEN A;  4GR6 A;  2PY8 A;  2PEJ A;  2Z44 A;  2PEQ A;  3Q20 A;  3RG6 C;  2PEI A;  2PEK A;  2Z46 A;  5BS1 A;  5BS2 A;  2Z45 A;  2PEO A;  4GR2 A;  3HYB A; 
#chains in the Genus database with same CATH topology
 7CEI A;  1RO2 A;  1AF8 A;  1VQL P;  3RG2 A;  2BUO A;  2N5I A;  5HV8 A;  2KOO A;  2MF4 A;  2JYL A;  2GDW A;  4R0M A;  2K2Q A;  2VLO A;  5HGL A;  2LTE A;  1GXG A;  2L9F A;  2K93 A;  4QNB A;  4HKG A;  1YHQ P;  1VQN P;  1OR5 A;  1W2B O;  3H0D A;  2KOD A;  2P9X A;  3G1G A;  3H47 A;  1M90 Q;  2QA4 P;  4COC A;  1A43 A;  1M6N A;  3P05 A;  3HZQ A;  1UNK A;  2KOP A;  2K0D X;  2JB0 A;  1K30 A;  5JPA A;  2M8N A;  2ERH A;  1M6E X;  2FQ1 A;  2LIU A;  2PEQ A;  1Q7Y Q;  2JGP A;  1VQ5 P;  1YIJ P;  4U0A A;  2EG5 A;  4F37 A;  1KD1 Q;  5BS2 A;  3GZL A;  1K8A Q;  2AF8 A;  5HVC A;  3GKL C;  3DS5 A;  3I56 P;  2KG9 A;  4XRO A;  3CXC O;  2L22 A;  2JYG A;  2K94 A;  2KG6 A;  1QVG O;  2PY8 A;  3LMO A;  2KWL A;  1CEI A;  1Q82 Q;  3CCL P;  3G71 P;  3U43 A;  4H2Y C;  2NO8 A;  1NQ4 A;  1F80 D;  3G1I A;  2GZG A;  3CCQ P;  1VQ4 P;  1GPJ A;  4M0I A;  1GXH A;  1L0I A;  1X3O A;  2MR7 A;  2FVA A;  2QNW A;  4BPH A;  1M74 A;  2PEM A;  2MD9 A;  1E6J P;  2KOR A;  1YJ9 P;  4UHP B;  2JQ4 A;  4MRT C;  3CMA P;  2Z44 A;  2KOQ A;  5KP6 B;  2L6E A;  4U0B A;  1VQM P;  3DS2 A;  2JAZ A;  4WYM A;  2GDY A;  2FVF A;  2GZF A;  3Q20 A;  3CCM P;  3WBH A;  3DTJ A;  3OW2 O;  2OAR A;  2JO0 A;  4QKO A;  2N98 A;  3NY7 B;  2Z46 A;  1EMV A;  2AFE A;  2CGQ A;  3M1M A;  4U0E A;  2KOS A;  1K73 Q;  1KQS O;  3CCJ P;  2EFJ A;  1AYI A;  2XXM A;  3RG6 C;  2KGE A;  1Z6M A;  3HYB A;  3G0V A;  1VHN A;  1HQB A;  3NTE A;  2PNG A;  4IPY A;  2XV6 A;  2JU1 A;  3G6E P;  1BAJ A;  2FAE A;  2AFD A;  2KG8 A;  1VQK P;  2PEK A;  3H4E A;  2CNR A;  2AVA A;  2PEI A;  2GZJ A;  1ACP A;  1NJI Q;  2E1M A;  4BPF A;  2VLQ A;  4H2W C;  3CME P;  3G4S P;  3I55 P;  5HGO A;  1DV5 A;  2PEO A;  2MR8 A;  5DCK A;  3G28 A;  2LKI A;  1KLP A;  3EJD A;  2KR5 A;  2M8L A;  1FR2 A;  4BPG A;  1VQ8 P;  2K5X A;  2GYK A;  3DS3 A;  2PEJ A;  1S72 P;  2FQ0 A;  3CC7 P;  2FAC A;  3CC2 P;  2XZ1 C;  2MVV A;  1IMQ A;  4PH1 A;  3GZM A;  4GR2 A;  2M8P A;  2WPT A;  2FVE A;  2XT1 A;  3CCR P;  1M1K Q;  2EHS A;  4PWV B;  1VQO P;  2KW2 A;  4PH0 A;  2LOL A;  3LRY A;  2CQ8 A;  2MY5 A;  2XZ0 D;  2VSQ A;  1Q81 Q;  2N6Y A;  5F2K A;  3CD6 P;  3DPH A;  2LML A;  4NEO A;  3CCV P;  3CPW O;  1HY8 A;  4PXH B;  1VQ7 P;  1D1D A;  2FQ2 A;  2CWO A;  3EJE A;  1BXI A;  4XFY A;  1KC8 Q;  4XRQ A;  5KP7 B;  2KGD A;  2K0Y A;  3GJN A;  2OTJ P;  2EHT A;  2KGC A;  3DS0 A;  2CG5 B;  1MZ8 A;  2ONT A;  1JJ2 O;  1VQP P;  5EJD A;  2FAD A;  2MVU A;  3DS1 A;  1EOQ A;  2LF4 A;  2L4B A;  2GDX A;  1UJZ A;  4XFZ A;  1DNY A;  2K0X A;  5BS1 A;  1A8O A;  1YJW P;  1E0H A;  1EIA A;  1VQ6 P;  1ZMB A;  5I4T G;  5CZD B;  4XFX A;  1VKU A;  1YJN P;  2N50 A;  4CA3 A;  1T8K A;  5KP8 B;  2M5R A;  2X2B A;  4DG9 A;  2GZI A;  2JU2 A;  2N5H A;  3CC4 P;  2QEX P;  1VQ9 P;  2FHS C;  2DGY A;  2KGA A;  4U0C A;  1AUM A;  3CE7 A;  5F2N A;  1K9M Q;  1ZNV A;  3B5I A;  5F2O A;  4COP A;  1QRJ A;  2Z45 A;  2OTL P;  1RNI A;  3CCE P;  2VLN A;  1N8R Q;  2K92 A;  2ROQ A;  1RO0 A;  3MGE A;  3G21 A;  2LL8 A;  2PEN A;  1YIT P;  4IZ6 A;  4U0D A;  2BHV A;  5HGM A;  4GR6 A;  3E2D A;  2N6Z A;  3CCS P;  3G26 A;  2JBG A;  2VLP A;  2DNW A;  1L0H A;  3EJB A;  1Q86 Q;  1QVF O;  1YI2 P;  1IMP A;  2L0Q A;  3CCU P;  5HGN A;  2EIA A;  3B4Q A;  4H2X C;  2GZE A;  1IUQ A;  3DS4 A;  2LPK A;  3G29 A;  4U0F A;  5EW5 E;  3VRL C;  2LIW A; 
#chains in the Genus database with same CATH homology
 1RO2 A;  3CCQ P;  1VQL P;  1VQ4 P;  4M0I A;  1NJI Q;  2E1M A;  5BS1 A;  1A8O A;  1YJW P;  2BUO A;  1EIA A;  3CME P;  3G4S P;  3I55 P;  5HGO A;  1M74 A;  2PEO A;  1VQ6 P;  1ZMB A;  5I4T G;  2PEM A;  5DCK A;  3G28 A;  4XFX A;  1E6J P;  1YJN P;  1YJ9 P;  2M8L A;  3CMA P;  2Z44 A;  2JYL A;  1VQ8 P;  3DS3 A;  5HGL A;  3CC4 P;  2PEJ A;  2QEX P;  1VQ9 P;  1S72 P;  3CC7 P;  2L6E A;  4QNB A;  4U0B A;  2DGY A;  1YHQ P;  1VQN P;  4U0C A;  3CC2 P;  1W2B O;  3H0D A;  1VQM P;  3DS2 A;  2KOD A;  4PH1 A;  1AUM A;  4GR2 A;  2P9X A;  2M8P A;  3G1G A;  3H47 A;  1M90 Q;  5F2N A;  2QA4 P;  1K9M Q;  4WYM A;  2XT1 A;  4COC A;  3CCR P;  1M1K Q;  1A43 A;  1M6N A;  3P05 A;  3B5I A;  3HZQ A;  5F2O A;  3Q20 A;  4COP A;  1QRJ A;  1VQO P;  3CCM P;  3WBH A;  3DTJ A;  3OW2 O;  2OAR A;  2JO0 A;  2Z45 A;  4PH0 A;  1K30 A;  5JPA A;  2OTL P;  2M8N A;  2Z46 A;  1RNI A;  3LRY A;  3CCE P;  1N8R Q;  1M6E X;  3M1M A;  4U0E A;  2PEQ A;  1RO0 A;  3MGE A;  1Q7Y Q;  1Q81 Q;  5F2K A;  3G21 A;  1VQ5 P;  4U0A A;  1YIJ P;  1K73 Q;  3CD6 P;  3DPH A;  2EG5 A;  2PEN A;  3CCJ P;  1KQS O;  2EFJ A;  3CCV P;  1YIT P;  2XXM A;  4U0D A;  3RG6 C;  1KD1 Q;  5BS2 A;  3CPW O;  1K8A Q;  1VQ7 P;  2BHV A;  5HGM A;  3HYB A;  1D1D A;  4GR6 A;  2CWO A;  3E2D A;  3CCS P;  3G0V A;  4XFY A;  1KC8 Q;  3G26 A;  4XRQ A;  3DS5 A;  3I56 P;  4XRO A;  3NTE A;  3CXC O;  2JYG A;  2OTJ P;  4IPY A;  1Q86 Q;  1QVG O;  1QVF O;  1YI2 P;  2PY8 A;  2XV6 A;  3DS0 A;  3G6E P;  3CCU P;  5HGN A;  1BAJ A;  2EIA A;  2ONT A;  1VQK P;  1JJ2 O;  1VQP P;  2PEK A;  1Q82 Q;  3H4E A;  1IUQ A;  3DS4 A;  3CCL P;  3G29 A;  4U0F A;  3G71 P;  3DS1 A;  1EOQ A;  2PEI A;  2LF4 A;  3VRL C;  3G1I A;  4XFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...