1YIJP

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yijP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yijP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yijP02
3CPWO 1YHQP 1QVGO 1VQ7P 1Q81Q 1VQLP 3G4SP 1VQ6P 1VQMP 1Q82Q 3G71P 3CCJP 3CCSP 1KQSO 1VQ4P 1VQKP 1VQPP 2OTJP 3I56P 1VQOP 1YJWP 3I55P 1KC8Q 1VQ8P 3OW2O 1Q86Q 3CCVP 3CCUP 1W2BO 3CC4P 1NJIQ 3CCMP 1K73Q 1M1KQ 1K9MQ 2QEXP 1Q7YQ 1KD1Q 3CC2P 1YI2P 3CMEP 1VQ5P 1YIJP 2QA4P 1YJNP 1JJ2O 3CCEP 1YJ9P 3CCLP 1K8AQ 1QVFO 1VQNP 1VQ9P 1S72P 3CC7P 1N8RQ 2OTLP 1M90Q 3G6EP 3CCRP 3CCQP 3CMAP 3CXCO 3CD6P 1YITP
chains in the Genus database with same CATH superfamily
1GL2D 1D1DA 1VQ6P 3H1HJ 3E1RA 2K94A 3AE8C 2MR8A 3H1IG 4TLFA 1NH4A 2GZFA 1L0ND 5APQA 1G1IA 3E7KA 3GG2A 3GHGC 2B87A 2K0YA 2WSEJ 1AA0A 4WB4A 2CWOA 1IFJA 2FYNB 3AE4C 4H44B 1HBWA 1YJ9P 1ZR2A 2ZYDA 1RF1A 1EXIA 3LW5J 1GDTA 1RO0A 1SQQD 1L0LK 4XE5B 3M9BA 1A02F 1URQD 3CCJP 1UNKA 1MKMA 2KOPA 1VKUA 3B4QA 4KT0J 5KP7B 4HJGH 5GTIH 1EDLA 3BVHA 3HE4B 5F2KA 2XT1A 2IPPA 3L73J 1UIIA 4UB6H 2N98A 4C7NA 2Z5IA 1LP1A 4I1LA 1FZFA 3L73E 2KLVA 3RG6C 2IZ1A 1RF1C 1Q90D 2A06D 1SQPG 2JWDA 1X9VA 3TSIA 3N7NA 2R5DA 3KYQA 1PGQA 4PH1A 1ZRTE 1LTTC 2W83C 3AE9C 3H25A 3TGUD 1OZHA 1UIXA 2NPSD 2M5RA 1LGHB 1HVVA 1GL2A 1NU1D 3RL0B 4U0CA 3CCEP 3NTEA 1BCCD 1KB9E 2YNYA 1T2KC 4H13C 1DD4A 5M1BA 3NMDA 5AW1B 2PEJA 5APUA 1JY2P 2MD9A 5BS2A 2QNWA 3NY7B 3B71A 4GKGA 2O1JA 1D7MA 3CCMP 3BCCD 4JYCA 3H0DA 1OW6A 2BCCG 3WU2E 1S9KD 2D2CC 3ITKA 2KIKA 4DOJA 4HH2A 2Y9ZA 1FE6A 3SFEC 1PFIA 4GOFA 3L74G 2FFDA 2PEMA 2WSEH 5DJUB 2JBGA 2E75B 3H32B 2JYLA 3MUDC 1URQA 5B5EE 1E6JP 1BE3D 2AEFA 2IDBA 4PJ0H 2IFNA 2VLOA 4XROA 2OTJP 2XV5A 2E43A 2Q6QA 4U0BA 4AQRD 1SP4A 2HR3A 3GZLA 2KWLA 3DS5A 3CXHE 1K05A 2WITA 2O3JA 2WZ7A 1P84E 1BAJA 3CXCO 1JB0J 1KLPA 1J1EC 2FFDC 1RQVA 3H1LD 3KHUA 5EW5E 1URQC 1W2BO 2AFEA 4OH8B 1H89A 3L75G 2Y0CA 4U3FG 4KHXA 2JO1A 4BRYB 3L71J 1QLED 1BXIA 3WMM0 4JBZA 3RK3B 1PZQA 1FOSE 2GDXA 1GPJA 3L71E 4MN4C 4QNBA 2RKLA 1N73C 3OW2O 1NAFA 5CJ0A 2WPSA 4WY4A 3H1JJ 5AVVB 3EFFK 1Q7YQ 1EDKA 3KDPB 3DTJA 1NYHA 1KB9H 4GIFA 4IFMA 4DG9A 3H1JE 4CPGA 5AW9B 2E74B 2AEMA 5B66E 2YO2A 3IFMA 4JPZB 4PD4E 4PV1D 3IN6A 5AW0B 1JY2N 1DNYA 2H7HA 2QM7A 2K92A 4IFDK 1GXGA 3CCQP 5AW5B 2WSSH 2IBZD 2FYUE 5AVSB 1KN7A 1FC2C 3HE4A 2K9YA 4WY4C 3RBXA 3FXEA 2LIWA 2N6YA 2KG9A 2KORA 2W8ZA 1FZBA 2YMKA 3L72G 1FZCA 1NQ4A 3GHGB 3GZMA 1PL5A 4H0LD 4H44C 3TYYA 2P67A 5EFWB 1SQPK 2LIUA 4IPYA 1S4XA 3HD7A 4DJGA 1T8ZA 4L75A 2YO3A 5CBNA 1JY2O 1U57A 1Q86Q 5GTHE 1USDA 3B5NB 3M9HA 5K5GB 3CXHH 4R0MA 1P84H 1G1JA 2Z5HA 3ZDMA 1GK6A 2A06G 1IFIA 5F2NA 1VF5B 3H1IJ 3EFGA 4BWNA 4EI2A 1VQKP 1DV5A 2HLOA 3TGUG 1MV8A 3L70G 4UB8E 3D71A 1NU1G 1SQXD 3HD7C 1GK4A 1KILE 2KOQA 3AEFC 1PEMA 1SQVK 2FYZA 2ZT9B 3RK3E 3U1CA 1OWAA 3G26A 1RF1B 2IBZI 5CCGD 2M8LA 1JMMA 3CC2P 3OAKA 3BCCG 2M8PA 4NPEA 4GR6A 3HUSB 2WT7A 3RL0C 1E0HA 2KR5A 5B66H 3H32A 1IJDB 1T8KA 2EHSA 1Q82Q 1H8AA 1JEKA 1KYOD 1FR2A 3G28A 2LPKA 2JU1A 2SPZA 4N78D 2XZ1C 4C7NB 2YIUB 2QJPC 2FACA 1CZQA 1SFCA 3B8EB 3BRVB 2JEEA 1YBKA 3H1KE 3CPWO 1A43A 1JO5A 3JSVC 4OVNF 1OIPA 2MF4A 1SQPJ 2X2BA 1S3JA 3WUVA 2WWWA 1VQPP 4EDFA 1IMQA 4YXDC 2M8NA 1IZNB 1M57D 2A45H 4H2WC 5AW4B 2D2CB 4U0FA 2W6JH 2J5UA 1K8AQ 3DS0A 2E75C 2XDJA 1FBMA 2ZXXA 1SS1A 1L0IA 2K5XA 2GUSA 2KS1A 1G2CA 1Q2NA 1AJYA 1GL2B 5KLVG 2JGPA 4BRYA 3VP9A 1QRJA 5GTHH 1IO4A 5AW8B 3G0VA 4WWIA 2MVVA 2N5IA 1NTZD 3MIWA 1SFCC 3WUTA 3MP7B 1LTIC 1YYCA 3IF4A 5DCKA 2QSIA 4I7ZC 4BPGA 2RMZA 1GW3A 1E79H 2CK3H 4H0LC 1L0NK 3V2RA 4U0EA 4GR2A 1SQVJ 3B5IA 1NTMD 2XU6A 1SQVE 1NHLA 1TU3F 2KB7P 5AVZB 4IL6E 2WTYA 1M6NA 5CCGA 3I5CA 1URQB 3D6YA 1SQQK 2AXTH 3MGEA 4OWFA 4AUWA 2E76D 3B4SA 5TJHA 3BRTB 1CI6A 3Q2YA 2FAEA 4IFFA 2K88A 3AE6C 2CPSA 3M0DA 2IBZG 3FX0A 1OFCX 3PHLA 4K3AA 1RO2A 4YXWH 1PP9D 2E74C 1BGYJ 2BUOA 2PY8A 3L75D 5BVZA 2FVFA 1KQLA 4GODA 1WT6A 4HYTB 1FDOA 3GMAA 4I2LC 1MZ9A 3GLMA 1BGYE 3CC7P 3CX5D 3E1IA 2KOSA 2FKWB 1NTKJ 3NXSA 1IK7A 1OVUA 3H4EA 1QL1A 2N5HA 4W7YA 5F2OA 1NTKE 2NPSB 2NZ2A 3RG2A 1BDCA 1K30A 3T97B 1VL2A 3H1HE 1RQUA 2K2QA 3M0DC 1HJ0A 3AEEC 4WY4B 2YKOA 3E2DA 1L0NJ 4DT0A 1YJWP 2LKIA 2AF8A 2L91A 1JY3O 1L0NE 2JB0A 2K0XA 4BPFA 2JP3A 4R4MA 2KK7A 3B5NC 4OGQD 1YQ4C 3KPEA 1SQXG 5HVCA 1YITP 4ASWA 1ZMEC 3V2QA 3G3ZA 3L36A 3CCSP 1GMJA 3L35A 4PJ0E 1VF5C 2XV6A 3HUSA 1DEEG 1JCCA 4N3YB 1GZLA 3P7KA 1K9MQ 1PPJE 1SQQJ 1VDFA 3L72D 4Y28J 4IL6H 4YTPC 2H8PD 2OYIB 3FGAD 3IAOA 3GF7A 4ZMDA 2K9JA 1EDIA 3CX5I 2ZT9C 1FZCB 4Y99B 4DCKA 2ZXEB 3HD7B 4XRQA 1EIAA 1JJ2O 3A7OA 2FXMA 2ZJSE 2PP6A 3Q1MA 1ZRTD 1U7JA 2L4BA 3H1KG 3VP8A 2YKPA 3HUSC 4BXLA 1VQLP 3USSA 1NVOA 2J58A 4D6TG 2PEOA 3P32A 3HE5A 3L70D 1ZXGA 3Q20A 1VQ5P 2Q1KA 1QVFO 1KB9D 3HRNA 2OYHA 2V7QJ 2RH0A 2GA1A 2YIUC 2L5GB 2POHA 4ZKPA 3WUUA 1Z56A 5AW7B 2LXCB 2L0QA 1BCCJ 1X8YA 1HTLC 1CSBA 2QJPB 1NTZG 1AVYA 4QKOA 1BCCE 5HGOA 4L74A 1HF9A 2N1TD 2WSFJ 1GU5A 2FXPA 2P7JA 2LTEA 4ZKUA 3L37A 2GZEA 1L0LJ 4PV1B 3TK1A 1RY3A 2WT7B 1GL2C 4K35A 2VLQA 2PNGA 1NTMG 1N2DC 1NKNA 2JU2A 5L8RJ 1L0LE 5KAIH 3CE7A 2FVAA 3D6ZA 2HYNA 3KXDA 5BU8B 1VQMP 3NFQA 1HH0A 2ERHA 3A0HE 1SFCB 3G1IA 1BE3J 3CC4P 1NJIQ 5KP6B 4I7ZB 3CXHD 3F89A 1ACPA 1P84D 1BE3E 4H0LB 3PTZA 1EZVE 3AE3C 2KGDA 3P8CE 4OGQC 5KLVD 1AFOA 1SQBG 1J1DC 1NAYA 3TNUB 1N7SD 1S5LX 1PP9G 2LXBA 3F5HA 3FWNA 2KS1B 1G2CB 4XA4A 2KUBA 3LIEA 2G3AA 1FJKA 4IZ6A 3H1LJ 7CEIA 1JM0A 2NPSA 2C0XA 1NOHA 1UJZA 2YKQA 3AEDC 1Y9BA 5APSA 2FBWC 3L71D 2OARA 3T97A 2KSEA 3BASA 3V2PA 2GDYA 1DEBA 1M1KQ 4RESB 1YI2P 1PGPA 2I8DA 2KZJA 3H1HG 5APXA 3U59A 2PRRA 3H1JD 2G8YA 1NO4A 2PAJA 4XFZA 2V7QH 4PD4D 2PENA 3CWBJ 1ZV8A 2Y9YA 1SLQA 1N86A 2N1TA 3SWFA 2M5AA 2E5TA 3CWBE 3K5BA 2NPSC 5CCHD 1MFTA 4IOIH 2FYUD 3OA7A 2B89A 4NPDA 1MZ8A 3VMXA 1USEA 2OYIA 1CI6B 2WSFH 1M7LA 1L0HA 5C39A 1XTCC 2XZ0D 5KLIB 2NRGA 1GD2E 2YMYA 4L73A 1FDMA 5AVRB 4COPA 2HPCA 2KOGA 3VTPC 4U0DA 1RF0A 3OJAB 1A8OA 1IK9A 3N4XA 3A0HH 3HTKA 2RN0A 2IZ0A 1LNQA 2M0BA 2N1TC 2Q3EA 2K3RA 2MKVA 3L73G 3EJEA 2QEXP 2WSCJ 2Y0DA 1BSHA 5AVWB 2W27A 2W6AA 1PGJA 1LWUA 2AFDA 2JQ4A 4M0IA 2AXCA 3GW6A 2OYIC 1R5SA 3O6QA 3S9OA 4PWVB 1OX3A 1KQSO 2LR2A 2Q9IA 2FHSC 5KKZB 3CCVP 2QJKB 2KP8A 3H1IE 1GW4A 1M74A 1FZCC 1M1JA 1KD1Q 4Y99C 4PD4I 5AW3B 1ZLLA 3VMAA 2BHVA 1RF0C 3BATA 2CQ8A 1KILD 1NTZK 3RK3D 3RK2D 1L4AD 1VQ4P 5CHXA 5APTA 3C1LA 3Q5SA 1LWUC 4QMAA 2KW2A 2AXTE 2VRSA 1S2EA 5APWA 1NTMK 3MTUE 5KJ7D 2KGCA 2LMLA 1R5LA 2LKMA 2P9XA 3FWLA 4R4LA 3LRYA 3DS4A 2O01J 5EJDA 1U7MA 1JY3P 3AECC 4JYBA 2YXQB 2H43A 2E76B 2GYKA 2PGDA 2K9JB 1YTZI 5AW2B 3VMYA 3V2NA 3H1KD 2FADA 2Q7CA 3LMOA 2R3CA 2VLPA 1K04A 1LTAC 4D6TD 1M56D 3DPHA 2PFXA 1HGZA 5DJTB 1S5LE 3M9QA 4PV1C 5APYA 1JNMA 1SQPE 1PEQA 1AYIA 1BDDA 3A2AA 3TNUA 1WRGA 3HE5B 4PH0A 3ABVC 2PEKA 1EC5A 3G71P 2R44A 1AVOA 2GDWA 1FU1A 3QH9A 4XFXA 1RNIA 2E1MA 2OYHB 2HFED 3P8MC 4C46A 2GZJA 1DX7A 4EYYQ 2QJYB 1VPCA 1YQ3C 2WSCH 4RJTA 2BEZF 3G9RA 3M0AA 2GUVA 3U43A 1NTZJ 3SFDC 2BCCJ 3L71G 2ITAA 2KNCA 1KFMA 2KG8A 1MFZA 3GF3A 5H2FE 4COCA 1CEIA 2BCCE 1L4AA 1GTWA 2XNDH 1NKZB 1QL2A 3L74J 2N9BA 4WBAA 1KYOI 4EOTA 4OGQB 2MR7A 4GDOA 1J1DB 3M1MA 1KFNA 3H1JG 3MGNA 1NTMJ 3L74E 2QRXA 1N7LA 5KJ7A 1X79B 1LT1A 2DW3A 3HZQA 4C7RA 5KAFH 3DS2A 1YHQP 2C9LY 1SQBD 2FYUG 3A3YB 2FQ2A 3AE1C 3TDKA 3AEBC 2N6ZA 1L4AC 5E79E 1KV4A 1T2KD 3AEGC 2O01H 2A45G 2OYOA 3FXDA 4H13D 5CCGC 3V4QA 2KXPB 1JY3N 2QIWA 3DS1A 1PP9J 2N9YB 2WPQA 3L75J 4GOEA 1VQ7P 4U3FJ 1FDIA 2Z4EA 2GM4A 2XZRA 4Z1MH 2HODB 3JC22 2P1JA 3TF5A 1PV3A 5CBOA 1S5LH 1RE3A 3L75E 1AUMA 1NTKD 1JTHB 4U3FE 2FXOA 2JAZA 3H1HD 5KLIC 1EDJA 2JO0A 2ZAEB 2O1KA 1IFNA 1NWQA 1NU1K 5AVQB 2JWAA 1LTJA 1IC2A 3AE2C 3W68A 2XKMA 2EG5A 5HGNA 2JKVA 1HGVA 2B9BA 3A0BH 2K93A 1VQ9P 3M06A 1N8RQ 2FQ0A 3H6PA 5KAIE 1KQGB 5AW6B 2N1TB 1DIPA 1RE3C 2M5AB 1F80D 2ROQA 2AEJA 2KGAA 3MZWB 3NTNA 1AV1A 4UHPB 1VHNA 5H2FH 1Y8AA 3DS3A 1PPJD 2K0DX 2ZYGA 1NGMB 2CNRA 5KKZC 2E5YA 2QJKC 3PH0A 4B86A 1KTMA 3MD0A 1LTJC 5HGLA 3CMAP 1JMBA 5BU5A 1SQQE 1QVGO 1BSNA 4U7JA 2CG5B 3L72J 2HPCB 3L73D 4XFYA 5HGMA 3O8ZA 1PEOA 1SVFA 2K37A 3C9IA 1W2EA 1ZOYC 3L72E 5TISE 1CW5A 1HY8A 3HTKB 2VLNA 4DZOA 5APVA 3V5BA 1OXZA 3RBZA 1T3JA 4I6MC 2P58A 5E79H 1LWUB 3VMZA 1N7SB 4HKZH 5KLVK 1K73Q 1X22A 2WQYC 2JJLA 3G29A 1YIJP 3O6QB 3GJNA 2A06E 1HJBA 3TGUJ 2E76C 2L9FA 3L70J 1M1JB 1DD3A 2W6BA 1NU1J 3TGUE 1AQTA 3A5TA 2L6EA 3L70E 4M3LA 2EFJA 1H0TA 2NO8A 1NU1E 2EHTA 3CX5H 2IYOA 3MUDA 4WYMA 2OTLP 5CJ4A 4WY4D 2R32A 2I1JA 5AVXB 1RH5B 3BCCJ 2AVAA 1Y47A 2Q3IA 1S1CX 3G1GA 2LL8A 1FJPA 3BCCE 4H44D 4W80A 3EQ2A 3C8VA 1L0LD 2OYHC 3HYBA 1SQVG 3VN0A 1HWTC 1VQNP 5CMZA 1S9KE 2QJYC 3CI9A 1XTGB 1MUUA 2P2UA 2KG6A 2FYUK 1ZMBA 3U1AA 2L22A 2UWJE 1FZEA 1EZVD 5KP8B 1EXJA 3LW5H 1EQ7A 3P8CD 1AQ5A 2KI7B 2JDIH 3I56P 1KB9I 1QGKB 4AYCA 3PJSK 3PP5A 1X3OA 5TISH 3CL3D 1N73A 3HD7D 3CLQA 3CMEP 2OQQA 2HODA 5KLVJ 2WMMA 1FAVA 1W5CE 1H88A 2H89C 1BGYG 1RHZB 2O01N 2LF4A 1JTHA 2KZIA 5KLVE 1Q81Q 3H1LE 4RKUJ 2Y0EA 3GKLC 3SWYA 2C9NY 4BPHA 4KJMA 1NTKG 3EJBA 1LTSC 3RL0D 2BQ1E 3AE7C 2FVEA 2KGEA 2KNCB 3G6EP 1KILB 1LTGC 5I4TG 3RK2B 3IR9A 1JOCA 4RO0A 1L4AB 4N6JA 1SQXK 1HUCA 3H47A 2XNXA 2W90A 3CWBD 1EMVA 1L0NG 2ZVNB 2QE7H 3VRLC 4O9BA 5CZDB 3CXHI 3LIDA 1P84I 1EZVI 1QEXA 2M3EA 2KODA 1LT9B 2E75D 3WU2H 2FYUJ 2C0WA 4ZNCA 1PPJG 3P05A 3JCUE 4IL6X 1FS0E 1R8EA 1PEUA 2N50A 3AEAC 3Q5RA 1KORA 1GU4A 4F37A 1SQQG 2IBZE 2ZFCA 3V6IA 1JCDA 5HV8A 3EJDA 1M6EX 2GZGA 3I55P 1SFCD 2FYNC 4LLHA 1JUNA 2OGUA 4HB1A 5B5EH 3EWKA 1FZGA 2QA4P 3WBHA 1N7SA 2Z46A 2I1KA 5JPAA 3VOPA 1FZAA 4HKGA 3VYIA 1RE4A 1HQBA 5KTBA 2B88A 3L4FA 3RGUA 1OVRA 4LGDE 3H1ID 1Z6MA 3R2PA 1AF8A 3CCUP 2ONTA 1FOSF 4GT1A 4NPFX 3SSUA 1LTJB 4JF7A 2WPVB 1M90Q 3Q5PA 2CPBA 2ZYAA 1KMIZ 2FQ1A 1GXHA 1SQXJ 2VSQA 2B87B 1N7SC 3KQGA 2DGYA 4H2YC 3CCLP 2V4HA 2P10A 2IX7C 1BCCG 1SQXE 1KQFB 1RE4C 5KAFE 2A45I 3QWOC 2E74D 4CA3A 4YPCA 4H2XC 1VQ8P 4TT3H 5CCHA 1M1JC 2KOOA 3G21A 3KZIE 3SWKA 2XXMA 2OTKE 2Z45A 2KLUA 4L76A 1L0LG 3M91A 3V4WA 2YXRB 3CD6P 1KZUB 4PD4H 4PXHB 4W7ZA 2Q5UA 1KYOE 2QVAA 4EIJA 3H1KJ 1SQBK 3S4RA 3JCUH 4N78E 1SQPD 3R4YA 2K1AA 1LP1B 4H13B 2EIAA 1OVVA 4D6TJ 1BE3G 1EZVG 5CCHC 1M8OB 2FY8A 4JQ0D 3AE5C 1LTBC 4D6TE 1VQOP 4NEOA 4WVZA 3B5ND 2WPRA 2KYVA 5AVTB 1WMKA 2HG5D 1NTKK 2R3SA 3A0BE 2ZVOB 1VF5D 1ZNVA 1OW7A 1YJNP 1IMPA 2M8RA 1ZN5A 1H0TB 2MVUA 1L2PA 2MJZA 2IYPA 3MHVA 3H1LG 1ZP0C 3Q3DA 1KILA 3D70A 2BCCD 2PEQA 1NTZE 1SQVD 2JR8A 2Z44A 2ZT9D 1ZR4A 2IFMA 3L74D 2R5BA 1IFPA 4UB8H 2BEQD 1ZW0A 1IUQA 2WPTA 2E42A 1NTME 3PRJA 2M3BA 3S1KA 3II6A 5GTIE 1J1EB 1S72P 3CWBG 1OR5A 2FFDB 1EOQA 3PLNA 2J59M 3W67A 1LT9A 2GZIA 2H88C 2JYGA 4UB6E 1KILC 3RK3C 1A02J 3RK2C 2QM8A 3KZIH 1PGOA 2WVRA 1DH3A 3UIAA 3RL0g 2DNWA 2QG4A 1SQBJ 1LJ2A 2PEIA 1PIXA 1BGYD 1X0TA 4ASVA 4LC1A 1QX8A 1SQBE 4XFJA 1N73B 2BASA 3G4SP 5AVUB 1J2JB 1OMIA 1KYOH 3GHGA 5KJ7C 1KC8Q 1T3UA 1PP9E 4U3FD 1IFMA 4MRTC 1YTZT 5AVYB 2MY5A 2D2CD 4U0AA 1E5WA 1T6AA 2KSJA 2CGQA 1OW8A 1LT9C 4A7PA 3CX5E 3CCRP 2LOLA 3B5NA 5BS1A 1IFDA
chains in the Genus database with same CATH topology
3CPWO 1A43A 2P9XA 1D1DA 1VQ6P 1VQMP 1RO2A 1VQPP 3LRYA 3DS4A 3G1GA 2M8NA 1Q86Q 2BUOA 2PY8A 3G1IA 3H47A 1W2BO 3CC4P 1NJIQ 3DS3A 2PEQA 4XRQA 4U0FA 4U0CA 1EIAA 3HYBA 3HZQA 2DGYA 4COPA 1K8AQ 1JJ2O 3NTEA 3CCEP 3CCLP 1VQNP 3DS0A 2Z44A 3CC7P 3DS2A 3VRLC 4U0DA 5HGLA 5F2NA 3CMAP 1A8OA 1YHQP 1QVGO 1VQLP 2PEJA 2CWOA 1VQKP 3H4EA 4QNBA 5BS2A 1QRJA 3DPHA 1VQ8P 2PEOA 3G0VA 3OW2O 1ZMBA 5F2OA 2KODA 1IUQA 4XFYA 5HGMA 3G21A 3CCMP 3Q20A 1PEOA 2QEXP 2XXMA 1Q7YQ 1K30A 3H0DA 1VQ5P 2Z45A 1PEQA 3P05A 3DTJA 1YJ9P 1QVFO 5DCKA 1S72P 1EOQA 1PEUA 1RO0A 3DS1A 4PH0A 3CD6P 4M0IA 1PEMA 1VQ7P 2PEKA 4U0EA 2OARA 4GR2A 2JYGA 3E2DA 1KQSO 3G71P 3CCJP 3G26A 1M6EX 3I56P 1YJWP 3I55P 2PEMA 3B5IA 4XFXA 1RNIA 2E1MA 3CCVP 1AUMA 2M8LA 1K73Q 1M1KQ 1M74A 1KD1Q 3CC2P 1YI2P 3G29A 2JYLA 1YIJP 3CMEP 2QA4P 2M8PA 3WBHA 2PEIA 2BHVA 4GR6A 2XT1A 2EIAA 1E6JP 5F2KA 5HGOA 2JO0A 1M6NA 2LF4A 3CCQP 2Z46A 1YITP 5JPAA 1Q81Q 4XFZA 3G4SP 1Q82Q 3CCSP 1VQ4P 2XV6A 4XROA 2OTJP 1VQOP 2PENA 1KC8Q 2L6EA 3G28A 4U0BA 3RG6C 2EFJA 3CCUP 2EG5A 2ONTA 5HGNA 1K9MQ 3MGEA 4COCA 4U0AA 3DS5A 2BQ1E 1VQ9P 4WYMA 1N8RQ 2OTLP 1BAJA 1M90Q 3G6EP 3CCRP 4PH1A 3CXCO 5BS1A 5I4TG 1YJNP 3M1MA 4IPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW O;  1YHQ P;  1QVG O;  1VQ7 P;  1Q81 Q;  1VQL P;  3G4S P;  1VQ6 P;  1VQM P;  1Q82 Q;  3G71 P;  3CCJ P;  3CCS P;  1KQS O;  1VQ4 P;  1VQK P;  1VQP P;  2OTJ P;  3I56 P;  1VQO P;  1YJW P;  3I55 P;  1KC8 Q;  1VQ8 P;  3OW2 O;  1Q86 Q;  3CCV P;  3CCU P;  1W2B O;  3CC4 P;  1NJI Q;  3CCM P;  1K73 Q;  1M1K Q;  1K9M Q;  2QEX P;  1Q7Y Q;  1KD1 Q;  3CC2 P;  1YI2 P;  3CME P;  1VQ5 P;  1YIJ P;  2QA4 P;  1YJN P;  1JJ2 O;  3CCE P;  1YJ9 P;  3CCL P;  1K8A Q;  1QVF O;  1VQN P;  1VQ9 P;  1S72 P;  3CC7 P;  1N8R Q;  2OTL P;  1M90 Q;  3G6E P;  3CCR P;  3CCQ P;  3CMA P;  3CXC O;  3CD6 P;  1YIT P; 
#chains in the Genus database with same CATH topology
 1GL2 D;  1D1D A;  1VQ6 P;  3H1H J;  3E1R A;  2K94 A;  3AE8 C;  2MR8 A;  3H1I G;  4TLF A;  1NH4 A;  2GZF A;  1L0N D;  5APQ A;  1G1I A;  3E7K A;  3GG2 A;  3GHG C;  2B87 A;  2K0Y A;  2WSE J;  1AA0 A;  4WB4 A;  2CWO A;  1IFJ A;  2FYN B;  3AE4 C;  4H44 B;  1HBW A;  1YJ9 P;  1ZR2 A;  2ZYD A;  1RF1 A;  1EXI A;  3LW5 J;  1GDT A;  1RO0 A;  1SQQ D;  1L0L K;  4XE5 B;  3M9B A;  1A02 F;  1URQ D;  3CCJ P;  1UNK A;  1MKM A;  2KOP A;  1VKU A;  3B4Q A;  4KT0 J;  5KP7 B;  4HJG H;  5GTI H;  1EDL A;  3BVH A;  3HE4 B;  5F2K A;  2XT1 A;  2IPP A;  3L73 J;  1UII A;  4UB6 H;  2N98 A;  4C7N A;  2Z5I A;  1LP1 A;  4I1L A;  1FZF A;  3L73 E;  2KLV A;  3RG6 C;  2IZ1 A;  1RF1 C;  1Q90 D;  2A06 D;  1SQP G;  2JWD A;  1X9V A;  3TSI A;  3N7N A;  2R5D A;  3KYQ A;  1PGQ A;  4PH1 A;  1ZRT E;  1LTT C;  2W83 C;  3AE9 C;  3H25 A;  3TGU D;  1OZH A;  1UIX A;  2NPS D;  2M5R A;  1LGH B;  1HVV A;  1GL2 A;  1NU1 D;  3RL0 B;  4U0C A;  3CCE P;  3NTE A;  1BCC D;  1KB9 E;  2YNY A;  1T2K C;  4H13 C;  1DD4 A;  5M1B A;  3NMD A;  5AW1 B;  2PEJ A;  5APU A;  1JY2 P;  2MD9 A;  5BS2 A;  2QNW A;  3NY7 B;  3B71 A;  4GKG A;  2O1J A;  1D7M A;  3CCM P;  3BCC D;  4JYC A;  3H0D A;  1OW6 A;  2BCC G;  3WU2 E;  1S9K D;  2D2C C;  3ITK A;  2KIK A;  4DOJ A;  4HH2 A;  2Y9Z A;  1FE6 A;  3SFE C;  1PFI A;  4GOF A;  3L74 G;  2FFD A;  2PEM A;  2WSE H;  5DJU B;  2JBG A;  2E75 B;  3H32 B;  2JYL A;  3MUD C;  1URQ A;  5B5E E;  1E6J P;  1BE3 D;  2AEF A;  2IDB A;  4PJ0 H;  2IFN A;  2VLO A;  4XRO A;  2OTJ P;  2XV5 A;  2E43 A;  2Q6Q A;  4U0B A;  4AQR D;  1SP4 A;  2HR3 A;  3GZL A;  2KWL A;  3DS5 A;  3CXH E;  1K05 A;  2WIT A;  2O3J A;  2WZ7 A;  1P84 E;  1BAJ A;  3CXC O;  1JB0 J;  1KLP A;  1J1E C;  2FFD C;  1RQV A;  3H1L D;  3KHU A;  5EW5 E;  1URQ C;  1W2B O;  2AFE A;  4OH8 B;  1H89 A;  3L75 G;  2Y0C A;  4U3F G;  4KHX A;  2JO1 A;  4BRY B;  3L71 J;  1QLE D;  1BXI A;  3WMM 0;  4JBZ A;  3RK3 B;  1PZQ A;  1FOS E;  2GDX A;  1GPJ A;  3L71 E;  4MN4 C;  4QNB A;  2RKL A;  1N73 C;  3OW2 O;  1NAF A;  5CJ0 A;  2WPS A;  4WY4 A;  3H1J J;  5AVV B;  3EFF K;  1Q7Y Q;  1EDK A;  3KDP B;  3DTJ A;  1NYH A;  1KB9 H;  4GIF A;  4IFM A;  4DG9 A;  3H1J E;  4CPG A;  5AW9 B;  2E74 B;  2AEM A;  5B66 E;  2YO2 A;  3IFM A;  4JPZ B;  4PD4 E;  4PV1 D;  3IN6 A;  5AW0 B;  1JY2 N;  1DNY A;  2H7H A;  2QM7 A;  2K92 A;  4IFD K;  1GXG A;  3CCQ P;  5AW5 B;  2WSS H;  2IBZ D;  2FYU E;  5AVS B;  1KN7 A;  1FC2 C;  3HE4 A;  2K9Y A;  4WY4 C;  3RBX A;  3FXE A;  2LIW A;  2N6Y A;  2KG9 A;  2KOR A;  2W8Z A;  1FZB A;  2YMK A;  3L72 G;  1FZC A;  1NQ4 A;  3GHG B;  3GZM A;  1PL5 A;  4H0L D;  4H44 C;  3TYY A;  2P67 A;  5EFW B;  1SQP K;  2LIU A;  4IPY A;  1S4X A;  3HD7 A;  4DJG A;  1T8Z A;  4L75 A;  2YO3 A;  5CBN A;  1JY2 O;  1U57 A;  1Q86 Q;  5GTH E;  1USD A;  3B5N B;  3M9H A;  5K5G B;  3CXH H;  4R0M A;  1P84 H;  1G1J A;  2Z5H A;  3ZDM A;  1GK6 A;  2A06 G;  1IFI A;  5F2N A;  1VF5 B;  3H1I J;  3EFG A;  4BWN A;  4EI2 A;  1VQK P;  1DV5 A;  2HLO A;  3TGU G;  1MV8 A;  3L70 G;  4UB8 E;  3D71 A;  1NU1 G;  1SQX D;  3HD7 C;  1GK4 A;  1KIL E;  2KOQ A;  3AEF C;  1PEM A;  1SQV K;  2FYZ A;  2ZT9 B;  3RK3 E;  3U1C A;  1OWA A;  3G26 A;  1RF1 B;  2IBZ I;  5CCG D;  2M8L A;  1JMM A;  3CC2 P;  3OAK A;  3BCC G;  2M8P A;  4NPE A;  4GR6 A;  3HUS B;  2WT7 A;  3RL0 C;  1E0H A;  2KR5 A;  5B66 H;  3H32 A;  1IJD B;  1T8K A;  2EHS A;  1Q82 Q;  1H8A A;  1JEK A;  1KYO D;  1FR2 A;  3G28 A;  2LPK A;  2JU1 A;  2SPZ A;  4N78 D;  2XZ1 C;  4C7N B;  2YIU B;  2QJP C;  2FAC A;  1CZQ A;  1SFC A;  3B8E B;  3BRV B;  2JEE A;  1YBK A;  3H1K E;  3CPW O;  1A43 A;  1JO5 A;  3JSV C;  4OVN F;  1OIP A;  2MF4 A;  1SQP J;  2X2B A;  1S3J A;  3WUV A;  2WWW A;  1VQP P;  4EDF A;  1IMQ A;  4YXD C;  2M8N A;  1IZN B;  1M57 D;  2A45 H;  4H2W C;  5AW4 B;  2D2C B;  4U0F A;  2W6J H;  2J5U A;  1K8A Q;  3DS0 A;  2E75 C;  2XDJ A;  1FBM A;  2ZXX A;  1SS1 A;  1L0I A;  2K5X A;  2GUS A;  2KS1 A;  1G2C A;  1Q2N A;  1AJY A;  1GL2 B;  5KLV G;  2JGP A;  4BRY A;  3VP9 A;  1QRJ A;  5GTH H;  1IO4 A;  5AW8 B;  3G0V A;  4WWI A;  2MVV A;  2N5I A;  1NTZ D;  3MIW A;  1SFC C;  3WUT A;  3MP7 B;  1LTI C;  1YYC A;  3IF4 A;  5DCK A;  2QSI A;  4I7Z C;  4BPG A;  2RMZ A;  1GW3 A;  1E79 H;  2CK3 H;  4H0L C;  1L0N K;  3V2R A;  4U0E A;  4GR2 A;  1SQV J;  3B5I A;  1NTM D;  2XU6 A;  1SQV E;  1NHL A;  1TU3 F;  2KB7 P;  5AVZ B;  4IL6 E;  2WTY A;  1M6N A;  5CCG A;  3I5C A;  1URQ B;  3D6Y A;  1SQQ K;  2AXT H;  3MGE A;  4OWF A;  4AUW A;  2E76 D;  3B4S A;  5TJH A;  3BRT B;  1CI6 A;  3Q2Y A;  2FAE A;  4IFF A;  2K88 A;  3AE6 C;  2CPS A;  3M0D A;  2IBZ G;  3FX0 A;  1OFC X;  3PHL A;  4K3A A;  1RO2 A;  4YXW H;  1PP9 D;  2E74 C;  1BGY J;  2BUO A;  2PY8 A;  3L75 D;  5BVZ A;  2FVF A;  1KQL A;  4GOD A;  1WT6 A;  4HYT B;  1FDO A;  3GMA A;  4I2L C;  1MZ9 A;  3GLM A;  1BGY E;  3CC7 P;  3CX5 D;  3E1I A;  2KOS A;  2FKW B;  1NTK J;  3NXS A;  1IK7 A;  1OVU A;  3H4E A;  1QL1 A;  2N5H A;  4W7Y A;  5F2O A;  1NTK E;  2NPS B;  2NZ2 A;  3RG2 A;  1BDC A;  1K30 A;  3T97 B;  1VL2 A;  3H1H E;  1RQU A;  2K2Q A;  3M0D C;  1HJ0 A;  3AEE C;  4WY4 B;  2YKO A;  3E2D A;  1L0N J;  4DT0 A;  1YJW P;  2LKI A;  2AF8 A;  2L91 A;  1JY3 O;  1L0N E;  2JB0 A;  2K0X A;  4BPF A;  2JP3 A;  4R4M A;  2KK7 A;  3B5N C;  4OGQ D;  1YQ4 C;  3KPE A;  1SQX G;  5HVC A;  1YIT P;  4ASW A;  1ZME C;  3V2Q A;  3G3Z A;  3L36 A;  3CCS P;  1GMJ A;  3L35 A;  4PJ0 E;  1VF5 C;  2XV6 A;  3HUS A;  1DEE G;  1JCC A;  4N3Y B;  1GZL A;  3P7K A;  1K9M Q;  1PPJ E;  1SQQ J;  1VDF A;  3L72 D;  4Y28 J;  4IL6 H;  4YTP C;  2H8P D;  2OYI B;  3FGA D;  3IAO A;  3GF7 A;  4ZMD A;  2K9J A;  1EDI A;  3CX5 I;  2ZT9 C;  1FZC B;  4Y99 B;  4DCK A;  2ZXE B;  3HD7 B;  4XRQ A;  1EIA A;  1JJ2 O;  3A7O A;  2FXM A;  2ZJS E;  2PP6 A;  3Q1M A;  1ZRT D;  1U7J A;  2L4B A;  3H1K G;  3VP8 A;  2YKP A;  3HUS C;  4BXL A;  1VQL P;  3USS A;  1NVO A;  2J58 A;  4D6T G;  2PEO A;  3P32 A;  3HE5 A;  3L70 D;  1ZXG A;  3Q20 A;  1VQ5 P;  2Q1K A;  1QVF O;  1KB9 D;  3HRN A;  2OYH A;  2V7Q J;  2RH0 A;  2GA1 A;  2YIU C;  2L5G B;  2POH A;  4ZKP A;  3WUU A;  1Z56 A;  5AW7 B;  2LXC B;  2L0Q A;  1BCC J;  1X8Y A;  1HTL C;  1CSB A;  2QJP B;  1NTZ G;  1AVY A;  4QKO A;  1BCC E;  5HGO A;  4L74 A;  1HF9 A;  2N1T D;  2WSF J;  1GU5 A;  2FXP A;  2P7J A;  2LTE A;  4ZKU A;  3L37 A;  2GZE A;  1L0L J;  4PV1 B;  3TK1 A;  1RY3 A;  2WT7 B;  1GL2 C;  4K35 A;  2VLQ A;  2PNG A;  1NTM G;  1N2D C;  1NKN A;  2JU2 A;  5L8R J;  1L0L E;  5KAI H;  3CE7 A;  2FVA A;  3D6Z A;  2HYN A;  3KXD A;  5BU8 B;  1VQM P;  3NFQ A;  1HH0 A;  2ERH A;  3A0H E;  1SFC B;  3G1I A;  1BE3 J;  3CC4 P;  1NJI Q;  5KP6 B;  4I7Z B;  3CXH D;  3F89 A;  1ACP A;  1P84 D;  1BE3 E;  4H0L B;  3PTZ A;  1EZV E;  3AE3 C;  2KGD A;  3P8C E;  4OGQ C;  5KLV D;  1AFO A;  1SQB G;  1J1D C;  1NAY A;  3TNU B;  1N7S D;  1S5L X;  1PP9 G;  2LXB A;  3F5H A;  3FWN A;  2KS1 B;  1G2C B;  4XA4 A;  2KUB A;  3LIE A;  2G3A A;  1FJK A;  4IZ6 A;  3H1L J;  7CEI A;  1JM0 A;  2NPS A;  2C0X A;  1NOH A;  1UJZ A;  2YKQ A;  3AED C;  1Y9B A;  5APS A;  2FBW C;  3L71 D;  2OAR A;  3T97 A;  2KSE A;  3BAS A;  3V2P A;  2GDY A;  1DEB A;  1M1K Q;  4RES B;  1YI2 P;  1PGP A;  2I8D A;  2KZJ A;  3H1H G;  5APX A;  3U59 A;  2PRR A;  3H1J D;  2G8Y A;  1NO4 A;  2PAJ A;  4XFZ A;  2V7Q H;  4PD4 D;  2PEN A;  3CWB J;  1ZV8 A;  2Y9Y A;  1SLQ A;  1N86 A;  2N1T A;  3SWF A;  2M5A A;  2E5T A;  3CWB E;  3K5B A;  2NPS C;  5CCH D;  1MFT A;  4IOI H;  2FYU D;  3OA7 A;  2B89 A;  4NPD A;  1MZ8 A;  3VMX A;  1USE A;  2OYI A;  1CI6 B;  2WSF H;  1M7L A;  1L0H A;  5C39 A;  1XTC C;  2XZ0 D;  5KLI B;  2NRG A;  1GD2 E;  2YMY A;  4L73 A;  1FDM A;  5AVR B;  4COP A;  2HPC A;  2KOG A;  3VTP C;  4U0D A;  1RF0 A;  3OJA B;  1A8O A;  1IK9 A;  3N4X A;  3A0H H;  3HTK A;  2RN0 A;  2IZ0 A;  1LNQ A;  2M0B A;  2N1T C;  2Q3E A;  2K3R A;  2MKV A;  3L73 G;  3EJE A;  2QEX P;  2WSC J;  2Y0D A;  1BSH A;  5AVW B;  2W27 A;  2W6A A;  1PGJ A;  1LWU A;  2AFD A;  2JQ4 A;  4M0I A;  2AXC A;  3GW6 A;  2OYI C;  1R5S A;  3O6Q A;  3S9O A;  4PWV B;  1OX3 A;  1KQS O;  2LR2 A;  2Q9I A;  2FHS C;  5KKZ B;  3CCV P;  2QJK B;  2KP8 A;  3H1I E;  1GW4 A;  1M74 A;  1FZC C;  1M1J A;  1KD1 Q;  4Y99 C;  4PD4 I;  5AW3 B;  1ZLL A;  3VMA A;  2BHV A;  1RF0 C;  3BAT A;  2CQ8 A;  1KIL D;  1NTZ K;  3RK3 D;  3RK2 D;  1L4A D;  1VQ4 P;  5CHX A;  5APT A;  3C1L A;  3Q5S A;  1LWU C;  4QMA A;  2KW2 A;  2AXT E;  2VRS A;  1S2E A;  5APW A;  1NTM K;  3MTU E;  5KJ7 D;  2KGC A;  2LML A;  1R5L A;  2LKM A;  2P9X A;  3FWL A;  4R4L A;  3LRY A;  3DS4 A;  2O01 J;  5EJD A;  1U7M A;  1JY3 P;  3AEC C;  4JYB A;  2YXQ B;  2H43 A;  2E76 B;  2GYK A;  2PGD A;  2K9J B;  1YTZ I;  5AW2 B;  3VMY A;  3V2N A;  3H1K D;  2FAD A;  2Q7C A;  3LMO A;  2R3C A;  2VLP A;  1K04 A;  1LTA C;  4D6T D;  1M56 D;  3DPH A;  2PFX A;  1HGZ A;  5DJT B;  1S5L E;  3M9Q A;  4PV1 C;  5APY A;  1JNM A;  1SQP E;  1PEQ A;  1AYI A;  1BDD A;  3A2A A;  3TNU A;  1WRG A;  3HE5 B;  4PH0 A;  3ABV C;  2PEK A;  1EC5 A;  3G71 P;  2R44 A;  1AVO A;  2GDW A;  1FU1 A;  3QH9 A;  4XFX A;  1RNI A;  2E1M A;  2OYH B;  2HFE D;  3P8M C;  4C46 A;  2GZJ A;  1DX7 A;  4EYY Q;  2QJY B;  1VPC A;  1YQ3 C;  2WSC H;  4RJT A;  2BEZ F;  3G9R A;  3M0A A;  2GUV A;  3U43 A;  1NTZ J;  3SFD C;  2BCC J;  3L71 G;  2ITA A;  2KNC A;  1KFM A;  2KG8 A;  1MFZ A;  3GF3 A;  5H2F E;  4COC A;  1CEI A;  2BCC E;  1L4A A;  1GTW A;  2XND H;  1NKZ B;  1QL2 A;  3L74 J;  2N9B A;  4WBA A;  1KYO I;  4EOT A;  4OGQ B;  2MR7 A;  4GDO A;  1J1D B;  3M1M A;  1KFN A;  3H1J G;  3MGN A;  1NTM J;  3L74 E;  2QRX A;  1N7L A;  5KJ7 A;  1X79 B;  1LT1 A;  2DW3 A;  3HZQ A;  4C7R A;  5KAF H;  3DS2 A;  1YHQ P;  2C9L Y;  1SQB D;  2FYU G;  3A3Y B;  2FQ2 A;  3AE1 C;  3TDK A;  3AEB C;  2N6Z A;  1L4A C;  5E79 E;  1KV4 A;  1T2K D;  3AEG C;  2O01 H;  2A45 G;  2OYO A;  3FXD A;  4H13 D;  5CCG C;  3V4Q A;  2KXP B;  1JY3 N;  2QIW A;  3DS1 A;  1PP9 J;  2N9Y B;  2WPQ A;  3L75 J;  4GOE A;  1VQ7 P;  4U3F J;  1FDI A;  2Z4E A;  2GM4 A;  2XZR A;  4Z1M H;  2HOD B;  3JC2 2;  2P1J A;  3TF5 A;  1PV3 A;  5CBO A;  1S5L H;  1RE3 A;  3L75 E;  1AUM A;  1NTK D;  1JTH B;  4U3F E;  2FXO A;  2JAZ A;  3H1H D;  5KLI C;  1EDJ A;  2JO0 A;  2ZAE B;  2O1K A;  1IFN A;  1NWQ A;  1NU1 K;  5AVQ B;  2JWA A;  1LTJ A;  1IC2 A;  3AE2 C;  3W68 A;  2XKM A;  2EG5 A;  5HGN A;  2JKV A;  1HGV A;  2B9B A;  3A0B H;  2K93 A;  1VQ9 P;  3M06 A;  1N8R Q;  2FQ0 A;  3H6P A;  5KAI E;  1KQG B;  5AW6 B;  2N1T B;  1DIP A;  1RE3 C;  2M5A B;  1F80 D;  2ROQ A;  2AEJ A;  2KGA A;  3MZW B;  3NTN A;  1AV1 A;  4UHP B;  1VHN A;  5H2F H;  1Y8A A;  3DS3 A;  1PPJ D;  2K0D X;  2ZYG A;  1NGM B;  2CNR A;  5KKZ C;  2E5Y A;  2QJK C;  3PH0 A;  4B86 A;  1KTM A;  3MD0 A;  1LTJ C;  5HGL A;  3CMA P;  1JMB A;  5BU5 A;  1SQQ E;  1QVG O;  1BSN A;  4U7J A;  2CG5 B;  3L72 J;  2HPC B;  3L73 D;  4XFY A;  5HGM A;  3O8Z A;  1PEO A;  1SVF A;  2K37 A;  3C9I A;  1W2E A;  1ZOY C;  3L72 E;  5TIS E;  1CW5 A;  1HY8 A;  3HTK B;  2VLN A;  4DZO A;  5APV A;  3V5B A;  1OXZ A;  3RBZ A;  1T3J A;  4I6M C;  2P58 A;  5E79 H;  1LWU B;  3VMZ A;  1N7S B;  4HKZ H;  5KLV K;  1K73 Q;  1X22 A;  2WQY C;  2JJL A;  3G29 A;  1YIJ P;  3O6Q B;  3GJN A;  2A06 E;  1HJB A;  3TGU J;  2E76 C;  2L9F A;  3L70 J;  1M1J B;  1DD3 A;  2W6B A;  1NU1 J;  3TGU E;  1AQT A;  3A5T A;  2L6E A;  3L70 E;  4M3L A;  2EFJ A;  1H0T A;  2NO8 A;  1NU1 E;  2EHT A;  3CX5 H;  2IYO A;  3MUD A;  4WYM A;  2OTL P;  5CJ4 A;  4WY4 D;  2R32 A;  2I1J A;  5AVX B;  1RH5 B;  3BCC J;  2AVA A;  1Y47 A;  2Q3I A;  1S1C X;  3G1G A;  2LL8 A;  1FJP A;  3BCC E;  4H44 D;  4W80 A;  3EQ2 A;  3C8V A;  1L0L D;  2OYH C;  3HYB A;  1SQV G;  3VN0 A;  1HWT C;  1VQN P;  5CMZ A;  1S9K E;  2QJY C;  3CI9 A;  1XTG B;  1MUU A;  2P2U A;  2KG6 A;  2FYU K;  1ZMB A;  3U1A A;  2L22 A;  2UWJ E;  1FZE A;  1EZV D;  5KP8 B;  1EXJ A;  3LW5 H;  1EQ7 A;  3P8C D;  1AQ5 A;  2KI7 B;  2JDI H;  3I56 P;  1KB9 I;  1QGK B;  4AYC A;  3PJS K;  3PP5 A;  1X3O A;  5TIS H;  3CL3 D;  1N73 A;  3HD7 D;  3CLQ A;  3CME P;  2OQQ A;  2HOD A;  5KLV J;  2WMM A;  1FAV A;  1W5C E;  1H88 A;  2H89 C;  1BGY G;  1RHZ B;  2O01 N;  2LF4 A;  1JTH A;  2KZI A;  5KLV E;  1Q81 Q;  3H1L E;  4RKU J;  2Y0E A;  3GKL C;  3SWY A;  2C9N Y;  4BPH A;  4KJM A;  1NTK G;  3EJB A;  1LTS C;  3RL0 D;  2BQ1 E;  3AE7 C;  2FVE A;  2KGE A;  2KNC B;  3G6E P;  1KIL B;  1LTG C;  5I4T G;  3RK2 B;  3IR9 A;  1JOC A;  4RO0 A;  1L4A B;  4N6J A;  1SQX K;  1HUC A;  3H47 A;  2XNX A;  2W90 A;  3CWB D;  1EMV A;  1L0N G;  2ZVN B;  2QE7 H;  3VRL C;  4O9B A;  5CZD B;  3CXH I;  3LID A;  1P84 I;  1EZV I;  1QEX A;  2M3E A;  2KOD A;  1LT9 B;  2E75 D;  3WU2 H;  2FYU J;  2C0W A;  4ZNC A;  1PPJ G;  3P05 A;  3JCU E;  4IL6 X;  1FS0 E;  1R8E A;  1PEU A;  2N50 A;  3AEA C;  3Q5R A;  1KOR A;  1GU4 A;  4F37 A;  1SQQ G;  2IBZ E;  2ZFC A;  3V6I A;  1JCD A;  5HV8 A;  3EJD A;  1M6E X;  2GZG A;  3I55 P;  1SFC D;  2FYN C;  4LLH A;  1JUN A;  2OGU A;  4HB1 A;  5B5E H;  3EWK A;  1FZG A;  2QA4 P;  3WBH A;  1N7S A;  2Z46 A;  2I1K A;  5JPA A;  3VOP A;  1FZA A;  4HKG A;  3VYI A;  1RE4 A;  1HQB A;  5KTB A;  2B88 A;  3L4F A;  3RGU A;  1OVR A;  4LGD E;  3H1I D;  1Z6M A;  3R2P A;  1AF8 A;  3CCU P;  2ONT A;  1FOS F;  4GT1 A;  4NPF X;  3SSU A;  1LTJ B;  4JF7 A;  2WPV B;  1M90 Q;  3Q5P A;  2CPB A;  2ZYA A;  1KMI Z;  2FQ1 A;  1GXH A;  1SQX J;  2VSQ A;  2B87 B;  1N7S C;  3KQG A;  2DGY A;  4H2Y C;  3CCL P;  2V4H A;  2P10 A;  2IX7 C;  1BCC G;  1SQX E;  1KQF B;  1RE4 C;  5KAF E;  2A45 I;  3QWO C;  2E74 D;  4CA3 A;  4YPC A;  4H2X C;  1VQ8 P;  4TT3 H;  5CCH A;  1M1J C;  2KOO A;  3G21 A;  3KZI E;  3SWK A;  2XXM A;  2OTK E;  2Z45 A;  2KLU A;  4L76 A;  1L0L G;  3M91 A;  3V4W A;  2YXR B;  3CD6 P;  1KZU B;  4PD4 H;  4PXH B;  4W7Z A;  2Q5U A;  1KYO E;  2QVA A;  4EIJ A;  3H1K J;  1SQB K;  3S4R A;  3JCU H;  4N78 E;  1SQP D;  3R4Y A;  2K1A A;  1LP1 B;  4H13 B;  2EIA A;  1OVV A;  4D6T J;  1BE3 G;  1EZV G;  5CCH C;  1M8O B;  2FY8 A;  4JQ0 D;  3AE5 C;  1LTB C;  4D6T E;  1VQO P;  4NEO A;  4WVZ A;  3B5N D;  2WPR A;  2KYV A;  5AVT B;  1WMK A;  2HG5 D;  1NTK K;  2R3S A;  3A0B E;  2ZVO B;  1VF5 D;  1ZNV A;  1OW7 A;  1YJN P;  1IMP A;  2M8R A;  1ZN5 A;  1H0T B;  2MVU A;  1L2P A;  2MJZ A;  2IYP A;  3MHV A;  3H1L G;  1ZP0 C;  3Q3D A;  1KIL A;  3D70 A;  2BCC D;  2PEQ A;  1NTZ E;  1SQV D;  2JR8 A;  2Z44 A;  2ZT9 D;  1ZR4 A;  2IFM A;  3L74 D;  2R5B A;  1IFP A;  4UB8 H;  2BEQ D;  1ZW0 A;  1IUQ A;  2WPT A;  2E42 A;  1NTM E;  3PRJ A;  2M3B A;  3S1K A;  3II6 A;  5GTI E;  1J1E B;  1S72 P;  3CWB G;  1OR5 A;  2FFD B;  1EOQ A;  3PLN A;  2J59 M;  3W67 A;  1LT9 A;  2GZI A;  2H88 C;  2JYG A;  4UB6 E;  1KIL C;  3RK3 C;  1A02 J;  3RK2 C;  2QM8 A;  3KZI H;  1PGO A;  2WVR A;  1DH3 A;  3UIA A;  3RL0 g;  2DNW A;  2QG4 A;  1SQB J;  1LJ2 A;  2PEI A;  1PIX A;  1BGY D;  1X0T A;  4ASV A;  4LC1 A;  1QX8 A;  1SQB E;  4XFJ A;  1N73 B;  2BAS A;  3G4S P;  5AVU B;  1J2J B;  1OMI A;  1KYO H;  3GHG A;  5KJ7 C;  1KC8 Q;  1T3U A;  1PP9 E;  4U3F D;  1IFM A;  4MRT C;  1YTZ T;  5AVY B;  2MY5 A;  2D2C D;  4U0A A;  1E5W A;  1T6A A;  2KSJ A;  2CGQ A;  1OW8 A;  1LT9 C;  4A7P A;  3CX5 E;  3CCR P;  2LOL A;  3B5N A;  5BS1 A;  1IFD A; 
#chains in the Genus database with same CATH homology
 3CPW O;  1A43 A;  2P9X A;  1D1D A;  1VQ6 P;  1VQM P;  1RO2 A;  1VQP P;  3LRY A;  3DS4 A;  3G1G A;  2M8N A;  1Q86 Q;  2BUO A;  2PY8 A;  3G1I A;  3H47 A;  1W2B O;  3CC4 P;  1NJI Q;  3DS3 A;  2PEQ A;  4XRQ A;  4U0F A;  4U0C A;  1EIA A;  3HYB A;  3HZQ A;  2DGY A;  4COP A;  1K8A Q;  1JJ2 O;  3NTE A;  3CCE P;  3CCL P;  1VQN P;  3DS0 A;  2Z44 A;  3CC7 P;  3DS2 A;  3VRL C;  4U0D A;  5HGL A;  5F2N A;  3CMA P;  1A8O A;  1YHQ P;  1QVG O;  1VQL P;  2PEJ A;  2CWO A;  1VQK P;  3H4E A;  4QNB A;  5BS2 A;  1QRJ A;  3DPH A;  1VQ8 P;  2PEO A;  3G0V A;  3OW2 O;  1ZMB A;  5F2O A;  2KOD A;  1IUQ A;  4XFY A;  5HGM A;  3G21 A;  3CCM P;  3Q20 A;  1PEO A;  2QEX P;  2XXM A;  1Q7Y Q;  1K30 A;  3H0D A;  1VQ5 P;  2Z45 A;  1PEQ A;  3P05 A;  3DTJ A;  1YJ9 P;  1QVF O;  5DCK A;  1S72 P;  1EOQ A;  1PEU A;  1RO0 A;  3DS1 A;  4PH0 A;  3CD6 P;  4M0I A;  1PEM A;  1VQ7 P;  2PEK A;  4U0E A;  2OAR A;  4GR2 A;  2JYG A;  3E2D A;  1KQS O;  3G71 P;  3CCJ P;  3G26 A;  1M6E X;  3I56 P;  1YJW P;  3I55 P;  2PEM A;  3B5I A;  4XFX A;  1RNI A;  2E1M A;  3CCV P;  1AUM A;  2M8L A;  1K73 Q;  1M1K Q;  1M74 A;  1KD1 Q;  3CC2 P;  1YI2 P;  3G29 A;  2JYL A;  1YIJ P;  3CME P;  2QA4 P;  2M8P A;  3WBH A;  2PEI A;  2BHV A;  4GR6 A;  2XT1 A;  2EIA A;  1E6J P;  5F2K A;  5HGO A;  2JO0 A;  1M6N A;  2LF4 A;  3CCQ P;  2Z46 A;  1YIT P;  5JPA A;  1Q81 Q;  4XFZ A;  3G4S P;  1Q82 Q;  3CCS P;  1VQ4 P;  2XV6 A;  4XRO A;  2OTJ P;  1VQO P;  2PEN A;  1KC8 Q;  2L6E A;  3G28 A;  4U0B A;  3RG6 C;  2EFJ A;  3CCU P;  2EG5 A;  2ONT A;  5HGN A;  1K9M Q;  3MGE A;  4COC A;  4U0A A;  3DS5 A;  2BQ1 E;  1VQ9 P;  4WYM A;  1N8R Q;  2OTL P;  1BAJ A;  1M90 Q;  3G6E P;  3CCR P;  4PH1 A;  3CXC O;  5BS1 A;  5I4T G;  1YJN P;  3M1M A;  4IPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...