1YIJP

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yijP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yijP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yijP02
1YJ9P 1NJIQ 1M1KQ 1KD1Q 1YI2P 1YIJP 2OTJP 1VQ5P 1VQPP 3CC4P 1VQKP 1KC8Q 1N8RQ 1JJ2O 1VQ9P 2QA4P 1YHQP 3G71P 3CCJP 3CCSP 1S72P 3CD6P 1VQ6P 1Q86Q 1Q81Q 3CXCO 1YJWP 1Q82Q 3CCRP 2QEXP 3CCUP 1VQ4P 3CPWO 1YJNP 1VQ8P 1W2BO 3OW2O 1QVFO 3CMAP 2OTLP 3I55P 1KQSO 1VQMP 1Q7YQ 1K73Q 3CMEP 3G4SP 3CCEP 1M90Q 3CCQP 1VQLP 3CCLP 1VQOP 3I56P 3CC2P 1VQNP 3CC7P 3G6EP 3CCMP 1K9MQ 1QVGO 1K8AQ 3CCVP 1VQ7P 1YITP
chains in the Genus database with same CATH superfamily
1VKUA 5CJ0A 3CWBE 4C7NB 4KT0J 2V4HA 3H1KG 3LW5J 2NRGA 2M5RA 3AEFC 4PD4E 2FYZA 1KILE 1SQPE 1A02J 3H1HJ 1OWAA 1FDIA 2NZ2A 3CCVP 2OTJP 1QL2A 2HPCB 5DJUB 2KNCA 5TJHA 4TLFA 1NTZK 2H89C 1ZLLA 5KLVD 3HE4B 4C7RA 3B5IA 1X8YA 1AQ5A 4NPDA 1JY3O 2KB7P 1W5CE 5F2OA 2E76B 4LGDE 3NMDA 1DIPA 1JEKA 1XTCC 3BCCE 3EJEA 3H4EA 4PWVB 5APQA 2E75D 1D1DA 3GW6A 5AVQB 1L0LG 4HKZH 4F37A 1FR2A 2FXMA 2L91A 1ZRTD 2P58A 1EZVE 1VQNP 5HGNA 1DEEG 2GUVA 2L0QA 2KW2A 1LNQA 1GXGA 1WMKA 2A45H 1OVRA 3V2NA 2C9NY 3CCJP 1L4AB 1PP9G 3G26A 3L71G 2YMKA 4H13D 2IYPA 2GA1A 3V6IA 1LT9C 2I1JA 1PZQA 3H1IE 4XFJA 2ITAA 3IF4A 3PLNA 2WITA 1P84I 3MUDA 1SQQJ 3RG6C 2AFEA 2C9LY 1LWUC 3WBHA 2YKPA 1NKZB 1T8ZA 3FX0A 5APXA 3TNUB 2B87A 1M1JA 2E75C 5AW1B 3V4QA 2Q6QA 1BE3E 1EDKA 3IR9A 1SQPK 1RF0A 2PEMA 1QLED 2KS1B 3QWOC 2FKWB 3H1HG 3M1MA 2E74B 1T8KA 3TGUE 1KV4A 1AVYA 2RN0A 1L0NJ 2IZ0A 1AUMA 1VQ8P 1S3JA 3BRVB 1L0HA 1HWTC 1HQBA 1SQBJ 1H0TA 3Q5RA 3CXHH 3M9QA 2KOPA 2MR8A 4U3FJ 3CC2P 1FZCB 3GG2A 3AE1C 4H13C 2HFED 4UB8H 1YJ9P 5AVVB 5AVYB 4WB4A 3PH0A 1GU5A 3AE6C 1SQXE 5B66H 3B4QA 3CXHE 2OYIB 3MGEA 4IFDK 4H0LD 2IYOA 3L75D 2WWWA 3L73J 2OTLP 2GUSA 5AW6B 4UB8E 1BSNA 3I5CA 2XNDH 3P8MC 1AV1A 2Z45A 4M3LA 1OXZA 2JU1A 3GHGC 5B66E 4OWFA 3AE5C 4R4LA 3RGUA 1BXIA 1LT9A 1N8RQ 1LTJB 2YO2A 1OFCX 1FDOA 2ZT9B 3PTZA 3GKLC 2GZIA 2WSEH 1IFDA 1KB9E 1SFCB 2PEIA 2W8ZA 2VLPA 2FQ0A 1RF1B 1KILC 1KYOD 4TT3H 1LTBC 3MIWA 4WVZA 1LTIC 2HPCA 2OQQA 3L37A 1U57A 4D6TD 3AE8C 2OYHA 3HE4A 1YJNP 1USDA 1SQQG 2KZJA 2KI7B 1IK7A 2GYKA 1OX3A 2H88C 3CX5H 1SQVD 3H6PA 1NO4A 2ZXEB 1BCCE 2DW3A 1M74A 1HTLC 1VQPP 1IFNA 2PEJA 1EC5A 4OH8B 1JJ2O 1VQ6P 2FYUJ 3VTPC 3VOPA 3CX5E 1NU1J 1QGKB 3RL0B 1NTME 2NPSD 3LMOA 2R32A 2ZFCA 1L0NG 1SQBG 4RESB 1NTKJ 1DD3A 4U3FG 2ERHA 4YPCA 4H44B 1L4AA 5GTHH 2WVRA 3GHGA 2G8YA 1KMIZ 3OW2O 2FAEA 1SQXK 5APSA 1ZOYC 5HGLA 5BU8B 2I8DA 2P10A 3OJAB 2C0XA 4KHXA 3L73G 5GTHE 1N73C 1NVOA 1OW6A 1FJPA 4XE5B 2QSIA 2K37A 5KLIC 3S9OA 1HGVA 2A06E 4XFYA 1N7SD 3TNUA 5AVSB 3W68A 4BPGA 3AECC 1W2EA 2N6ZA 3T97B 3RK2B 2KS1A 3WMM0 3SWFA 1LTAC 3RK3E 3U1CA 3A7OA 1YHQP 3V2QA 1EZVG 1A43A 4RKUJ 2R3SA 3AEBC 3VP9A 3DS2A 1FE6A 1GDTA 1PPJG 3L70J 1AA0A 1FZCA 2BHVA 3TDKA 2XZ0D 2Z5HA 1KZUB 3PRJA 2WT7A 1M1KQ 5L8RJ 3FXDA 2KGDA 1M57D 1G2CB 3Q3DA 1OZHA 4U0CA 2KUBA 2XT1A 2N9YB 3KZIE 3S1KA 1BGYJ 2ZVNB 2GDWA 2FYUG 1NU1G 2HLOA 1NTMK 1GK6A 1N7SC 2O01J 5KKZB 2CPSA 1BCCJ 4B86A 5GTIH 4QNBA 3D70A 1NTKG 2KOSA 3I55P 1K73Q 2IBZE 3DS5A 2CNRA 3M0DC 1NTMJ 2QJPC 1RF1A 3HYBA 2JWAA 3G0VA 5GTIE 1IFMA 3JC22 2KSEA 1VQKP 1RH5B 2KGCA 2FXOA 4IFFA 3CLQA 2JAZA 3L74D 1VQMP 1T3UA 2L22A 1UJZA 4EIJA 2NPSA 3JSVC 2W27A 3F89A 2QJYC 1DX7A 1GPJA 3M9BA 2LIUA 3HUSC 3H1LD 5AVTB 1EDLA 2M8RA 2RMZA 1A8OA 2O1JA 1D7MA 3LW5H 1G1IA 1HJ0A 2X2BA 2ONTA 1PGJA 2M8NA 2D2CB 1L2PA 3FWNA 1M6NA 1N2DC 4L75A 5AW7B 1HGZA 1QEXA 1RE3C 1GW3A 3L70G 5EJDA 1JMMA 1FOSF 1JCDA 4QMAA 3EWKA 3HTKA 4NEOA 1U7JA 3H1KD 2W90A 1GXHA 2D2CD 2K3RA 1N7SA 7CEIA 3AEDC 1CZQA 1BGYG 4PV1B 2JO1A 2EHSA 4JF7A 3N4XA 1Q81Q 2MR7A 4PJ0H 3RBXA 2PNGA 2LXBA 1ZRTE 2KXPB 1EOQA 1BCCG 2PAJA 1RO0A 3EFGA 1E79H 2ZXXA 3MD0A 4PD4I 4BRYB 2B89A 2YIUB 3T97A 1VF5C 3NTNA 1JM0A 5CCGA 3D6YA 2XZRA 2ZYGA 2WSCJ 2J58A 1NTMG 4COCA 1OW8A 1L0LD 2I1KA 3G9RA 3KPEA 1J1EC 1IMQA 5AVXB 4H2WC 4DCKA 2BCCJ 3M06A 1NJIQ 2JB0A 1PV3A 2W6JH 2Z44A 3CPWO 1FAVA 3L71D 2Y9YA 5CJ4A 2K88A 3U1AA 1BSHA 5CBNA 3G6EP 2PRRA 1EZVI 1NQ4A 1ZV8A 2BQ1E 5KP6B 5AVZB 3L72J 5B5EH 3MUDC 3WUTA 1Q82Q 4R4MA 4ASVA 1E6JP 1ZP0C 2B9BA 2Z5IA 2WPTA 3G1IA 5KLVK 5B5EE 3H1JJ 1URQB 2IFMA 3P8CD 5APWA 1M1JC 3AE4C 2Z46A 5F2NA 3V2PA 3H1HD 1NWQA 2ZJSE 1LP1B 1RF0C 3L75E 3TSIA 3OA7A 2FVEA 3I56P 5KLVJ 1H8AA 1LWUB 1PGQA 1LGHB 2FVFA 1IFPA 4DG9A 1NTZJ 1ZW0A 1IUQA 1KYOH 1CEIA 5HVCA 2N5IA 3MP7B 2SPZA 3U59A 1J1DB 3CI9A 3GF3A 2E76D 2XV5A 1VQ7P 2XU6A 2GDXA 4KJMA 3O6QB 1KYOE 2R5DA 3RL0g 1USEA 3E2DA 1GU4A 4D6TE 5BU5A 2BCCG 1RE4A 1EDIA 4W7ZA 4EOTA 2FYNC 3NY7B 3KQGA 1SQVE 3H32B 1IJDB 5EW5E 1VPCA 4GIFA 1YYCA 1L4AD 4XROA 4H2XC 3R4YA 3HE5B 2BASA 1SQQD 1Z56A 3D6ZA 1H88A 1FDMA 3L72G 2OYHC 5HV8A 4IOIH 1GL2B 1OMIA 2AF8A 2KLUA 3DTJA 2BEZF 1KB9I 3MZWB 2XDJA 4UHPB 2WTYA 3AEEC 2XZ1C 2R44A 3CWBJ 1KN7A 1PEMA 1KILB 3H1JG 2K9JA 4BPHA 1KLPA 4QKOA 1E5WA 1IO4A 3KXDA 3GJNA 2K93A 2M8PA 1SQPJ 3MGNA 1L0ND 2GM4A 1KD1Q 1SLQA 1SQBD 2E74D 1L0IA 2WSFH 5KLVG 1GD2E 4U3FD 1VQ4P 1PEUA 4DOJA 1W2BO 4GT1A 4XA4A 1NTZG 4WY4B 2QRXA 1L4AC 1P84H 2LOLA 1S9KD 3VRLC 2E5TA 2LR2A 4XFZA 3EFFK 1FC2C 3L73D 1RNIA 1KC8Q 4C7NA 3BCCJ 4U0DA 4W7YA 3A5TA 3O8ZA 1M56D 4WY4D 2YKOA 1TU3F 1OVVA 3TF5A 3EJDA 3B5NB 2FFDB 1NGMB 2KOOA 3HRNA 1NAFA 2JGPA 1MZ9A 4IPYA 1LP1A 4IZ6A 1SQVK 5DCKA 2HG5D 3V4WA 2ZT9D 1LTTC 1GTWA 3E1RA 2WPQA 2Y0CA 1SFCD 1PPJD 2CG5B 4H0LC 3H1IJ 1VQ5P 1FZCC 2K0DX 1JY2P 3P7KA 2OYOA 2J59M 3K5BA 1QX8A 2AEMA 3SWYA 1PFIA 2E1MA 1LT1A 3CWBG 3CC7P 4RJTA 2FYUD 1FBMA 1NU1D 1BE3J 1JCCA 2W6BA 3Q5SA 4U0EA 1IZNB 4YXWH 2E42A 1SQPG 2ZAEB 4GOFA 3RL0D 2N5HA 2O01N 2FBWC 3L74E 3TGUJ 1H89A 1NTKD 4GR2A 2JO0A 5HGMA 5CBOA 2ZT9C 2QJKB 3H32A 2R5BA 4HB1A 2KLVA 3H1LE 1JY3N 1SFCC 1KQLA 4H44D 4RO0A 3BATA 1RF1C 1YQ3C 1M8OB 1AFOA 1NHLA 1SQXJ 4IL6X 4WWIA 2QIWA 3G4SP 2KZIA 3R2PA 1NYHA 1Q2NA 2IZ1A 2AXCA 3BCCG 3HD7B 3P05A 2NPSC 2VRSA 1BDDA 1N86A 2FY8A 3BRTB 4L76A 1CI6B 1P84D 2QJPB 2JKVA 4XFXA 4Y99C 1JY2O 3H1KE 3QH9A 4JQ0D 1UIIA 5KAFH 1GMJA 4CPGA 1IFJA 3A0BH 4IL6H 3U43A 4OGQB 3HD7D 4WBAA 2QVAA 2KGEA 1J2JB 3RK2D 4HKGA 3RL0C 2POHA 5CCGD 5KJ7D 1KQFB 3L70D 1VQ9P 2HODB 2M8LA 2P2UA 2OYIA 3A0BE 2JP3A 3LIEA 4IL6E 3CCUP 3H1IG 5KAIH 2A45G 2WSEJ 2PENA 4WY4A 1DEBA 4H44C 2N6YA 4U0AA 2N1TB 1WRGA 5CCHD 3WU2H 5KAIE 1BGYD 1LTJA 3H25A 1GZLA 1T6AA 2V7QH 1L0LE 3CMEP 1BE3G 2PFXA 2O3JA 3DPHA 1VQOP 1M7LA 1SFCA 4N78D 3WU2E 3CCMP 2IFNA 3B5NA 3G1GA 2N1TD 2BUOA 3VMAA 3AEGC 2K1AA 3TGUG 2KOQA 2L5GB 3LIDA 3VYIA 3G71P 3L36A 1AYIA 1Q86Q 1K30A 5TISH 5APYA 5CCGC 2MF4A 3L71E 1VQLP 1S4XA 1FJKA 3DS1A 2R3CA 5AW5B 1SQXG 4DT0A 1KORA 1OVUA 2J5UA 2KIKA 3GF7A 1CSBA 3ITKA 2XV6A 1VF5B 4EDFA 2O1KA 2GZGA 2H8PD 1OW7A 2CQ8A 1R5LA 4N6JA 3M0AA 4EYYQ 2OTKE 3H47A 1J1EB 3RK3B 5BS2A 1BDCA 2FVAA 3P8CE 3MTUE 3CCSP 3H1HE 2E5YA 4MN4C 1HUCA 1KQSO 5KKZC 1NOHA 2ZYDA 3VMZA 3LRYA 3PP5A 2PEQA 2PGDA 3M91A 4I7ZB 2MVUA 3IN6A 2AVAA 1MFTA 4YXDC 2YNYA 2DGYA 2FADA 5CMZA 1NAYA 2LTEA 5DJTB 2P67A 2EHTA 1FS0E 1MV8A 2YXQB 1DD4A 3HD7A 1L0LK 2OGUA 1GW4A 2YKQA 4PV1D 4PJ0E 4U0BA 2JBGA 1PEQA 5KJ7A 3RG2A 3GLMA 1ZR2A 2UWJE 2PP6A 2WQYC 2KOGA 4PXHB 2KSJA 4CA3A 2B87B 2LMLA 2VLQA 1JOCA 3P32A 3UIAA 2Q3IA 2D2CC 5CCHA 2FXPA 3L74G 1G2CA 2IDBA 1YTZI 1YJWP 2Q3EA 1SVFA 3VN0A 1OIPA 1H0TB 2BCCD 1PP9D 4O9BA 1M90Q 3CCQP 1SQQE 2WPSA 2YXRB 1K9MQ 1RE4C 1SP4A 2N1TA 4IFMA 2HR3A 2WMMA 3CC4P 4ASWA 2MJZA 2A06G 3AEAC 2PEOA 5HGOA 3NTEA 3EJBA 3ZDMA 4R0MA 3L72D 1UNKA 2XNXA 4AUWA 1L0NE 2QM7A 4N3YB 1MUUA 1LT9B 3H0DA 4HJGH 1NKNA 1SQBE 3D71A 2A45I 2FYNB 5KP7B 2NO8A 2YIUC 1MKMA 3N7NA 4U3FE 4HH2A 1ZNVA 2Q7CA 5JPAA 2W6AA 3H1JD 1ZMEC 1IC2A 1A02F 5APUA 1K8AQ 3BVHA 1S9KE 3DS3A 1URQD 2CK3H 3L73E 4ZNCA 2E75B 2M5AB 2KP8A 2OYHB 3KHUA 2H43A 2EIAA 2LPKA 1ACPA 1SS1A 1NTZD 2JR8A 5AW3B 3TYYA 4U0FA 4AYCA 3AE7C 5BS1A 4BXLA 1LTGC 4ZMDA 5KP8B 2FQ1A 1EXIA 3EQ2A 2IBZG 4H13B 3IAOA 1VHNA 2P9XA 1G1JA 2H7HA 2AFDA 2KK7A 3B8EB 3CXHI 3RBZA 3Q1MA 1KFMA 1EMVA 1PPJE 3DS4A 1QVGO 2M0BA 1FZBA 2KGAA 4AQRD 2K0YA 1SQQK 2JDIH 3WUVA 3KYQA 3GHGB 3GZLA 1DNYA 3SFEC 1KFNA 2AEFA 1URQC 2N50A 3GMAA 5BVZA 1LJ2A 2BEQD 4PH1A 4BRYA 1FU1A 3V5BA 2OARA 2FYUE 1KTMA 1ZN5A 1NU1E 3SWKA 3E7KA 1MFZA 2RKLA 2CGQA 2PEKA 1EQ7A 1L0NK 1R5SA 1ZMBA 2E76C 2XKMA 2P7JA 1U7MA 1SQBK 1X22A 1NTKE 3VP8A 1GL2D 2ROQA 1MZ8A 3G29A 4UB6H 3CWBD 3SFDC 1AF8A 1WT6A 1X0TA 1J1DC 1FZEA 2KR5A 4GDOA 4Z1MH 4PD4D 4H0LB 1KILD 1SQPD 2K5XA 2YO3A 2M3EA 4UB6E 2DNWA 3JCUH 2L9FA 2MY5A 3L75J 3CX5I 1CW5A 4LC1A 2WT7B 2AXTH 3IFMA 2LKMA 1GK4A 3JCUE 1S2EA 1Y8AA 1P84E 2AXTE 2WPVB 4NPEA 1KB9H 4K3AA 3BCCD 5AW4B 4DJGA 1URQA 4Y28J 2AEJA 4JBZA 1T3JA 1GL2C 3L70E 4GKGA 4ZKUA 2KYVA 1EZVD 1S1CX 1N73B 1RQVA 3CL3D 1S5LX 4D6TJ 1DV5A 2E74C 1RHZB 3B5ND 1LWUA 4U7JA 5KLIB 1T2KD 2HYNA 2FQ2A 1HJBA 2O01H 5CHXA 1SQVJ 2M5AA 2KWLA 1BGYE 1N7LA 2Q5UA 2MVVA 3CCRP 2IPPA 1QL1A 2FYUK 1K05A 5KTBA 4HYTB 1NU1K 2NPSB 3H1ID 1BAJA 2E43A 2KG9A 3BASA 1PEOA 3WUUA 3Q20A 1ZXGA 2OYIC 1YQ4C 3L4FA 3C8VA 4N78E 1S5LH 1XTGB 2EG5A 4Y99B 1AJYA 1AVOA 3O6QA 1NTKK 3VMXA 4WY4C 3B4SA 5APTA 2QG4A 1IFIA 2K0XA 1S5LE 2LXCB 4DZOA 5CZDB 1BE3D 1LTJC 4L73A 5AW0B 3S4RA 2KG8A 3M9HA 1IMPA 4BWNA 5AVWB 4ZKPA 2Z4EA 4YTPC 3TGUD 2K9YA 3FWLA 1VDFA 3L75G 3G28A 3B5NC 3B71A 3HTKB 5M1BA 1ZR4A 2FFDC 1T2KC 2LKIA 1N7SB 3HE5A 3C1LA 2L6EA 2KG6A 1GL2A 5C39A 2GZFA 2IBZI 3SSUA 1HF9A 1Q90D 1UIXA 1SQXD 2Q9IA 2WSFJ 3CXHD 4OVNF 2N98A 5E79H 1KILA 1PGPA 4JPZB 1FOSE 2CWOA 4GR6A 2EFJA 1HVVA 3TK1A 2GZJA 1RQUA 5E79E 3W67A 4D6TG 3USSA 1JUNA 3MHVA 4WYMA 2FHSC 5KAFE 2QJYB 1FZFA 2JYGA 2RH0A 3HUSB 3G3ZA 1Q7YQ 4W80A 1HY8A 1KB9D 3E1IA 1SQVG 3Q5PA 3AE9C 3KZIH 4OGQD 1DH3A 2Y9ZA 2JEEA 3V2RA 2XXMA 2WSCH 2QM8A 2QJKC 1QRJA 4A7PA 1JTHB 3F5HA 1JMBA 5K5GB 2JJLA 3CCEP 2VLOA 1KQGB 3A0HH 4BPFA 2Q1KA 2FFDA 1BCCD 5AVUB 2MD9A 1F80D 1YI2P 4PH0A 2B88A 3NFQA 2JQ4A 1NH4A 3CX5D 3HD7C 3II6A 3RK2C 3A0HE 1NTMD 1EDJA 3CMAP 1N73A 2KORA 2BCCE 1R8EA 1JO5A 1PP9E 2KODA 5KJ7C 4K35A 2WZ7A 3FGAD 1X9VA 3AE2C 5AVRB 3L74J 2ZYAA 3A3YB 5TISE 3VMYA 4XRQA 5AW9B 2KNCB 4OGQC 2W83C 3Q2YA 2VSQA 3H1LJ 4GOEA 1LTSC 1PIXA 2C0WA 1Y9BA 1PL5A 2CPBA 5CCHC 1E0HA 4JYCA 2N9BA 3L72E 4EI2A 2PY8A 3G21A 2Y0EA 1RO2A 2FACA 2VLNA 3CD6P 3A2AA 3HZQA 4COPA 2A06D 1VF5D 2N1TC 2GDYA 1Z6MA 2P1JA 3PJSK 4I2LC 1YTZT 3OAKA 2JU2A 3C9IA 3H1JE 3GZMA 1JNMA 3ABVC 5AW2B 1JB0J 3PHLA 3H1KJ 1YITP 2K92A 1YIJP 3RK3D 4M0IA 2Y0DA 4MRTC 2QEXP 5KLVE 5H2FH 1FZGA 3KDPB 2YMYA 2GZEA 1M6EX 2K94A 1RY3A 3L35A 1IK9A 1NTZE 4L74A 5H2FE 2JYLA 3M0DA 2WSSH 2JWDA 1CI6A 3AE3C 3DS0A 4JYBA 2G3AA 1M1JB 1PGOA 2MKVA 1EIAA 1EXJA 1L0LJ 5I4TG 1OR5A 1YBKA 1HH0A 1FZAA 5EFWB 2LF4A 3FXEA 2QA4P 2LIWA 2QNWA 2HODA 2V7QJ 4I1LA 5AW8B 1X79B 1K04A 1AQTA 4H2YC 2K9JB 2IBZD 3HUSA 2M3BA 3RK3C 1VL2A 1JY3P 2ZVOB 3CCLP 1PP9J 3CE7A 3H1LG 1Y47A 3L71J 2LL8A 1X3OA 1HBWA 2IX7C 2L4BA 1S72P 4I6MC 3CXCO 4I7ZC 1JTHA 1QVFO 4GODA 1KYOI 2WPRA 1RE3A 2K2QA 4NPFX 4C46A 4PV1C 2QE7H 4LLHA 4PD4H 1JY2N 5APVA 5F2KA 3NXSA
chains in the Genus database with same CATH topology
2EG5A 1NJIQ 4XFZA 1YIJP 2XXMA 3RG6C 4M0IA 1RNIA 1KC8Q 4U0BA 3E2DA 1PEQA 1YHQP 3G71P 1A8OA 3WBHA 1A43A 1Q86Q 1K30A 1QRJA 2QEXP 4U0DA 3DS2A 2Z44A 3CPWO 1YJNP 2EIAA 3G4SP 2ONTA 1M6EX 3CCEP 2M8NA 1VQLP 2BHVA 3DS1A 3G6EP 1M6NA 4U0FA 3CCVP 5BS1A 2PEMA 3P05A 1M1KQ 1M74A 1YI2P 2OTJP 4PH0A 2BQ1E 1VQPP 2JYLA 2PEJA 3M1MA 1JJ2O 4IPYA 3G28A 1VQ6P 5DCKA 1AUMA 1YJWP 1Q82Q 4XROA 2XV6A 1VQ8P 4U0CA 1E6JP 2P9XA 2XT1A 3DS0A 4XFXA 3CMAP 2KODA 1M90Q 3CCQP 2L6EA 3B5IA 3G1IA 3CC2P 1EIAA 1YITP 5I4TG 1K9MQ 3DS4A 1QVGO 5F2OA 1YJ9P 3DTJA 3H47A 1VQ5P 3CC4P 2LF4A 5BS2A 4XRQA 2Z46A 3H4EA 5F2NA 1VQ9P 1D1DA 2QA4P 2M8LA 3CCSP 2PEOA 3MGEA 5HGOA 1Q81Q 3NTEA 3CCUP 4QNBA 1PEMA 3OW2O 3VRLC 2OTLP 3I55P 1KQSO 1K73Q 2PENA 2Z45A 3DS5A 1EOQA 3LRYA 5HGLA 3CCLP 2CWOA 3I56P 1RO0A 2E1MA 2PEQA 1VQNP 4GR6A 2EFJA 2M8PA 3CC7P 5HGNA 4PH1A 3HYBA 4U0AA 3G0VA 1KD1Q 2OARA 2PY8A 3G21A 3H0DA 1VQKP 1RO2A 4U0EA 1N8RQ 4WYMA 2DGYA 4COCA 3CCJP 1S72P 3CD6P 3HZQA 2PEKA 3G26A 4COPA 3CXCO 1IUQA 2JYGA 3CCRP 1VQ4P 1PEUA 1ZMBA 1W2BO 1QVFO 4XFYA 1VQMP 1Q7YQ 3CMEP 5JPAA 1BAJA 3DPHA 4GR2A 1PEOA 2JO0A 1VQOP 5HGMA 3Q20A 2PEIA 3CCMP 3G29A 5F2KA 3G1GA 1K8AQ 2BUOA 1VQ7P 3DS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 P;  1NJI Q;  1M1K Q;  1KD1 Q;  1YI2 P;  1YIJ P;  2OTJ P;  1VQ5 P;  1VQP P;  3CC4 P;  1VQK P;  1KC8 Q;  1N8R Q;  1JJ2 O;  1VQ9 P;  2QA4 P;  1YHQ P;  3G71 P;  3CCJ P;  3CCS P;  1S72 P;  3CD6 P;  1VQ6 P;  1Q86 Q;  1Q81 Q;  3CXC O;  1YJW P;  1Q82 Q;  3CCR P;  2QEX P;  3CCU P;  1VQ4 P;  3CPW O;  1YJN P;  1VQ8 P;  1W2B O;  3OW2 O;  1QVF O;  3CMA P;  2OTL P;  3I55 P;  1KQS O;  1VQM P;  1Q7Y Q;  1K73 Q;  3CME P;  3G4S P;  3CCE P;  1M90 Q;  3CCQ P;  1VQL P;  3CCL P;  1VQO P;  3I56 P;  3CC2 P;  1VQN P;  3CC7 P;  3G6E P;  3CCM P;  1K9M Q;  1QVG O;  1K8A Q;  3CCV P;  1VQ7 P;  1YIT P; 
#chains in the Genus database with same CATH topology
 1VKU A;  5CJ0 A;  3CWB E;  4C7N B;  4KT0 J;  2V4H A;  3H1K G;  3LW5 J;  2NRG A;  2M5R A;  3AEF C;  4PD4 E;  2FYZ A;  1KIL E;  1SQP E;  1A02 J;  3H1H J;  1OWA A;  1FDI A;  2NZ2 A;  3CCV P;  2OTJ P;  1QL2 A;  2HPC B;  5DJU B;  2KNC A;  5TJH A;  4TLF A;  1NTZ K;  2H89 C;  1ZLL A;  5KLV D;  3HE4 B;  4C7R A;  3B5I A;  1X8Y A;  1AQ5 A;  4NPD A;  1JY3 O;  2KB7 P;  1W5C E;  5F2O A;  2E76 B;  4LGD E;  3NMD A;  1DIP A;  1JEK A;  1XTC C;  3BCC E;  3EJE A;  3H4E A;  4PWV B;  5APQ A;  2E75 D;  1D1D A;  3GW6 A;  5AVQ B;  1L0L G;  4HKZ H;  4F37 A;  1FR2 A;  2FXM A;  2L91 A;  1ZRT D;  2P58 A;  1EZV E;  1VQN P;  5HGN A;  1DEE G;  2GUV A;  2L0Q A;  2KW2 A;  1LNQ A;  1GXG A;  1WMK A;  2A45 H;  1OVR A;  3V2N A;  2C9N Y;  3CCJ P;  1L4A B;  1PP9 G;  3G26 A;  3L71 G;  2YMK A;  4H13 D;  2IYP A;  2GA1 A;  3V6I A;  1LT9 C;  2I1J A;  1PZQ A;  3H1I E;  4XFJ A;  2ITA A;  3IF4 A;  3PLN A;  2WIT A;  1P84 I;  3MUD A;  1SQQ J;  3RG6 C;  2AFE A;  2C9L Y;  1LWU C;  3WBH A;  2YKP A;  1NKZ B;  1T8Z A;  3FX0 A;  5APX A;  3TNU B;  2B87 A;  1M1J A;  2E75 C;  5AW1 B;  3V4Q A;  2Q6Q A;  1BE3 E;  1EDK A;  3IR9 A;  1SQP K;  1RF0 A;  2PEM A;  1QLE D;  2KS1 B;  3QWO C;  2FKW B;  3H1H G;  3M1M A;  2E74 B;  1T8K A;  3TGU E;  1KV4 A;  1AVY A;  2RN0 A;  1L0N J;  2IZ0 A;  1AUM A;  1VQ8 P;  1S3J A;  3BRV B;  1L0H A;  1HWT C;  1HQB A;  1SQB J;  1H0T A;  3Q5R A;  3CXH H;  3M9Q A;  2KOP A;  2MR8 A;  4U3F J;  3CC2 P;  1FZC B;  3GG2 A;  3AE1 C;  4H13 C;  2HFE D;  4UB8 H;  1YJ9 P;  5AVV B;  5AVY B;  4WB4 A;  3PH0 A;  1GU5 A;  3AE6 C;  1SQX E;  5B66 H;  3B4Q A;  3CXH E;  2OYI B;  3MGE A;  4IFD K;  4H0L D;  2IYO A;  3L75 D;  2WWW A;  3L73 J;  2OTL P;  2GUS A;  5AW6 B;  4UB8 E;  1BSN A;  3I5C A;  2XND H;  3P8M C;  1AV1 A;  2Z45 A;  4M3L A;  1OXZ A;  2JU1 A;  3GHG C;  5B66 E;  4OWF A;  3AE5 C;  4R4L A;  3RGU A;  1BXI A;  1LT9 A;  1N8R Q;  1LTJ B;  2YO2 A;  1OFC X;  1FDO A;  2ZT9 B;  3PTZ A;  3GKL C;  2GZI A;  2WSE H;  1IFD A;  1KB9 E;  1SFC B;  2PEI A;  2W8Z A;  2VLP A;  2FQ0 A;  1RF1 B;  1KIL C;  1KYO D;  4TT3 H;  1LTB C;  3MIW A;  4WVZ A;  1LTI C;  2HPC A;  2OQQ A;  3L37 A;  1U57 A;  4D6T D;  3AE8 C;  2OYH A;  3HE4 A;  1YJN P;  1USD A;  1SQQ G;  2KZJ A;  2KI7 B;  1IK7 A;  2GYK A;  1OX3 A;  2H88 C;  3CX5 H;  1SQV D;  3H6P A;  1NO4 A;  2ZXE B;  1BCC E;  2DW3 A;  1M74 A;  1HTL C;  1VQP P;  1IFN A;  2PEJ A;  1EC5 A;  4OH8 B;  1JJ2 O;  1VQ6 P;  2FYU J;  3VTP C;  3VOP A;  3CX5 E;  1NU1 J;  1QGK B;  3RL0 B;  1NTM E;  2NPS D;  3LMO A;  2R32 A;  2ZFC A;  1L0N G;  1SQB G;  4RES B;  1NTK J;  1DD3 A;  4U3F G;  2ERH A;  4YPC A;  4H44 B;  1L4A A;  5GTH H;  2WVR A;  3GHG A;  2G8Y A;  1KMI Z;  3OW2 O;  2FAE A;  1SQX K;  5APS A;  1ZOY C;  5HGL A;  5BU8 B;  2I8D A;  2P10 A;  3OJA B;  2C0X A;  4KHX A;  3L73 G;  5GTH E;  1N73 C;  1NVO A;  1OW6 A;  1FJP A;  4XE5 B;  2QSI A;  2K37 A;  5KLI C;  3S9O A;  1HGV A;  2A06 E;  4XFY A;  1N7S D;  3TNU A;  5AVS B;  3W68 A;  4BPG A;  3AEC C;  1W2E A;  2N6Z A;  3T97 B;  3RK2 B;  2KS1 A;  3WMM 0;  3SWF A;  1LTA C;  3RK3 E;  3U1C A;  3A7O A;  1YHQ P;  3V2Q A;  1EZV G;  1A43 A;  4RKU J;  2R3S A;  3AEB C;  3VP9 A;  3DS2 A;  1FE6 A;  1GDT A;  1PPJ G;  3L70 J;  1AA0 A;  1FZC A;  2BHV A;  3TDK A;  2XZ0 D;  2Z5H A;  1KZU B;  3PRJ A;  2WT7 A;  1M1K Q;  5L8R J;  3FXD A;  2KGD A;  1M57 D;  1G2C B;  3Q3D A;  1OZH A;  4U0C A;  2KUB A;  2XT1 A;  2N9Y B;  3KZI E;  3S1K A;  1BGY J;  2ZVN B;  2GDW A;  2FYU G;  1NU1 G;  2HLO A;  1NTM K;  1GK6 A;  1N7S C;  2O01 J;  5KKZ B;  2CPS A;  1BCC J;  4B86 A;  5GTI H;  4QNB A;  3D70 A;  1NTK G;  2KOS A;  3I55 P;  1K73 Q;  2IBZ E;  3DS5 A;  2CNR A;  3M0D C;  1NTM J;  2QJP C;  1RF1 A;  3HYB A;  2JWA A;  3G0V A;  5GTI E;  1IFM A;  3JC2 2;  2KSE A;  1VQK P;  1RH5 B;  2KGC A;  2FXO A;  4IFF A;  3CLQ A;  2JAZ A;  3L74 D;  1VQM P;  1T3U A;  2L22 A;  1UJZ A;  4EIJ A;  2NPS A;  3JSV C;  2W27 A;  3F89 A;  2QJY C;  1DX7 A;  1GPJ A;  3M9B A;  2LIU A;  3HUS C;  3H1L D;  5AVT B;  1EDL A;  2M8R A;  2RMZ A;  1A8O A;  2O1J A;  1D7M A;  3LW5 H;  1G1I A;  1HJ0 A;  2X2B A;  2ONT A;  1PGJ A;  2M8N A;  2D2C B;  1L2P A;  3FWN A;  1M6N A;  1N2D C;  4L75 A;  5AW7 B;  1HGZ A;  1QEX A;  1RE3 C;  1GW3 A;  3L70 G;  5EJD A;  1JMM A;  1FOS F;  1JCD A;  4QMA A;  3EWK A;  3HTK A;  4NEO A;  1U7J A;  3H1K D;  2W90 A;  1GXH A;  2D2C D;  2K3R A;  1N7S A;  7CEI A;  3AED C;  1CZQ A;  1BGY G;  4PV1 B;  2JO1 A;  2EHS A;  4JF7 A;  3N4X A;  1Q81 Q;  2MR7 A;  4PJ0 H;  3RBX A;  2PNG A;  2LXB A;  1ZRT E;  2KXP B;  1EOQ A;  1BCC G;  2PAJ A;  1RO0 A;  3EFG A;  1E79 H;  2ZXX A;  3MD0 A;  4PD4 I;  4BRY B;  2B89 A;  2YIU B;  3T97 A;  1VF5 C;  3NTN A;  1JM0 A;  5CCG A;  3D6Y A;  2XZR A;  2ZYG A;  2WSC J;  2J58 A;  1NTM G;  4COC A;  1OW8 A;  1L0L D;  2I1K A;  3G9R A;  3KPE A;  1J1E C;  1IMQ A;  5AVX B;  4H2W C;  4DCK A;  2BCC J;  3M06 A;  1NJI Q;  2JB0 A;  1PV3 A;  2W6J H;  2Z44 A;  3CPW O;  1FAV A;  3L71 D;  2Y9Y A;  5CJ4 A;  2K88 A;  3U1A A;  1BSH A;  5CBN A;  3G6E P;  2PRR A;  1EZV I;  1NQ4 A;  1ZV8 A;  2BQ1 E;  5KP6 B;  5AVZ B;  3L72 J;  5B5E H;  3MUD C;  3WUT A;  1Q82 Q;  4R4M A;  4ASV A;  1E6J P;  1ZP0 C;  2B9B A;  2Z5I A;  2WPT A;  3G1I A;  5KLV K;  5B5E E;  3H1J J;  1URQ B;  2IFM A;  3P8C D;  5APW A;  1M1J C;  3AE4 C;  2Z46 A;  5F2N A;  3V2P A;  3H1H D;  1NWQ A;  2ZJS E;  1LP1 B;  1RF0 C;  3L75 E;  3TSI A;  3OA7 A;  2FVE A;  3I56 P;  5KLV J;  1H8A A;  1LWU B;  1PGQ A;  1LGH B;  2FVF A;  1IFP A;  4DG9 A;  1NTZ J;  1ZW0 A;  1IUQ A;  1KYO H;  1CEI A;  5HVC A;  2N5I A;  3MP7 B;  2SPZ A;  3U59 A;  1J1D B;  3CI9 A;  3GF3 A;  2E76 D;  2XV5 A;  1VQ7 P;  2XU6 A;  2GDX A;  4KJM A;  3O6Q B;  1KYO E;  2R5D A;  3RL0 g;  1USE A;  3E2D A;  1GU4 A;  4D6T E;  5BU5 A;  2BCC G;  1RE4 A;  1EDI A;  4W7Z A;  4EOT A;  2FYN C;  3NY7 B;  3KQG A;  1SQV E;  3H32 B;  1IJD B;  5EW5 E;  1VPC A;  4GIF A;  1YYC A;  1L4A D;  4XRO A;  4H2X C;  3R4Y A;  3HE5 B;  2BAS A;  1SQQ D;  1Z56 A;  3D6Z A;  1H88 A;  1FDM A;  3L72 G;  2OYH C;  5HV8 A;  4IOI H;  1GL2 B;  1OMI A;  2AF8 A;  2KLU A;  3DTJ A;  2BEZ F;  1KB9 I;  3MZW B;  2XDJ A;  4UHP B;  2WTY A;  3AEE C;  2XZ1 C;  2R44 A;  3CWB J;  1KN7 A;  1PEM A;  1KIL B;  3H1J G;  2K9J A;  4BPH A;  1KLP A;  4QKO A;  1E5W A;  1IO4 A;  3KXD A;  3GJN A;  2K93 A;  2M8P A;  1SQP J;  3MGN A;  1L0N D;  2GM4 A;  1KD1 Q;  1SLQ A;  1SQB D;  2E74 D;  1L0I A;  2WSF H;  5KLV G;  1GD2 E;  4U3F D;  1VQ4 P;  1PEU A;  4DOJ A;  1W2B O;  4GT1 A;  4XA4 A;  1NTZ G;  4WY4 B;  2QRX A;  1L4A C;  1P84 H;  2LOL A;  1S9K D;  3VRL C;  2E5T A;  2LR2 A;  4XFZ A;  3EFF K;  1FC2 C;  3L73 D;  1RNI A;  1KC8 Q;  4C7N A;  3BCC J;  4U0D A;  4W7Y A;  3A5T A;  3O8Z A;  1M56 D;  4WY4 D;  2YKO A;  1TU3 F;  1OVV A;  3TF5 A;  3EJD A;  3B5N B;  2FFD B;  1NGM B;  2KOO A;  3HRN A;  1NAF A;  2JGP A;  1MZ9 A;  4IPY A;  1LP1 A;  4IZ6 A;  1SQV K;  5DCK A;  2HG5 D;  3V4W A;  2ZT9 D;  1LTT C;  1GTW A;  3E1R A;  2WPQ A;  2Y0C A;  1SFC D;  1PPJ D;  2CG5 B;  4H0L C;  3H1I J;  1VQ5 P;  1FZC C;  2K0D X;  1JY2 P;  3P7K A;  2OYO A;  2J59 M;  3K5B A;  1QX8 A;  2AEM A;  3SWY A;  1PFI A;  2E1M A;  1LT1 A;  3CWB G;  3CC7 P;  4RJT A;  2FYU D;  1FBM A;  1NU1 D;  1BE3 J;  1JCC A;  2W6B A;  3Q5S A;  4U0E A;  1IZN B;  4YXW H;  2E42 A;  1SQP G;  2ZAE B;  4GOF A;  3RL0 D;  2N5H A;  2O01 N;  2FBW C;  3L74 E;  3TGU J;  1H89 A;  1NTK D;  4GR2 A;  2JO0 A;  5HGM A;  5CBO A;  2ZT9 C;  2QJK B;  3H32 A;  2R5B A;  4HB1 A;  2KLV A;  3H1L E;  1JY3 N;  1SFC C;  1KQL A;  4H44 D;  4RO0 A;  3BAT A;  1RF1 C;  1YQ3 C;  1M8O B;  1AFO A;  1NHL A;  1SQX J;  4IL6 X;  4WWI A;  2QIW A;  3G4S P;  2KZI A;  3R2P A;  1NYH A;  1Q2N A;  2IZ1 A;  2AXC A;  3BCC G;  3HD7 B;  3P05 A;  2NPS C;  2VRS A;  1BDD A;  1N86 A;  2FY8 A;  3BRT B;  4L76 A;  1CI6 B;  1P84 D;  2QJP B;  2JKV A;  4XFX A;  4Y99 C;  1JY2 O;  3H1K E;  3QH9 A;  4JQ0 D;  1UII A;  5KAF H;  1GMJ A;  4CPG A;  1IFJ A;  3A0B H;  4IL6 H;  3U43 A;  4OGQ B;  3HD7 D;  4WBA A;  2QVA A;  2KGE A;  1J2J B;  3RK2 D;  4HKG A;  3RL0 C;  2POH A;  5CCG D;  5KJ7 D;  1KQF B;  3L70 D;  1VQ9 P;  2HOD B;  2M8L A;  2P2U A;  2OYI A;  3A0B E;  2JP3 A;  3LIE A;  4IL6 E;  3CCU P;  3H1I G;  5KAI H;  2A45 G;  2WSE J;  2PEN A;  4WY4 A;  1DEB A;  4H44 C;  2N6Y A;  4U0A A;  2N1T B;  1WRG A;  5CCH D;  3WU2 H;  5KAI E;  1BGY D;  1LTJ A;  3H25 A;  1GZL A;  1T6A A;  2V7Q H;  1L0L E;  3CME P;  1BE3 G;  2PFX A;  2O3J A;  3DPH A;  1VQO P;  1M7L A;  1SFC A;  4N78 D;  3WU2 E;  3CCM P;  2IFN A;  3B5N A;  3G1G A;  2N1T D;  2BUO A;  3VMA A;  3AEG C;  2K1A A;  3TGU G;  2KOQ A;  2L5G B;  3LID A;  3VYI A;  3G71 P;  3L36 A;  1AYI A;  1Q86 Q;  1K30 A;  5TIS H;  5APY A;  5CCG C;  2MF4 A;  3L71 E;  1VQL P;  1S4X A;  1FJK A;  3DS1 A;  2R3C A;  5AW5 B;  1SQX G;  4DT0 A;  1KOR A;  1OVU A;  2J5U A;  2KIK A;  3GF7 A;  1CSB A;  3ITK A;  2XV6 A;  1VF5 B;  4EDF A;  2O1K A;  2GZG A;  2H8P D;  1OW7 A;  2CQ8 A;  1R5L A;  4N6J A;  3M0A A;  4EYY Q;  2OTK E;  3H47 A;  1J1E B;  3RK3 B;  5BS2 A;  1BDC A;  2FVA A;  3P8C E;  3MTU E;  3CCS P;  3H1H E;  2E5Y A;  4MN4 C;  1HUC A;  1KQS O;  5KKZ C;  1NOH A;  2ZYD A;  3VMZ A;  3LRY A;  3PP5 A;  2PEQ A;  2PGD A;  3M91 A;  4I7Z B;  2MVU A;  3IN6 A;  2AVA A;  1MFT A;  4YXD C;  2YNY A;  2DGY A;  2FAD A;  5CMZ A;  1NAY A;  2LTE A;  5DJT B;  2P67 A;  2EHT A;  1FS0 E;  1MV8 A;  2YXQ B;  1DD4 A;  3HD7 A;  1L0L K;  2OGU A;  1GW4 A;  2YKQ A;  4PV1 D;  4PJ0 E;  4U0B A;  2JBG A;  1PEQ A;  5KJ7 A;  3RG2 A;  3GLM A;  1ZR2 A;  2UWJ E;  2PP6 A;  2WQY C;  2KOG A;  4PXH B;  2KSJ A;  4CA3 A;  2B87 B;  2LML A;  2VLQ A;  1JOC A;  3P32 A;  3UIA A;  2Q3I A;  2D2C C;  5CCH A;  2FXP A;  3L74 G;  1G2C A;  2IDB A;  1YTZ I;  1YJW P;  2Q3E A;  1SVF A;  3VN0 A;  1OIP A;  1H0T B;  2BCC D;  1PP9 D;  4O9B A;  1M90 Q;  3CCQ P;  1SQQ E;  2WPS A;  2YXR B;  1K9M Q;  1RE4 C;  1SP4 A;  2N1T A;  4IFM A;  2HR3 A;  2WMM A;  3CC4 P;  4ASW A;  2MJZ A;  2A06 G;  3AEA C;  2PEO A;  5HGO A;  3NTE A;  3EJB A;  3ZDM A;  4R0M A;  3L72 D;  1UNK A;  2XNX A;  4AUW A;  1L0N E;  2QM7 A;  4N3Y B;  1MUU A;  1LT9 B;  3H0D A;  4HJG H;  1NKN A;  1SQB E;  3D71 A;  2A45 I;  2FYN B;  5KP7 B;  2NO8 A;  2YIU C;  1MKM A;  3N7N A;  4U3F E;  4HH2 A;  1ZNV A;  2Q7C A;  5JPA A;  2W6A A;  3H1J D;  1ZME C;  1IC2 A;  1A02 F;  5APU A;  1K8A Q;  3BVH A;  1S9K E;  3DS3 A;  1URQ D;  2CK3 H;  3L73 E;  4ZNC A;  2E75 B;  2M5A B;  2KP8 A;  2OYH B;  3KHU A;  2H43 A;  2EIA A;  2LPK A;  1ACP A;  1SS1 A;  1NTZ D;  2JR8 A;  5AW3 B;  3TYY A;  4U0F A;  4AYC A;  3AE7 C;  5BS1 A;  4BXL A;  1LTG C;  4ZMD A;  5KP8 B;  2FQ1 A;  1EXI A;  3EQ2 A;  2IBZ G;  4H13 B;  3IAO A;  1VHN A;  2P9X A;  1G1J A;  2H7H A;  2AFD A;  2KK7 A;  3B8E B;  3CXH I;  3RBZ A;  3Q1M A;  1KFM A;  1EMV A;  1PPJ E;  3DS4 A;  1QVG O;  2M0B A;  1FZB A;  2KGA A;  4AQR D;  2K0Y A;  1SQQ K;  2JDI H;  3WUV A;  3KYQ A;  3GHG B;  3GZL A;  1DNY A;  3SFE C;  1KFN A;  2AEF A;  1URQ C;  2N50 A;  3GMA A;  5BVZ A;  1LJ2 A;  2BEQ D;  4PH1 A;  4BRY A;  1FU1 A;  3V5B A;  2OAR A;  2FYU E;  1KTM A;  1ZN5 A;  1NU1 E;  3SWK A;  3E7K A;  1MFZ A;  2RKL A;  2CGQ A;  2PEK A;  1EQ7 A;  1L0N K;  1R5S A;  1ZMB A;  2E76 C;  2XKM A;  2P7J A;  1U7M A;  1SQB K;  1X22 A;  1NTK E;  3VP8 A;  1GL2 D;  2ROQ A;  1MZ8 A;  3G29 A;  4UB6 H;  3CWB D;  3SFD C;  1AF8 A;  1WT6 A;  1X0T A;  1J1D C;  1FZE A;  2KR5 A;  4GDO A;  4Z1M H;  4PD4 D;  4H0L B;  1KIL D;  1SQP D;  2K5X A;  2YO3 A;  2M3E A;  4UB6 E;  2DNW A;  3JCU H;  2L9F A;  2MY5 A;  3L75 J;  3CX5 I;  1CW5 A;  4LC1 A;  2WT7 B;  2AXT H;  3IFM A;  2LKM A;  1GK4 A;  3JCU E;  1S2E A;  1Y8A A;  1P84 E;  2AXT E;  2WPV B;  4NPE A;  1KB9 H;  4K3A A;  3BCC D;  5AW4 B;  4DJG A;  1URQ A;  4Y28 J;  2AEJ A;  4JBZ A;  1T3J A;  1GL2 C;  3L70 E;  4GKG A;  4ZKU A;  2KYV A;  1EZV D;  1S1C X;  1N73 B;  1RQV A;  3CL3 D;  1S5L X;  4D6T J;  1DV5 A;  2E74 C;  1RHZ B;  3B5N D;  1LWU A;  4U7J A;  5KLI B;  1T2K D;  2HYN A;  2FQ2 A;  1HJB A;  2O01 H;  5CHX A;  1SQV J;  2M5A A;  2KWL A;  1BGY E;  1N7L A;  2Q5U A;  2MVV A;  3CCR P;  2IPP A;  1QL1 A;  2FYU K;  1K05 A;  5KTB A;  4HYT B;  1NU1 K;  2NPS B;  3H1I D;  1BAJ A;  2E43 A;  2KG9 A;  3BAS A;  1PEO A;  3WUU A;  3Q20 A;  1ZXG A;  2OYI C;  1YQ4 C;  3L4F A;  3C8V A;  4N78 E;  1S5L H;  1XTG B;  2EG5 A;  4Y99 B;  1AJY A;  1AVO A;  3O6Q A;  1NTK K;  3VMX A;  4WY4 C;  3B4S A;  5APT A;  2QG4 A;  1IFI A;  2K0X A;  1S5L E;  2LXC B;  4DZO A;  5CZD B;  1BE3 D;  1LTJ C;  4L73 A;  5AW0 B;  3S4R A;  2KG8 A;  3M9H A;  1IMP A;  4BWN A;  5AVW B;  4ZKP A;  2Z4E A;  4YTP C;  3TGU D;  2K9Y A;  3FWL A;  1VDF A;  3L75 G;  3G28 A;  3B5N C;  3B71 A;  3HTK B;  5M1B A;  1ZR4 A;  2FFD C;  1T2K C;  2LKI A;  1N7S B;  3HE5 A;  3C1L A;  2L6E A;  2KG6 A;  1GL2 A;  5C39 A;  2GZF A;  2IBZ I;  3SSU A;  1HF9 A;  1Q90 D;  1UIX A;  1SQX D;  2Q9I A;  2WSF J;  3CXH D;  4OVN F;  2N98 A;  5E79 H;  1KIL A;  1PGP A;  4JPZ B;  1FOS E;  2CWO A;  4GR6 A;  2EFJ A;  1HVV A;  3TK1 A;  2GZJ A;  1RQU A;  5E79 E;  3W67 A;  4D6T G;  3USS A;  1JUN A;  3MHV A;  4WYM A;  2FHS C;  5KAF E;  2QJY B;  1FZF A;  2JYG A;  2RH0 A;  3HUS B;  3G3Z A;  1Q7Y Q;  4W80 A;  1HY8 A;  1KB9 D;  3E1I A;  1SQV G;  3Q5P A;  3AE9 C;  3KZI H;  4OGQ D;  1DH3 A;  2Y9Z A;  2JEE A;  3V2R A;  2XXM A;  2WSC H;  2QM8 A;  2QJK C;  1QRJ A;  4A7P A;  1JTH B;  3F5H A;  1JMB A;  5K5G B;  2JJL A;  3CCE P;  2VLO A;  1KQG B;  3A0H H;  4BPF A;  2Q1K A;  2FFD A;  1BCC D;  5AVU B;  2MD9 A;  1F80 D;  1YI2 P;  4PH0 A;  2B88 A;  3NFQ A;  2JQ4 A;  1NH4 A;  3CX5 D;  3HD7 C;  3II6 A;  3RK2 C;  3A0H E;  1NTM D;  1EDJ A;  3CMA P;  1N73 A;  2KOR A;  2BCC E;  1R8E A;  1JO5 A;  1PP9 E;  2KOD A;  5KJ7 C;  4K35 A;  2WZ7 A;  3FGA D;  1X9V A;  3AE2 C;  5AVR B;  3L74 J;  2ZYA A;  3A3Y B;  5TIS E;  3VMY A;  4XRQ A;  5AW9 B;  2KNC B;  4OGQ C;  2W83 C;  3Q2Y A;  2VSQ A;  3H1L J;  4GOE A;  1LTS C;  1PIX A;  2C0W A;  1Y9B A;  1PL5 A;  2CPB A;  5CCH C;  1E0H A;  4JYC A;  2N9B A;  3L72 E;  4EI2 A;  2PY8 A;  3G21 A;  2Y0E A;  1RO2 A;  2FAC A;  2VLN A;  3CD6 P;  3A2A A;  3HZQ A;  4COP A;  2A06 D;  1VF5 D;  2N1T C;  2GDY A;  1Z6M A;  2P1J A;  3PJS K;  4I2L C;  1YTZ T;  3OAK A;  2JU2 A;  3C9I A;  3H1J E;  3GZM A;  1JNM A;  3ABV C;  5AW2 B;  1JB0 J;  3PHL A;  3H1K J;  1YIT P;  2K92 A;  1YIJ P;  3RK3 D;  4M0I A;  2Y0D A;  4MRT C;  2QEX P;  5KLV E;  5H2F H;  1FZG A;  3KDP B;  2YMY A;  2GZE A;  1M6E X;  2K94 A;  1RY3 A;  3L35 A;  1IK9 A;  1NTZ E;  4L74 A;  5H2F E;  2JYL A;  3M0D A;  2WSS H;  2JWD A;  1CI6 A;  3AE3 C;  3DS0 A;  4JYB A;  2G3A A;  1M1J B;  1PGO A;  2MKV A;  1EIA A;  1EXJ A;  1L0L J;  5I4T G;  1OR5 A;  1YBK A;  1HH0 A;  1FZA A;  5EFW B;  2LF4 A;  3FXE A;  2QA4 P;  2LIW A;  2QNW A;  2HOD A;  2V7Q J;  4I1L A;  5AW8 B;  1X79 B;  1K04 A;  1AQT A;  4H2Y C;  2K9J B;  2IBZ D;  3HUS A;  2M3B A;  3RK3 C;  1VL2 A;  1JY3 P;  2ZVO B;  3CCL P;  1PP9 J;  3CE7 A;  3H1L G;  1Y47 A;  3L71 J;  2LL8 A;  1X3O A;  1HBW A;  2IX7 C;  2L4B A;  1S72 P;  4I6M C;  3CXC O;  4I7Z C;  1JTH A;  1QVF O;  4GOD A;  1KYO I;  2WPR A;  1RE3 A;  2K2Q A;  4NPF X;  4C46 A;  4PV1 C;  2QE7 H;  4LLH A;  4PD4 H;  1JY2 N;  5APV A;  5F2K A;  3NXS A; 
#chains in the Genus database with same CATH homology
 2EG5 A;  1NJI Q;  4XFZ A;  1YIJ P;  2XXM A;  3RG6 C;  4M0I A;  1RNI A;  1KC8 Q;  4U0B A;  3E2D A;  1PEQ A;  1YHQ P;  3G71 P;  1A8O A;  3WBH A;  1A43 A;  1Q86 Q;  1K30 A;  1QRJ A;  2QEX P;  4U0D A;  3DS2 A;  2Z44 A;  3CPW O;  1YJN P;  2EIA A;  3G4S P;  2ONT A;  1M6E X;  3CCE P;  2M8N A;  1VQL P;  2BHV A;  3DS1 A;  3G6E P;  1M6N A;  4U0F A;  3CCV P;  5BS1 A;  2PEM A;  3P05 A;  1M1K Q;  1M74 A;  1YI2 P;  2OTJ P;  4PH0 A;  2BQ1 E;  1VQP P;  2JYL A;  2PEJ A;  3M1M A;  1JJ2 O;  4IPY A;  3G28 A;  1VQ6 P;  5DCK A;  1AUM A;  1YJW P;  1Q82 Q;  4XRO A;  2XV6 A;  1VQ8 P;  4U0C A;  1E6J P;  2P9X A;  2XT1 A;  3DS0 A;  4XFX A;  3CMA P;  2KOD A;  1M90 Q;  3CCQ P;  2L6E A;  3B5I A;  3G1I A;  3CC2 P;  1EIA A;  1YIT P;  5I4T G;  1K9M Q;  3DS4 A;  1QVG O;  5F2O A;  1YJ9 P;  3DTJ A;  3H47 A;  1VQ5 P;  3CC4 P;  2LF4 A;  5BS2 A;  4XRQ A;  2Z46 A;  3H4E A;  5F2N A;  1VQ9 P;  1D1D A;  2QA4 P;  2M8L A;  3CCS P;  2PEO A;  3MGE A;  5HGO A;  1Q81 Q;  3NTE A;  3CCU P;  4QNB A;  1PEM A;  3OW2 O;  3VRL C;  2OTL P;  3I55 P;  1KQS O;  1K73 Q;  2PEN A;  2Z45 A;  3DS5 A;  1EOQ A;  3LRY A;  5HGL A;  3CCL P;  2CWO A;  3I56 P;  1RO0 A;  2E1M A;  2PEQ A;  1VQN P;  4GR6 A;  2EFJ A;  2M8P A;  3CC7 P;  5HGN A;  4PH1 A;  3HYB A;  4U0A A;  3G0V A;  1KD1 Q;  2OAR A;  2PY8 A;  3G21 A;  3H0D A;  1VQK P;  1RO2 A;  4U0E A;  1N8R Q;  4WYM A;  2DGY A;  4COC A;  3CCJ P;  1S72 P;  3CD6 P;  3HZQ A;  2PEK A;  3G26 A;  4COP A;  3CXC O;  1IUQ A;  2JYG A;  3CCR P;  1VQ4 P;  1PEU A;  1ZMB A;  1W2B O;  1QVF O;  4XFY A;  1VQM P;  1Q7Y Q;  3CME P;  5JPA A;  1BAJ A;  3DPH A;  4GR2 A;  1PEO A;  2JO0 A;  1VQO P;  5HGM A;  3Q20 A;  2PEI A;  3CCM P;  3G29 A;  5F2K A;  3G1G A;  1K8A Q;  2BUO A;  1VQ7 P;  3DS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...