1YIJP

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yijP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yijP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yijP02
1QVFO 1KC8Q 1YI2P 3CD6P 1NJIQ 3I55P 3CCVP 1KD1Q 1VQ8P 3OW2O 1VQMP 2QA4P 1VQ7P 3CCEP 3CC4P 1VQ4P 3CXCO 3G6EP 1VQ5P 3CMEP 1Q82Q 1VQNP 3G4SP 3CCMP 1YJ9P 1VQ9P 3CC2P 1KQSO 3CCRP 1YJNP 1M1KQ 1Q86Q 3G71P 1M90Q 2OTJP 3I56P 3CCUP 1S72P 3CCSP 1YHQP 1K73Q 1K8AQ 1VQOP 1VQLP 1N8RQ 3CPWO 2QEXP 1JJ2O 2OTLP 1K9MQ 1VQ6P 1QVGO 1YJWP 1W2BO 3CCLP 1YIJP 1YITP 1Q81Q 1VQPP 1VQKP 3CMAP 1Q7YQ 3CCJP 3CC7P 3CCQP
chains in the Genus database with same CATH superfamily
1M57D 2WPTA 4WY4B 2GM4A 2WWWA 3USSA 3Q3DA 4XFZA 5KP6B 2P9XA 4WYMA 3M0DA 1JY2O 1GU5A 2N50A 1IFPA 2OTKE 2WSFH 5GTIH 3CWBD 1D1DA 3R2PA 3B71A 1YIJP 3BASA 2ZT9C 3SSUA 3H1LD 1T2KC 2WPSA 3CCEP 1JB0J 3G6EP 2LL8A 1VQ9P 1AF8A 1SFCB 3AEDC 1TU3F 4RESB 2GZJA 1NU1G 1L4AC 5AW1B 2Q3EA 1SQXK 1L0LK 2E76D 1IFIA 1BE3E 1FZCC 4DCKA 1SQVD 3GHGC 1KMIZ 1L0HA 2LIWA 2M5AB 3VMXA 1KYOI 1YJ9P 2N5HA 3TNUB 2LXCB 1M90Q 2XXMA 3MTUE 1LT9A 2JP3A 2E76B 1P84E 1JY3N 4I6MC 4U3FG 5F2NA 3PHLA 3DS5A 3GF7A 4YPCA 1SQQD 1R5LA 2E42A 2QJKC 1OW8A 1VQNP 5AW2B 1KYOD 3LRYA 4NPFX 1GW3A 3AE9C 4QKOA 2QEXP 2YIUB 1S4XA 1NTZG 1Y47A 3PTZA 3CI9A 3KPEA 2ZFCA 3NTNA 1PL5A 5CCGA 3C8VA 2Q3IA 1VQMP 2NPSB 3SWFA 2WSEH 2LKIA 5M1BA 2FAEA 1EZVG 1JTHB 2WT7A 2OYHB 1L0NE 1X79B 3AEEC 2WITA 1KILD 4NPEA 1VF5D 5KAFE 1FZEA 3P7KA 2FYUE 3TNUA 5AW6B 1JMBA 4I2LC 1T8ZA 3L70G 1RQUA 4MN4C 3H1LG 5BU8B 3MHVA 3H1IG 1BGYD 1SQBD 3L75D 3H25A 2K2QA 2EIAA 3C9IA 3DS4A 4GOFA 1LTJA 4U7JA 1P84I 3A0HE 2JWAA 4U3FD 3G1GA 5BU5A 2M3BA 2M8NA 2XU6A 1KN7A 3AEGC 4H2WC 2R5BA 2EHSA 1RF0C 3CXHH 3TGUG 5AVRB 3VN0A 2A06G 4EYYQ 2OTJP 5APTA 2EFJA 1IMQA 3B4QA 4PD4D 1Q7YQ 3F5HA 4L76A 4NEOA 2FYUK 2PP6A 5AW5B 3B5NA 2ZYDA 2VLPA 4WY4D 1KQSO 3P32A 1GDTA 1LJ2A 4WBAA 4BPFA 1A43A 4UB8E 2EHTA 2MVUA 1QEXA 5DJTB 2N9BA 1HQBA 4IFDK 3HTKB 4OVNF 1SQQG 1S5LH 2KSEA 4BRYA 3RBZA 2E74B 1N7LA 1PV3A 4R4LA 3GZLA 3OW2O 3H1KE 3L36A 2GDYA 2KODA 1SQPK 3H0DA 1ACPA 3S4RA 2WPRA 1AVYA 4PV1C 1FC2C 1NTKE 3G1IA 3VYIA 1OW6A 4HB1A 5CZDB 4IL6E 2V7QH 2FXMA 3CCJP 2Q7CA 3H4EA 1UIXA 1NU1E 1K05A 1L0LJ 2DNWA 3RK3D 1BSHA 3PLNA 2P10A 1BGYG 1FAVA 3IAOA 5B5EH 1LGHB 2YO2A 2K0XA 2AEFA 4GODA 3TGUE 4PJ0E 1NKZB 1K8AQ 2JO0A 1USDA 1RF1B 2FVFA 1DNYA 1KQGB 4TT3H 3S1KA 2Q6QA 2SPZA 1SQVK 2GDXA 1R5SA 3DS3A 3CCMP 2WZ7A 4HKZH 5KLIB 1QGKB 2OYIB 4IFFA 4XRQA 2LTEA 3W68A 1DIPA 2OQQA 1OFCX 1KYOH 3CMAP 2E43A 1LP1B 4PH1A 1NTMK 1DEEG 3V2NA 3F89A 2G8YA 1S1CX 1PGQA 5KJ7C 4U0EA 3L71G 5E79E 3FWNA 1SLQA 5CBOA 1VQLP 2E75B 5I4TG 1PP9J 2ZYGA 7CEIA 1BXIA 1T3UA 5L8RJ 4WB4A 3L70D 3L75J 1PP9G 2N5IA 3HD7C 2JBGA 1OXZA 3L71J 4U3FJ 1QX8A 1HTLC 4YXDC 3SFDC 1URQA 2K0YA 2FXOA 2FQ1A 2QIWA 1OWAA 5BVZA 2H8PD 5KTBA 1LP1A 1U57A 1SS1A 2D2CD 1PEMA 3HUSA 3V6IA 2W90A 1KFMA 3TDKA 2JKVA 2A45H 3B8EB 3A5TA 4PD4I 3ZDMA 2UWJE 4RO0A 2BUOA 1T2KD 1X8YA 3L72G 3NTEA 4HYTB 2FYUJ 1L4AA 1S5LE 2ZT9B 2N6ZA 1BAJA 1JY3O 1FDOA 2M8RA 3B5ND 1GPJA 2AEJA 2AF8A 2XZRA 4XROA 2Y0CA 1BDCA 4N6JA 1KB9I 2KIKA 2G3AA 1KD1Q 4U3FE 1ZNVA 2WSCH 1URQC 2FFDA 2MF4A 5TISE 4NPDA 3I56P 3L75E 3GHGB 2PGDA 4H0LD 3V5BA 2K3RA 3L74J 1VF5B 3HUSB 2KK7A 1NOHA 1KC8Q 1HH0A 5H2FH 3OJAB 4BRYB 2N1TC 5CCHC 1IFDA 2Z44A 1L2PA 4JQ0D 1HVVA 3MUDC 2KB7P 1L0ND 3PJSK 1A8OA 2KOPA 1VQ6P 2I1KA 3P8CD 1JO5A 3MGEA 3EQ2A 5KJ7A 1BDDA 3AE4C 2L9FA 2L0QA 4XE5B 5E79H 1BCCE 4UB6E 2JR8A 3VTPC 1VQ5P 3AE6C 3HD7D 3A3YB 1NAFA 3VMZA 2QSIA 2FKWB 1L0NG 5KAFH 1AA0A 4DT0A 2LR2A 4GKGA 1KYOE 2NPSC 2KG6A 4COCA 3HRNA 1M74A 2IPPA 3CLQA 2Y9ZA 2ZVOB 4TLFA 2KLVA 2O01J 1SVFA 5K5GB 1DD4A 2X2BA 2QJPB 3OA7A 2JAZA 3EJEA 5CBNA 1D7MA 2DW3A 1P84D 2IBZD 2CG5B 1N7SD 2PY8A 1KFNA 5KLVE 1FZCA 4PH0A 1PGPA 2GZFA 1UNKA 1FJPA 3A0BE 2KOOA 1RQVA 3LW5J 3GW6A 1WT6A 2RMZA 3L74E 2JWDA 3Q20A 1GXHA 3JCUE 5KKZB 3BVHA 2ZVNB 2IYOA 4L74A 1HWTC 1LWUA 1IO4A 2MKVA 4PXHB 1ZW0A 1NTZJ 3U43A 3M0DC 1NTKG 1QL2A 1RH5B 1M1KQ 3T97A 4DZOA 2WVRA 3HE5B 4EIJA 1VQOP 1FU1A 1HGZA 4WWIA 3Q1MA 1PPJD 2KUBA 2JDIH 2QJYB 2XZ0D 1Q90D 3IN6A 4U0DA 1RE3C 2WPVB 3CWBE 5AW0B 3EJDA 4D6TJ 1DX7A 1UIIA 1LNQA 3HE4B 2YMKA 3AECC 3SWKA 2AFDA 3N4XA 2KSJA 5DJUB 2MR8A 2V4HA 3V2PA 4ASVA 4C7RA 2R32A 2WQYC 4U0FA 2QJKB 2Q5UA 2WSSH 2HLOA 2LOLA 1KTMA 5JPAA 3HUSC 3CCVP 1VQ8P 3DS1A 2PNGA 1X9VA 1S3JA 2KG8A 1SP4A 2KZJA 3H1JD 2HYNA 4RJTA 1OR5A 4CPGA 4OH8B 2N1TB 1Q86Q 3L74G 2KORA 3O6QA 2Z45A 3HE4A 2FFDC 5AVZB 3AE5C 4K3AA 2J5UA 4XFJA 3I55P 4YXWH 2KOSA 2JYLA 4U0AA 1NTKK 2NO8A 1Q82Q 1JY2N 3W67A 1KLPA 1EDKA 4GT1A 5HGNA 3H1JE 2GZEA 1S72P 4BWNA 1GXGA 3G26A 3GHGA 3KHUA 1L0IA 5KLIC 2ZJSE 1RO2A 1BCCG 3BCCE 2J58A 2GYKA 1H88A 1CZQA 3UIAA 4PWVB 4QNBA 3VMYA 4DG9A 1KV4A 3WUTA 3G4SP 3L4FA 2KOGA 2C0WA 2OGUA 1NAYA 2MY5A 1L0NK 1MFZA 1GL2A 4R0MA 1PPJG 3DS2A 2N98A 4ASWA 3M9QA 2JO1A 2M5RA 2MVVA 5B66H 1AFOA 4GDOA 4H0LB 4UHPB 1KORA 3LW5H 1KB9D 3DS0A 2W6AA 5AW9B 2C9LY 3Q2YA 1T6AA 1ZMBA 3G9RA 1NO4A 5EFWB 1BCCJ 1Z6MA 1LT9C 3B5NC 3RK2C 3TYYA 3E7KA 1NU1K 3PRJA 2E5YA 1FDMA 1JUNA 1H0TA 2QRXA 3M9BA 4H2YC 3CC4P 4O9BA 1Y9BA 4K35A 2A06D 3AE2C 1G1IA 1KILB 3Q5RA 2HG5D 2E1MA 4PD4E 1QVFO 3CX5D 2LMLA 4A7PA 1RHZB 2KOQA 1NQ4A 2R5DA 3KYQA 3H1HE 1G1JA 1N8RQ 1EOQA 1NHLA 5BS2A 3L70E 3GKLC 3JCUH 1NYHA 1NH4A 2LF4A 1IMPA 2Z5HA 3CXCO 5HVCA 2B88A 2HPCA 4AUWA 2OTLP 2P2UA 2AXCA 1BCCD 2FQ2A 1EXIA 2Q1KA 1VQPP 3Q5SA 1S9KE 2L91A 1BE3G 1Q2NA 2P1JA 2L4BA 2OYIC 3H32B 1FOSF 2K94A 1EQ7A 5APVA 2GUVA 3AE7C 2R3SA 4HH2A 3I5CA 2FACA 4OGQD 1EXJA 1AQ5A 2YIUC 2KI7B 3S9OA 3CWBJ 1PP9E 2K9JA 2FQ0A 3U1AA 1S9KD 2FVEA 5APUA 2XV6A 4H13C 3TGUJ 1AQTA 1RY3A 2Y0EA 4DJGA 5GTHH 3OAKA 2B9BA 2YO3A 4XFXA 2L22A 1EDLA 3FGAD 2K92A 3CX5E 4XA4A 1SQQE 5F2OA 3E2DA 5KP7B 1EMVA 1OIPA 1NJIQ 1LTIC 1HBWA 4GIFA 1QRJA 2LXBA 1SFCD 5H2FE 1NTKD 2BEZF 2B87A 4IPYA 2W6JH 2WSEJ 3G0VA 2PEMA 1M1JA 3V2RA 1N2DC 1PZQA 3B5IA 1BSNA 1FJKA 3O8ZA 2K37A 4C46A 1GMJA 3CXHE 2H88C 2KNCB 2D2CC 1M6NA 3LMOA 1CEIA 3ABVC 2YNYA 3MP7B 3G21A 2PEQA 2YKQA 3KZIE 3A0HH 4Y99B 1JCCA 1K73Q 4HJGH 1AV1A 5KAIH 1SFCA 1W2BO 2V7QJ 1IFJA 1NU1J 5KKZC 3QWOC 2M3EA 2KR5A 1JM0A 1YI2P 1KZUB 3BRTB 1SQVJ 2ZXXA 4JBZA 1LTJB 2C9NY 3H1KJ 2N1TA 3CCLP 2BASA 2E74C 3D71A 1JEKA 2KXPB 2HR3A 3RL0B 1YQ4C 4LGDE 1MFTA 1VPCA 5CHXA 2QJYC 3GZMA 2A45I 3G28A 1IUQA 1M56D 2P7JA 1KQLA 1RE3A 1BE3J 3M1MA 2A06E 1SQBE 2IFNA 3H1IJ 1OMIA 1KILA 2O3JA 2W6BA 4JPZB 4L73A 2KP8A 2B87B 2GA1A 2LPKA 1X3OA 2N6YA 2MJZA 4BXLA 1ZMEC 3B4SA 4M0IA 3L71D 4C7NA 1KILE 2AFEA 1FR2A 2XT1A 1RE4C 3P8MC 3MD0A 1QVGO 4N78E 1LTBC 2ONTA 2P67A 3E1RA 3WU2H 4I7ZB 2AEMA 2M8PA 4R4MA 4H44C 1VQ4P 4YTPC 2LKMA 3RK3C 1LWUB 3RG6C 1MV8A 2XKMA 2QJPC 3H47A 2NPSD 3IR9A 2XNXA 2K9JB 3M06A 3FX0A 1W5CE 3ITKA 4BPGA 2IZ0A 5EW5E 2K5XA 3P05A 1JOCA 1DV5A 3L75G 1AVOA 1IK7A 3CXHI 3L73E 3RL0D 2ERHA 3GF3A 3SWYA 4L75A 1WMKA 5F2KA 2AXTE 5HGMA 1A02F 4IOIH 3WUUA 2YXRB 3H6PA 5CCGD 4AQRD 1W2EA 1BGYJ 2FYUG 1SQBJ 3GLMA 1LTSC 1LTAC 2GDWA 5HGLA 2KZIA 4EDFA 2HODB 5CCHD 4WY4C 5B66E 2N1TD 4D6TE 1FBMA 1ZRTE 1K30A 5AVVB 3RGUA 5APSA 3L74D 1NWQA 3CE7A 3RL0g 3KXDA 1E0HA 2R3CA 2NRGA 4ZMDA 3G3ZA 5KLVD 2RKLA 3H1HD 3E1IA 1IJDB 1M1JB 1LTJC 2M8LA 4ZKUA 4MRTC 1SFCC 4UB8H 3U1CA 3A7OA 1PEUA 2IFMA 3CC7P 1ZR2A 5AVWB 2BHVA 3BCCD 3BRVB 3D6ZA 2HODA 5KP8B 1CI6A 4UB6H 1KILC 5KLVG 1GL2C 2I1JA 2MR7A 3AEBC 1S2EA 5KAIE 4D6TG 1NTME 3HD7A 5AVTB 1PEQA 2CGQA 4OGQC 3BCCG 3CL3D 3AE8C 3EJBA 1EDIA 3CD6P 1ZP0C 1VQ7P 1EZVD 2NZ2A 1RO0A 3IFMA 4I1LA 3EWKA 1J2JB 1EZVE 1E5WA 5CCGC 1FDIA 1VF5C 3NMDA 3QH9A 2DGYA 2JJLA 3GJNA 2CWOA 5TISH 2PRRA 2O01H 2Y0DA 1EDJA 1XTCC 2OYHA 2LIUA 4XFYA 1OZHA 5APQA 2O1KA 1EC5A 2NPSA 2O1JA 3H1LJ 1HUCA 3CMEP 3TSIA 1M7LA 1H89A 3RK3E 2PEJA 2OYHC 2H89C 1Z56A 3FXDA 1NTZD 3R4YA 1AJYA 2Q9IA 2QM8A 1OVRA 4U0CA 4W80A 5AVYB 1SQPE 2IBZI 2I8DA 3CX5I 1USEA 2QNWA 1N73C 1GW4A 1L4AD 5DCKA 2CNRA 4LC1A 1IC2A 1VQKP 2H43A 3KZIH 2PFXA 4M3LA 2KNCA 1ZR4A 3B5NB 2Z5IA 2KW2A 2Y9YA 2ROQA 4OWFA 1FZAA 1VKUA 2KLUA 2B89A 2JU2A 1SQPG 3MZWB 4H44D 1K9MQ 1G2CB 3VOPA 4JYBA 4RKUJ 4IZ6A 2RN0A 1HY8A 2BEQD 3RG2A 1NVOA 2OYOA 2BQ1E 5AVUB 1HJBA 3G29A 1F80D 3CX5H 5AW3B 5AW7B 3L72E 1AUMA 3MIWA 1YJWP 4Y99C 2WTYA 1ZV8A 2XV5A 1ZXGA 1M6EX 2RH0A 3L72D 1N73A 4PD4H 1SQBG 2IBZE 3HZQA 2KG9A 3CC2P 1N7SB 3H1JG 1GL2B 1YTZT 1BGYE 5AVSB 1R8EA 4F37A 3H1IE 4KHXA 1VHNA 2K93A 4PV1B 1UJZA 4CA3A 1GU4A 3BCCJ 2IX7C 4OGQB 3P8CE 2YKOA 1NTMG 1L4AB 3V4QA 2BCCJ 3L71E 3RL0C 3D6YA 3H1JJ 2KWLA 1FS0E 2JYGA 4PV1D 1CW5A 4PJ0H 4Y28J 2PENA 3M91A 2N9YB 3FXEA 5B5EE 1RF1C 2FYNC 3AEAC 1SQQJ 1L0NJ 1JCDA 1GD2E 4C7NB 2VLNA 2FXPA 1MKMA 1LTGC 3KQGA 4GOEA 4IL6H 1U7MA 1PEOA 1N86A 2JQ4A 4LLHA 2FVAA 1SQPD 3RBXA 1T8KA 3O6QB 1G2CA 1GTWA 1J1EC 2J59M 3EFFK 4ZKPA 2ZAEB 1HGVA 3L72J 1J1DC 1SQPJ 1VL2A 1SQBK 5CJ4A 1YJNP 1KQFB 2WPQA 3VP9A 1NU1D 2E5TA 1BE3D 4H2XC 1LWUC 2IDBA 2E75C 4EI2A 2HPCB 2K9YA 1L0LE 2AVAA 3VMAA 1GK4A 1OVUA 2QG4A 5HV8A 3AEFC 3CPWO 2ZYAA 2OARA 3H1LE 4H13D 4COPA 2K88A 3L70J 3CCQP 1DD3A 4IL6X 2JGPA 3C1LA 3JSVC 1NTMD 4GR2A 2GZGA 2H7HA 3TF5A 2FY8A 5C39A 2GZIA 2KS1B 3BATA 1X22A 3RK2B 3CCSP 2BCCG 2K0DX 3II6A 1NTMJ 1NKNA 1PFIA 1IFNA 1YITP 3CWBG 3WMM0 2KGCA 1ZLLA 1YYCA 1SQXE 1FE6A 2QA4P 1E6JP 1H0TB 3VRLC 1N7SC 4D6TD 2QE7H 2WSCJ 1ZOYC 4JYCA 3V2QA 2O01N 3HE5A 3CXHD 1PP9D 2FYUD 2CK3H 1M1JC 2E76C 2VLOA 4BPHA 1ZRTD 5CCHA 3EFGA 2YKPA 2XDJA 1U7JA 1PIXA 2W8ZA 1IZNB 4KJMA 2KGEA 1FZGA 3L73D 1QLED 3M9HA 1RF0A 2VLQA 1NTKJ 4Z1MH 1L0LD 2M5AA 2KS1A 2W27A 2FYNB 2QM7A 2YXQB 1ZN5A 3L73G 2ZT9D 3DTJA 1IK9A 1SQXJ 4I7ZC 2JU1A 1HJ0A 2AXTH 2JEEA 5AVQB 1NTZE 1J1EB 2L5GB 1MZ9A 2IZ1A 3TGUD 1SQQK 2PEIA 2EG5A 4IFMA 3PH0A 2FADA 2KYVA 1PGJA 1X0TA 2GUSA 4H13B 1URQD 2L6EA 1JMMA 3L37A 4N78D 2VRSA 4B86A 2A45G 3FWLA 3V4WA 2P58A 3WU2E 3CCRP 1YTZI 4WVZA 2KGDA 1GZLA 1GK6A 2BCCD 4HKGA 1RE4A 5APXA 1CSBA 2XNDH 1NGMB 1QL1A 3M0AA 3IF4A 2QVAA 2ITAA 3SFEC 1LT1A 1N73B 1XTGB 3KDPB 5KLVK 3H1ID 3GG2A 2MD9A 1KB9E 2PAJA 3G71P 3CCUP 3A0BH 4JF7A 3A2AA 2CPBA 3HD7B 1MZ8A 2WMMA 2POHA 1HF9A 2D2CB 3T97B 3AE1C 1FOSE 2PEOA 2YMYA 3AE3C 4QMAA 1CI6B 2Z46A 1S5LX 5AW4B 1Y8AA 3LIDA 3HTKA 4ZNCA 5AW8B 1IFMA 5EJDA 2KGAA 2FBWC 5APYA 3MGNA 1SQXG 3H1KD 5CMZA 1SQVE 5KJ7D 1MUUA 1DEBA 1LTTC 1N7SA 5CJ0A 2IYPA 3H32A 4U0BA 1AYIA 2BCCE 1T3JA 3TK1A 1FZFA 1OX3A 3WBHA 2HFED 1A02J 1YHQP 1PGOA 2E75D 1JY3P 3NXSA 2FYZA 1FZCB 5AVXB 3PP5A 1K04A 3N7NA 2R44A 1WRGA 5BS1A 2E74D 5HGOA 3L73J 3DPHA 1JJ2O 1URQB 1M8OB 1EIAA 1P84H 1NTZK 1JY2P 2OYIA 2FFDB 1YBKA 4GR6A 4W7ZA 2CQ8A 4AYCA 4WY4A 1E79H 3LIEA 2WSFJ 4W7YA 2FHSC 1OW7A 3NY7B 1DH3A 1FZBA 2CPSA 3VP8A 1SQVG 1PPJE 5GTHE 4DOJA 4H44B 1JTHA 2WT7B 5KLVJ 3RK3B 2ZXEB 5TJHA 2XZ1C 3H1HJ 1JNMA 3K5BA 2IBZG 2M0BA 5APWA 1J1DB 5GTIE 1EZVI 1L0LG 1Q81Q 3L35A 2W83C 1OVVA 1RNIA 4KT0J 3Q5PA 3RK2D 4N3YB 1YQ3C 3D70A 3HYBA 4H0LC 4EOTA 3H1HG 3NFQA 1H8AA 3MUDA 3U59A 2K1AA 2PEKA 3GMAA 3H1KG 1SQXD 1VDFA 1KB9H 1LT9B 3WUVA 1GL2D 1RF1A 3JC22 2Z4EA 2JB0A 2C0XA 2VSQA
chains in the Genus database with same CATH topology
1KC8Q 2M8PA 3OW2O 1M6NA 1VQMP 2QA4P 1VQ4P 3CXCO 1E6JP 3G4SP 2KODA 2Z44A 5BS1A 3G21A 2PEQA 3RG6C 3VRLC 5HGOA 3H0DA 3CCRP 4XFZA 1M1KQ 2P9XA 1PEOA 3DPHA 4WYMA 1K73Q 1VQOP 3G1IA 3H47A 1A8OA 1JJ2O 2OTLP 1EIAA 1K9MQ 1VQ6P 1D1DA 1W2BO 1YIJP 3MGEA 3DS2A 1VQPP 4U0DA 1PEQA 3CCJP 3H4EA 1YI2P 3P05A 3CD6P 4GR6A 3CCEP 1VQ7P 3DS0A 3G6EP 1RO0A 1VQ5P 2BQ1E 1ZMBA 1VQ9P 1YJNP 3G71P 5F2KA 3G29A 3CCUP 1PEMA 2EIAA 1K8AQ 2JO0A 3DS4A 5HGMA 2DGYA 1AUMA 2CWOA 4COCA 4U0FA 1YJWP 3CCLP 1M74A 3G1GA 2XV6A 2BUOA 5JPAA 2M8NA 1M6EX 4XFYA 2PEOA 5HGLA 3CCVP 1VQ8P 3DS1A 3NTEA 3CC4P 2Z46A 3HZQA 3CMEP 3G28A 3DS3A 3CCMP 1IUQA 1YJ9P 3CC2P 1BAJA 3M1MA 2PY8A 1Q86Q 3DTJA 1K30A 2PEJA 1M90Q 4XRQA 2XXMA 2OTJP 4XFXA 3CPWO 2EFJA 4XROA 2Z45A 2OARA 4PH0A 5F2NA 3DS5A 1Q81Q 5F2OA 3E2DA 3CMAP 4COPA 1Q7YQ 3CCQP 4PH1A 2E1MA 1RNIA 1QVFO 4U0CA 4GR2A 1NJIQ 3I55P 1KD1Q 2PEIA 2EG5A 2JYLA 4U0AA 1QRJA 4U0BA 4M0IA 3HYBA 1Q82Q 1VQNP 3Q20A 4U0EA 1KQSO 3LRYA 4IPYA 3G0VA 2XT1A 2JYGA 3WBHA 5HGNA 1A43A 3I56P 1S72P 2PEMA 3CCSP 1YHQP 1VQLP 1N8RQ 1EOQA 2QEXP 5I4TG 3G26A 2PEKA 2PENA 2M8LA 1QVGO 3B5IA 5DCKA 5BS2A 1YITP 1RO2A 2L6EA 1VQKP 1PEUA 2ONTA 3CC7P 2BHVA 2LF4A 4QNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF O;  1KC8 Q;  1YI2 P;  3CD6 P;  1NJI Q;  3I55 P;  3CCV P;  1KD1 Q;  1VQ8 P;  3OW2 O;  1VQM P;  2QA4 P;  1VQ7 P;  3CCE P;  3CC4 P;  1VQ4 P;  3CXC O;  3G6E P;  1VQ5 P;  3CME P;  1Q82 Q;  1VQN P;  3G4S P;  3CCM P;  1YJ9 P;  1VQ9 P;  3CC2 P;  1KQS O;  3CCR P;  1YJN P;  1M1K Q;  1Q86 Q;  3G71 P;  1M90 Q;  2OTJ P;  3I56 P;  3CCU P;  1S72 P;  3CCS P;  1YHQ P;  1K73 Q;  1K8A Q;  1VQO P;  1VQL P;  1N8R Q;  3CPW O;  2QEX P;  1JJ2 O;  2OTL P;  1K9M Q;  1VQ6 P;  1QVG O;  1YJW P;  1W2B O;  3CCL P;  1YIJ P;  1YIT P;  1Q81 Q;  1VQP P;  1VQK P;  3CMA P;  1Q7Y Q;  3CCJ P;  3CC7 P;  3CCQ P; 
#chains in the Genus database with same CATH topology
 1M57 D;  2WPT A;  4WY4 B;  2GM4 A;  2WWW A;  3USS A;  3Q3D A;  4XFZ A;  5KP6 B;  2P9X A;  4WYM A;  3M0D A;  1JY2 O;  1GU5 A;  2N50 A;  1IFP A;  2OTK E;  2WSF H;  5GTI H;  3CWB D;  1D1D A;  3R2P A;  3B71 A;  1YIJ P;  3BAS A;  2ZT9 C;  3SSU A;  3H1L D;  1T2K C;  2WPS A;  3CCE P;  1JB0 J;  3G6E P;  2LL8 A;  1VQ9 P;  1AF8 A;  1SFC B;  3AED C;  1TU3 F;  4RES B;  2GZJ A;  1NU1 G;  1L4A C;  5AW1 B;  2Q3E A;  1SQX K;  1L0L K;  2E76 D;  1IFI A;  1BE3 E;  1FZC C;  4DCK A;  1SQV D;  3GHG C;  1KMI Z;  1L0H A;  2LIW A;  2M5A B;  3VMX A;  1KYO I;  1YJ9 P;  2N5H A;  3TNU B;  2LXC B;  1M90 Q;  2XXM A;  3MTU E;  1LT9 A;  2JP3 A;  2E76 B;  1P84 E;  1JY3 N;  4I6M C;  4U3F G;  5F2N A;  3PHL A;  3DS5 A;  3GF7 A;  4YPC A;  1SQQ D;  1R5L A;  2E42 A;  2QJK C;  1OW8 A;  1VQN P;  5AW2 B;  1KYO D;  3LRY A;  4NPF X;  1GW3 A;  3AE9 C;  4QKO A;  2QEX P;  2YIU B;  1S4X A;  1NTZ G;  1Y47 A;  3PTZ A;  3CI9 A;  3KPE A;  2ZFC A;  3NTN A;  1PL5 A;  5CCG A;  3C8V A;  2Q3I A;  1VQM P;  2NPS B;  3SWF A;  2WSE H;  2LKI A;  5M1B A;  2FAE A;  1EZV G;  1JTH B;  2WT7 A;  2OYH B;  1L0N E;  1X79 B;  3AEE C;  2WIT A;  1KIL D;  4NPE A;  1VF5 D;  5KAF E;  1FZE A;  3P7K A;  2FYU E;  3TNU A;  5AW6 B;  1JMB A;  4I2L C;  1T8Z A;  3L70 G;  1RQU A;  4MN4 C;  3H1L G;  5BU8 B;  3MHV A;  3H1I G;  1BGY D;  1SQB D;  3L75 D;  3H25 A;  2K2Q A;  2EIA A;  3C9I A;  3DS4 A;  4GOF A;  1LTJ A;  4U7J A;  1P84 I;  3A0H E;  2JWA A;  4U3F D;  3G1G A;  5BU5 A;  2M3B A;  2M8N A;  2XU6 A;  1KN7 A;  3AEG C;  4H2W C;  2R5B A;  2EHS A;  1RF0 C;  3CXH H;  3TGU G;  5AVR B;  3VN0 A;  2A06 G;  4EYY Q;  2OTJ P;  5APT A;  2EFJ A;  1IMQ A;  3B4Q A;  4PD4 D;  1Q7Y Q;  3F5H A;  4L76 A;  4NEO A;  2FYU K;  2PP6 A;  5AW5 B;  3B5N A;  2ZYD A;  2VLP A;  4WY4 D;  1KQS O;  3P32 A;  1GDT A;  1LJ2 A;  4WBA A;  4BPF A;  1A43 A;  4UB8 E;  2EHT A;  2MVU A;  1QEX A;  5DJT B;  2N9B A;  1HQB A;  4IFD K;  3HTK B;  4OVN F;  1SQQ G;  1S5L H;  2KSE A;  4BRY A;  3RBZ A;  2E74 B;  1N7L A;  1PV3 A;  4R4L A;  3GZL A;  3OW2 O;  3H1K E;  3L36 A;  2GDY A;  2KOD A;  1SQP K;  3H0D A;  1ACP A;  3S4R A;  2WPR A;  1AVY A;  4PV1 C;  1FC2 C;  1NTK E;  3G1I A;  3VYI A;  1OW6 A;  4HB1 A;  5CZD B;  4IL6 E;  2V7Q H;  2FXM A;  3CCJ P;  2Q7C A;  3H4E A;  1UIX A;  1NU1 E;  1K05 A;  1L0L J;  2DNW A;  3RK3 D;  1BSH A;  3PLN A;  2P10 A;  1BGY G;  1FAV A;  3IAO A;  5B5E H;  1LGH B;  2YO2 A;  2K0X A;  2AEF A;  4GOD A;  3TGU E;  4PJ0 E;  1NKZ B;  1K8A Q;  2JO0 A;  1USD A;  1RF1 B;  2FVF A;  1DNY A;  1KQG B;  4TT3 H;  3S1K A;  2Q6Q A;  2SPZ A;  1SQV K;  2GDX A;  1R5S A;  3DS3 A;  3CCM P;  2WZ7 A;  4HKZ H;  5KLI B;  1QGK B;  2OYI B;  4IFF A;  4XRQ A;  2LTE A;  3W68 A;  1DIP A;  2OQQ A;  1OFC X;  1KYO H;  3CMA P;  2E43 A;  1LP1 B;  4PH1 A;  1NTM K;  1DEE G;  3V2N A;  3F89 A;  2G8Y A;  1S1C X;  1PGQ A;  5KJ7 C;  4U0E A;  3L71 G;  5E79 E;  3FWN A;  1SLQ A;  5CBO A;  1VQL P;  2E75 B;  5I4T G;  1PP9 J;  2ZYG A;  7CEI A;  1BXI A;  1T3U A;  5L8R J;  4WB4 A;  3L70 D;  3L75 J;  1PP9 G;  2N5I A;  3HD7 C;  2JBG A;  1OXZ A;  3L71 J;  4U3F J;  1QX8 A;  1HTL C;  4YXD C;  3SFD C;  1URQ A;  2K0Y A;  2FXO A;  2FQ1 A;  2QIW A;  1OWA A;  5BVZ A;  2H8P D;  5KTB A;  1LP1 A;  1U57 A;  1SS1 A;  2D2C D;  1PEM A;  3HUS A;  3V6I A;  2W90 A;  1KFM A;  3TDK A;  2JKV A;  2A45 H;  3B8E B;  3A5T A;  4PD4 I;  3ZDM A;  2UWJ E;  4RO0 A;  2BUO A;  1T2K D;  1X8Y A;  3L72 G;  3NTE A;  4HYT B;  2FYU J;  1L4A A;  1S5L E;  2ZT9 B;  2N6Z A;  1BAJ A;  1JY3 O;  1FDO A;  2M8R A;  3B5N D;  1GPJ A;  2AEJ A;  2AF8 A;  2XZR A;  4XRO A;  2Y0C A;  1BDC A;  4N6J A;  1KB9 I;  2KIK A;  2G3A A;  1KD1 Q;  4U3F E;  1ZNV A;  2WSC H;  1URQ C;  2FFD A;  2MF4 A;  5TIS E;  4NPD A;  3I56 P;  3L75 E;  3GHG B;  2PGD A;  4H0L D;  3V5B A;  2K3R A;  3L74 J;  1VF5 B;  3HUS B;  2KK7 A;  1NOH A;  1KC8 Q;  1HH0 A;  5H2F H;  3OJA B;  4BRY B;  2N1T C;  5CCH C;  1IFD A;  2Z44 A;  1L2P A;  4JQ0 D;  1HVV A;  3MUD C;  2KB7 P;  1L0N D;  3PJS K;  1A8O A;  2KOP A;  1VQ6 P;  2I1K A;  3P8C D;  1JO5 A;  3MGE A;  3EQ2 A;  5KJ7 A;  1BDD A;  3AE4 C;  2L9F A;  2L0Q A;  4XE5 B;  5E79 H;  1BCC E;  4UB6 E;  2JR8 A;  3VTP C;  1VQ5 P;  3AE6 C;  3HD7 D;  3A3Y B;  1NAF A;  3VMZ A;  2QSI A;  2FKW B;  1L0N G;  5KAF H;  1AA0 A;  4DT0 A;  2LR2 A;  4GKG A;  1KYO E;  2NPS C;  2KG6 A;  4COC A;  3HRN A;  1M74 A;  2IPP A;  3CLQ A;  2Y9Z A;  2ZVO B;  4TLF A;  2KLV A;  2O01 J;  1SVF A;  5K5G B;  1DD4 A;  2X2B A;  2QJP B;  3OA7 A;  2JAZ A;  3EJE A;  5CBN A;  1D7M A;  2DW3 A;  1P84 D;  2IBZ D;  2CG5 B;  1N7S D;  2PY8 A;  1KFN A;  5KLV E;  1FZC A;  4PH0 A;  1PGP A;  2GZF A;  1UNK A;  1FJP A;  3A0B E;  2KOO A;  1RQV A;  3LW5 J;  3GW6 A;  1WT6 A;  2RMZ A;  3L74 E;  2JWD A;  3Q20 A;  1GXH A;  3JCU E;  5KKZ B;  3BVH A;  2ZVN B;  2IYO A;  4L74 A;  1HWT C;  1LWU A;  1IO4 A;  2MKV A;  4PXH B;  1ZW0 A;  1NTZ J;  3U43 A;  3M0D C;  1NTK G;  1QL2 A;  1RH5 B;  1M1K Q;  3T97 A;  4DZO A;  2WVR A;  3HE5 B;  4EIJ A;  1VQO P;  1FU1 A;  1HGZ A;  4WWI A;  3Q1M A;  1PPJ D;  2KUB A;  2JDI H;  2QJY B;  2XZ0 D;  1Q90 D;  3IN6 A;  4U0D A;  1RE3 C;  2WPV B;  3CWB E;  5AW0 B;  3EJD A;  4D6T J;  1DX7 A;  1UII A;  1LNQ A;  3HE4 B;  2YMK A;  3AEC C;  3SWK A;  2AFD A;  3N4X A;  2KSJ A;  5DJU B;  2MR8 A;  2V4H A;  3V2P A;  4ASV A;  4C7R A;  2R32 A;  2WQY C;  4U0F A;  2QJK B;  2Q5U A;  2WSS H;  2HLO A;  2LOL A;  1KTM A;  5JPA A;  3HUS C;  3CCV P;  1VQ8 P;  3DS1 A;  2PNG A;  1X9V A;  1S3J A;  2KG8 A;  1SP4 A;  2KZJ A;  3H1J D;  2HYN A;  4RJT A;  1OR5 A;  4CPG A;  4OH8 B;  2N1T B;  1Q86 Q;  3L74 G;  2KOR A;  3O6Q A;  2Z45 A;  3HE4 A;  2FFD C;  5AVZ B;  3AE5 C;  4K3A A;  2J5U A;  4XFJ A;  3I55 P;  4YXW H;  2KOS A;  2JYL A;  4U0A A;  1NTK K;  2NO8 A;  1Q82 Q;  1JY2 N;  3W67 A;  1KLP A;  1EDK A;  4GT1 A;  5HGN A;  3H1J E;  2GZE A;  1S72 P;  4BWN A;  1GXG A;  3G26 A;  3GHG A;  3KHU A;  1L0I A;  5KLI C;  2ZJS E;  1RO2 A;  1BCC G;  3BCC E;  2J58 A;  2GYK A;  1H88 A;  1CZQ A;  3UIA A;  4PWV B;  4QNB A;  3VMY A;  4DG9 A;  1KV4 A;  3WUT A;  3G4S P;  3L4F A;  2KOG A;  2C0W A;  2OGU A;  1NAY A;  2MY5 A;  1L0N K;  1MFZ A;  1GL2 A;  4R0M A;  1PPJ G;  3DS2 A;  2N98 A;  4ASW A;  3M9Q A;  2JO1 A;  2M5R A;  2MVV A;  5B66 H;  1AFO A;  4GDO A;  4H0L B;  4UHP B;  1KOR A;  3LW5 H;  1KB9 D;  3DS0 A;  2W6A A;  5AW9 B;  2C9L Y;  3Q2Y A;  1T6A A;  1ZMB A;  3G9R A;  1NO4 A;  5EFW B;  1BCC J;  1Z6M A;  1LT9 C;  3B5N C;  3RK2 C;  3TYY A;  3E7K A;  1NU1 K;  3PRJ A;  2E5Y A;  1FDM A;  1JUN A;  1H0T A;  2QRX A;  3M9B A;  4H2Y C;  3CC4 P;  4O9B A;  1Y9B A;  4K35 A;  2A06 D;  3AE2 C;  1G1I A;  1KIL B;  3Q5R A;  2HG5 D;  2E1M A;  4PD4 E;  1QVF O;  3CX5 D;  2LML A;  4A7P A;  1RHZ B;  2KOQ A;  1NQ4 A;  2R5D A;  3KYQ A;  3H1H E;  1G1J A;  1N8R Q;  1EOQ A;  1NHL A;  5BS2 A;  3L70 E;  3GKL C;  3JCU H;  1NYH A;  1NH4 A;  2LF4 A;  1IMP A;  2Z5H A;  3CXC O;  5HVC A;  2B88 A;  2HPC A;  4AUW A;  2OTL P;  2P2U A;  2AXC A;  1BCC D;  2FQ2 A;  1EXI A;  2Q1K A;  1VQP P;  3Q5S A;  1S9K E;  2L91 A;  1BE3 G;  1Q2N A;  2P1J A;  2L4B A;  2OYI C;  3H32 B;  1FOS F;  2K94 A;  1EQ7 A;  5APV A;  2GUV A;  3AE7 C;  2R3S A;  4HH2 A;  3I5C A;  2FAC A;  4OGQ D;  1EXJ A;  1AQ5 A;  2YIU C;  2KI7 B;  3S9O A;  3CWB J;  1PP9 E;  2K9J A;  2FQ0 A;  3U1A A;  1S9K D;  2FVE A;  5APU A;  2XV6 A;  4H13 C;  3TGU J;  1AQT A;  1RY3 A;  2Y0E A;  4DJG A;  5GTH H;  3OAK A;  2B9B A;  2YO3 A;  4XFX A;  2L22 A;  1EDL A;  3FGA D;  2K92 A;  3CX5 E;  4XA4 A;  1SQQ E;  5F2O A;  3E2D A;  5KP7 B;  1EMV A;  1OIP A;  1NJI Q;  1LTI C;  1HBW A;  4GIF A;  1QRJ A;  2LXB A;  1SFC D;  5H2F E;  1NTK D;  2BEZ F;  2B87 A;  4IPY A;  2W6J H;  2WSE J;  3G0V A;  2PEM A;  1M1J A;  3V2R A;  1N2D C;  1PZQ A;  3B5I A;  1BSN A;  1FJK A;  3O8Z A;  2K37 A;  4C46 A;  1GMJ A;  3CXH E;  2H88 C;  2KNC B;  2D2C C;  1M6N A;  3LMO A;  1CEI A;  3ABV C;  2YNY A;  3MP7 B;  3G21 A;  2PEQ A;  2YKQ A;  3KZI E;  3A0H H;  4Y99 B;  1JCC A;  1K73 Q;  4HJG H;  1AV1 A;  5KAI H;  1SFC A;  1W2B O;  2V7Q J;  1IFJ A;  1NU1 J;  5KKZ C;  3QWO C;  2M3E A;  2KR5 A;  1JM0 A;  1YI2 P;  1KZU B;  3BRT B;  1SQV J;  2ZXX A;  4JBZ A;  1LTJ B;  2C9N Y;  3H1K J;  2N1T A;  3CCL P;  2BAS A;  2E74 C;  3D71 A;  1JEK A;  2KXP B;  2HR3 A;  3RL0 B;  1YQ4 C;  4LGD E;  1MFT A;  1VPC A;  5CHX A;  2QJY C;  3GZM A;  2A45 I;  3G28 A;  1IUQ A;  1M56 D;  2P7J A;  1KQL A;  1RE3 A;  1BE3 J;  3M1M A;  2A06 E;  1SQB E;  2IFN A;  3H1I J;  1OMI A;  1KIL A;  2O3J A;  2W6B A;  4JPZ B;  4L73 A;  2KP8 A;  2B87 B;  2GA1 A;  2LPK A;  1X3O A;  2N6Y A;  2MJZ A;  4BXL A;  1ZME C;  3B4S A;  4M0I A;  3L71 D;  4C7N A;  1KIL E;  2AFE A;  1FR2 A;  2XT1 A;  1RE4 C;  3P8M C;  3MD0 A;  1QVG O;  4N78 E;  1LTB C;  2ONT A;  2P67 A;  3E1R A;  3WU2 H;  4I7Z B;  2AEM A;  2M8P A;  4R4M A;  4H44 C;  1VQ4 P;  4YTP C;  2LKM A;  3RK3 C;  1LWU B;  3RG6 C;  1MV8 A;  2XKM A;  2QJP C;  3H47 A;  2NPS D;  3IR9 A;  2XNX A;  2K9J B;  3M06 A;  3FX0 A;  1W5C E;  3ITK A;  4BPG A;  2IZ0 A;  5EW5 E;  2K5X A;  3P05 A;  1JOC A;  1DV5 A;  3L75 G;  1AVO A;  1IK7 A;  3CXH I;  3L73 E;  3RL0 D;  2ERH A;  3GF3 A;  3SWY A;  4L75 A;  1WMK A;  5F2K A;  2AXT E;  5HGM A;  1A02 F;  4IOI H;  3WUU A;  2YXR B;  3H6P A;  5CCG D;  4AQR D;  1W2E A;  1BGY J;  2FYU G;  1SQB J;  3GLM A;  1LTS C;  1LTA C;  2GDW A;  5HGL A;  2KZI A;  4EDF A;  2HOD B;  5CCH D;  4WY4 C;  5B66 E;  2N1T D;  4D6T E;  1FBM A;  1ZRT E;  1K30 A;  5AVV B;  3RGU A;  5APS A;  3L74 D;  1NWQ A;  3CE7 A;  3RL0 g;  3KXD A;  1E0H A;  2R3C A;  2NRG A;  4ZMD A;  3G3Z A;  5KLV D;  2RKL A;  3H1H D;  3E1I A;  1IJD B;  1M1J B;  1LTJ C;  2M8L A;  4ZKU A;  4MRT C;  1SFC C;  4UB8 H;  3U1C A;  3A7O A;  1PEU A;  2IFM A;  3CC7 P;  1ZR2 A;  5AVW B;  2BHV A;  3BCC D;  3BRV B;  3D6Z A;  2HOD A;  5KP8 B;  1CI6 A;  4UB6 H;  1KIL C;  5KLV G;  1GL2 C;  2I1J A;  2MR7 A;  3AEB C;  1S2E A;  5KAI E;  4D6T G;  1NTM E;  3HD7 A;  5AVT B;  1PEQ A;  2CGQ A;  4OGQ C;  3BCC G;  3CL3 D;  3AE8 C;  3EJB A;  1EDI A;  3CD6 P;  1ZP0 C;  1VQ7 P;  1EZV D;  2NZ2 A;  1RO0 A;  3IFM A;  4I1L A;  3EWK A;  1J2J B;  1EZV E;  1E5W A;  5CCG C;  1FDI A;  1VF5 C;  3NMD A;  3QH9 A;  2DGY A;  2JJL A;  3GJN A;  2CWO A;  5TIS H;  2PRR A;  2O01 H;  2Y0D A;  1EDJ A;  1XTC C;  2OYH A;  2LIU A;  4XFY A;  1OZH A;  5APQ A;  2O1K A;  1EC5 A;  2NPS A;  2O1J A;  3H1L J;  1HUC A;  3CME P;  3TSI A;  1M7L A;  1H89 A;  3RK3 E;  2PEJ A;  2OYH C;  2H89 C;  1Z56 A;  3FXD A;  1NTZ D;  3R4Y A;  1AJY A;  2Q9I A;  2QM8 A;  1OVR A;  4U0C A;  4W80 A;  5AVY B;  1SQP E;  2IBZ I;  2I8D A;  3CX5 I;  1USE A;  2QNW A;  1N73 C;  1GW4 A;  1L4A D;  5DCK A;  2CNR A;  4LC1 A;  1IC2 A;  1VQK P;  2H43 A;  3KZI H;  2PFX A;  4M3L A;  2KNC A;  1ZR4 A;  3B5N B;  2Z5I A;  2KW2 A;  2Y9Y A;  2ROQ A;  4OWF A;  1FZA A;  1VKU A;  2KLU A;  2B89 A;  2JU2 A;  1SQP G;  3MZW B;  4H44 D;  1K9M Q;  1G2C B;  3VOP A;  4JYB A;  4RKU J;  4IZ6 A;  2RN0 A;  1HY8 A;  2BEQ D;  3RG2 A;  1NVO A;  2OYO A;  2BQ1 E;  5AVU B;  1HJB A;  3G29 A;  1F80 D;  3CX5 H;  5AW3 B;  5AW7 B;  3L72 E;  1AUM A;  3MIW A;  1YJW P;  4Y99 C;  2WTY A;  1ZV8 A;  2XV5 A;  1ZXG A;  1M6E X;  2RH0 A;  3L72 D;  1N73 A;  4PD4 H;  1SQB G;  2IBZ E;  3HZQ A;  2KG9 A;  3CC2 P;  1N7S B;  3H1J G;  1GL2 B;  1YTZ T;  1BGY E;  5AVS B;  1R8E A;  4F37 A;  3H1I E;  4KHX A;  1VHN A;  2K93 A;  4PV1 B;  1UJZ A;  4CA3 A;  1GU4 A;  3BCC J;  2IX7 C;  4OGQ B;  3P8C E;  2YKO A;  1NTM G;  1L4A B;  3V4Q A;  2BCC J;  3L71 E;  3RL0 C;  3D6Y A;  3H1J J;  2KWL A;  1FS0 E;  2JYG A;  4PV1 D;  1CW5 A;  4PJ0 H;  4Y28 J;  2PEN A;  3M91 A;  2N9Y B;  3FXE A;  5B5E E;  1RF1 C;  2FYN C;  3AEA C;  1SQQ J;  1L0N J;  1JCD A;  1GD2 E;  4C7N B;  2VLN A;  2FXP A;  1MKM A;  1LTG C;  3KQG A;  4GOE A;  4IL6 H;  1U7M A;  1PEO A;  1N86 A;  2JQ4 A;  4LLH A;  2FVA A;  1SQP D;  3RBX A;  1T8K A;  3O6Q B;  1G2C A;  1GTW A;  1J1E C;  2J59 M;  3EFF K;  4ZKP A;  2ZAE B;  1HGV A;  3L72 J;  1J1D C;  1SQP J;  1VL2 A;  1SQB K;  5CJ4 A;  1YJN P;  1KQF B;  2WPQ A;  3VP9 A;  1NU1 D;  2E5T A;  1BE3 D;  4H2X C;  1LWU C;  2IDB A;  2E75 C;  4EI2 A;  2HPC B;  2K9Y A;  1L0L E;  2AVA A;  3VMA A;  1GK4 A;  1OVU A;  2QG4 A;  5HV8 A;  3AEF C;  3CPW O;  2ZYA A;  2OAR A;  3H1L E;  4H13 D;  4COP A;  2K88 A;  3L70 J;  3CCQ P;  1DD3 A;  4IL6 X;  2JGP A;  3C1L A;  3JSV C;  1NTM D;  4GR2 A;  2GZG A;  2H7H A;  3TF5 A;  2FY8 A;  5C39 A;  2GZI A;  2KS1 B;  3BAT A;  1X22 A;  3RK2 B;  3CCS P;  2BCC G;  2K0D X;  3II6 A;  1NTM J;  1NKN A;  1PFI A;  1IFN A;  1YIT P;  3CWB G;  3WMM 0;  2KGC A;  1ZLL A;  1YYC A;  1SQX E;  1FE6 A;  2QA4 P;  1E6J P;  1H0T B;  3VRL C;  1N7S C;  4D6T D;  2QE7 H;  2WSC J;  1ZOY C;  4JYC A;  3V2Q A;  2O01 N;  3HE5 A;  3CXH D;  1PP9 D;  2FYU D;  2CK3 H;  1M1J C;  2E76 C;  2VLO A;  4BPH A;  1ZRT D;  5CCH A;  3EFG A;  2YKP A;  2XDJ A;  1U7J A;  1PIX A;  2W8Z A;  1IZN B;  4KJM A;  2KGE A;  1FZG A;  3L73 D;  1QLE D;  3M9H A;  1RF0 A;  2VLQ A;  1NTK J;  4Z1M H;  1L0L D;  2M5A A;  2KS1 A;  2W27 A;  2FYN B;  2QM7 A;  2YXQ B;  1ZN5 A;  3L73 G;  2ZT9 D;  3DTJ A;  1IK9 A;  1SQX J;  4I7Z C;  2JU1 A;  1HJ0 A;  2AXT H;  2JEE A;  5AVQ B;  1NTZ E;  1J1E B;  2L5G B;  1MZ9 A;  2IZ1 A;  3TGU D;  1SQQ K;  2PEI A;  2EG5 A;  4IFM A;  3PH0 A;  2FAD A;  2KYV A;  1PGJ A;  1X0T A;  2GUS A;  4H13 B;  1URQ D;  2L6E A;  1JMM A;  3L37 A;  4N78 D;  2VRS A;  4B86 A;  2A45 G;  3FWL A;  3V4W A;  2P58 A;  3WU2 E;  3CCR P;  1YTZ I;  4WVZ A;  2KGD A;  1GZL A;  1GK6 A;  2BCC D;  4HKG A;  1RE4 A;  5APX A;  1CSB A;  2XND H;  1NGM B;  1QL1 A;  3M0A A;  3IF4 A;  2QVA A;  2ITA A;  3SFE C;  1LT1 A;  1N73 B;  1XTG B;  3KDP B;  5KLV K;  3H1I D;  3GG2 A;  2MD9 A;  1KB9 E;  2PAJ A;  3G71 P;  3CCU P;  3A0B H;  4JF7 A;  3A2A A;  2CPB A;  3HD7 B;  1MZ8 A;  2WMM A;  2POH A;  1HF9 A;  2D2C B;  3T97 B;  3AE1 C;  1FOS E;  2PEO A;  2YMY A;  3AE3 C;  4QMA A;  1CI6 B;  2Z46 A;  1S5L X;  5AW4 B;  1Y8A A;  3LID A;  3HTK A;  4ZNC A;  5AW8 B;  1IFM A;  5EJD A;  2KGA A;  2FBW C;  5APY A;  3MGN A;  1SQX G;  3H1K D;  5CMZ A;  1SQV E;  5KJ7 D;  1MUU A;  1DEB A;  1LTT C;  1N7S A;  5CJ0 A;  2IYP A;  3H32 A;  4U0B A;  1AYI A;  2BCC E;  1T3J A;  3TK1 A;  1FZF A;  1OX3 A;  3WBH A;  2HFE D;  1A02 J;  1YHQ P;  1PGO A;  2E75 D;  1JY3 P;  3NXS A;  2FYZ A;  1FZC B;  5AVX B;  3PP5 A;  1K04 A;  3N7N A;  2R44 A;  1WRG A;  5BS1 A;  2E74 D;  5HGO A;  3L73 J;  3DPH A;  1JJ2 O;  1URQ B;  1M8O B;  1EIA A;  1P84 H;  1NTZ K;  1JY2 P;  2OYI A;  2FFD B;  1YBK A;  4GR6 A;  4W7Z A;  2CQ8 A;  4AYC A;  4WY4 A;  1E79 H;  3LIE A;  2WSF J;  4W7Y A;  2FHS C;  1OW7 A;  3NY7 B;  1DH3 A;  1FZB A;  2CPS A;  3VP8 A;  1SQV G;  1PPJ E;  5GTH E;  4DOJ A;  4H44 B;  1JTH A;  2WT7 B;  5KLV J;  3RK3 B;  2ZXE B;  5TJH A;  2XZ1 C;  3H1H J;  1JNM A;  3K5B A;  2IBZ G;  2M0B A;  5APW A;  1J1D B;  5GTI E;  1EZV I;  1L0L G;  1Q81 Q;  3L35 A;  2W83 C;  1OVV A;  1RNI A;  4KT0 J;  3Q5P A;  3RK2 D;  4N3Y B;  1YQ3 C;  3D70 A;  3HYB A;  4H0L C;  4EOT A;  3H1H G;  3NFQ A;  1H8A A;  3MUD A;  3U59 A;  2K1A A;  2PEK A;  3GMA A;  3H1K G;  1SQX D;  1VDF A;  1KB9 H;  1LT9 B;  3WUV A;  1GL2 D;  1RF1 A;  3JC2 2;  2Z4E A;  2JB0 A;  2C0X A;  2VSQ A; 
#chains in the Genus database with same CATH homology
 1KC8 Q;  2M8P A;  3OW2 O;  1M6N A;  1VQM P;  2QA4 P;  1VQ4 P;  3CXC O;  1E6J P;  3G4S P;  2KOD A;  2Z44 A;  5BS1 A;  3G21 A;  2PEQ A;  3RG6 C;  3VRL C;  5HGO A;  3H0D A;  3CCR P;  4XFZ A;  1M1K Q;  2P9X A;  1PEO A;  3DPH A;  4WYM A;  1K73 Q;  1VQO P;  3G1I A;  3H47 A;  1A8O A;  1JJ2 O;  2OTL P;  1EIA A;  1K9M Q;  1VQ6 P;  1D1D A;  1W2B O;  1YIJ P;  3MGE A;  3DS2 A;  1VQP P;  4U0D A;  1PEQ A;  3CCJ P;  3H4E A;  1YI2 P;  3P05 A;  3CD6 P;  4GR6 A;  3CCE P;  1VQ7 P;  3DS0 A;  3G6E P;  1RO0 A;  1VQ5 P;  2BQ1 E;  1ZMB A;  1VQ9 P;  1YJN P;  3G71 P;  5F2K A;  3G29 A;  3CCU P;  1PEM A;  2EIA A;  1K8A Q;  2JO0 A;  3DS4 A;  5HGM A;  2DGY A;  1AUM A;  2CWO A;  4COC A;  4U0F A;  1YJW P;  3CCL P;  1M74 A;  3G1G A;  2XV6 A;  2BUO A;  5JPA A;  2M8N A;  1M6E X;  4XFY A;  2PEO A;  5HGL A;  3CCV P;  1VQ8 P;  3DS1 A;  3NTE A;  3CC4 P;  2Z46 A;  3HZQ A;  3CME P;  3G28 A;  3DS3 A;  3CCM P;  1IUQ A;  1YJ9 P;  3CC2 P;  1BAJ A;  3M1M A;  2PY8 A;  1Q86 Q;  3DTJ A;  1K30 A;  2PEJ A;  1M90 Q;  4XRQ A;  2XXM A;  2OTJ P;  4XFX A;  3CPW O;  2EFJ A;  4XRO A;  2Z45 A;  2OAR A;  4PH0 A;  5F2N A;  3DS5 A;  1Q81 Q;  5F2O A;  3E2D A;  3CMA P;  4COP A;  1Q7Y Q;  3CCQ P;  4PH1 A;  2E1M A;  1RNI A;  1QVF O;  4U0C A;  4GR2 A;  1NJI Q;  3I55 P;  1KD1 Q;  2PEI A;  2EG5 A;  2JYL A;  4U0A A;  1QRJ A;  4U0B A;  4M0I A;  3HYB A;  1Q82 Q;  1VQN P;  3Q20 A;  4U0E A;  1KQS O;  3LRY A;  4IPY A;  3G0V A;  2XT1 A;  2JYG A;  3WBH A;  5HGN A;  1A43 A;  3I56 P;  1S72 P;  2PEM A;  3CCS P;  1YHQ P;  1VQL P;  1N8R Q;  1EOQ A;  2QEX P;  5I4T G;  3G26 A;  2PEK A;  2PEN A;  2M8L A;  1QVG O;  3B5I A;  5DCK A;  5BS2 A;  1YIT P;  1RO2 A;  2L6E A;  1VQK P;  1PEU A;  2ONT A;  3CC7 P;  2BHV A;  2LF4 A;  4QNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...