1YIJP

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yijP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yijP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yijP02
3CXCO 3CCRP 1VQMP 1VQ9P 1VQLP 1Q82Q 3G6EP 1VQ7P 3CCSP 1K9MQ 1VQ8P 1M1KQ 3CC7P 3CD6P 3CPWO 1W2BO 1JJ2O 1QVGO 1K8AQ 1S72P 3CMEP 1KC8Q 2QA4P 1VQ6P 3CCVP 1YHQP 1YIJP 2OTJP 1YITP 1KD1Q 1Q81Q 3CCEP 1Q7YQ 3CMAP 1YI2P 1VQNP 1VQ5P 1NJIQ 3I55P 1VQOP 1K73Q 3CC4P 3OW2O 1M90Q 3CCJP 1YJWP 3I56P 3CCMP 1Q86Q 1VQPP 1VQ4P 1YJNP 3CCLP 3G4SP 2QEXP 1KQSO 1VQKP 1YJ9P 1QVFO 3G71P 3CCQP 3CC2P 2OTLP 1N8RQ 3CCUP
chains in the Genus database with same CATH superfamily
2K92A 1GL2B 1XTGB 2C9NY 2LL8A 2SPZA 2YMYA 2OYIA 5AVQB 5AVRB 2KLUA 4BPHA 2YKQA 4Y99B 1BSHA 3RK3B 1GPJA 4DCKA 2WSCH 1BCCD 5EJDA 3IR9A 2FYUK 1SQQE 3CX5I 2WTYA 2L22A 1FZBA 2FYZA 1KYOI 4MRTC 2KNCA 3PTZA 1LTAC 2IPPA 3B4QA 2IBZE 4XFXA 1JY3N 3H1HD 3HRNA 1JCDA 1S4XA 1L2PA 2N1TC 4IPYA 1FZFA 1IMPA 5HGOA 5DCKA 1SLQA 2KB7P 2OGUA 4H44D 3U1AA 4JYCA 3RK3D 1S1CX 2MR8A 3L70D 1PL5A 2ZYAA 2JB0A 3BRVB 2KR5A 4COPA 3TK1A 2KSEA 2PEMA 1FOSE 2WSCJ 1KN7A 5AVWB 1OWAA 4U0CA 3IFMA 1T2KD 1LT9C 1LNQA 2RKLA 4PXHB 3DPHA 1LWUC 1USEA 2N1TA 1RF1A 3P05A 2WWWA 2WSEH 3G71P 3CCUP 3T97A 1YTZT 4U7JA 2BEZF 2L0QA 4C7NA 2KIKA 2E1MA 1H89A 1L4AD 3AE8C 2Z44A 3HUSC 1BCCG 3E1IA 4IFDK 2M8PA 2KGEA 1M56D 3KYQA 1M6EX 2A06D 3HD7D 3CCMP 2WITA 2OYIC 2M0BA 1NOHA 2VLNA 1ZR2A 4XA4A 2GZFA 3EJEA 1AVYA 1GW3A 4YXWH 3WUVA 3KZIE 2KP8A 2WSFJ 2FVFA 1WRGA 2BCCG 1YI2P 3L75G 4IFMA 3I55P 2HPCB 2WMMA 4PJ0E 3DS1A 1PIXA 1GL2D 1HTLC 2IFNA 2PEOA 3VRLC 1RF0C 1G2CB 1IZNB 3NTEA 5AVTB 3CWBJ 4COCA 4DOJA 3AE5C 2QJYB 2YO3A 1MV8A 1AYIA 2H88C 1JOCA 2PAJA 1BCCJ 2FYNC 4WYMA 1QEXA 2QJPC 4OWFA 7CEIA 1IK9A 1OIPA 2ZXXA 4D6TG 3E2DA 2Z4EA 1NTZJ 1LTSC 3IF4A 2B88A 3C1LA 1MZ8A 2FVAA 2OTKE 5KTBA 1YYCA 1PPJG 2JU1A 2HYNA 4EOTA 5AW6B 1EXIA 3M91A 1LTBC 4H44B 1LWUB 1BGYD 1NTZK 3D6ZA 1T2KC 1GTWA 5CMZA 4U3FD 3Q5RA 2Q3IA 2KXPB 1S2EA 3AECC 3AEEC 3ITKA 1RE3C 1JTHB 3S4RA 1XTCC 2KSJA 1P84E 1JY3O 3GHGC 2MR7A 1SQBE 5AW9B 1SQPD 1KILB 5CCHA 2WSSH 2PP6A 1DH3A 1NKNA 1IO4A 4ASVA 1KQFB 1EZVD 3Q1MA 2CG5B 1NVOA 2QIWA 3H1IG 4MN4C 2KZIA 1OR5A 1RNIA 5KLIB 4PWVB 3RG2A 3GF3A 5E79E 1IFNA 3TDKA 1RE3A 4PD4I 2PEKA 4IL6H 2FY8A 2ZVOB 1IUQA 2ZYGA 5BS2A 2B87B 2JYLA 5APTA 5AW8B 1RF0A 1EXJA 1KYOH 2IBZI 1S5LH 4L74A 2ZXEB 1EZVG 1VQKP 4H0LD 5APVA 1IFIA 3EJBA 1GZLA 2OYOA 1OW8A 3T97B 3L73D 2FFDB 3L70G 3G3ZA 4JPZB 1VQNP 2AXTH 5DJUB 3GJNA 2NPSB 4R4MA 2M8LA 2JDIH 1ZRTE 1LTGC 3AE6C 5BU8B 1PGOA 4HKZH 1M1JC 3V2NA 5M1BA 2HR3A 3AE1C 1SQQJ 5AW3B 5JPAA 1NAYA 1N7LA 1BSNA 4WBAA 5AVUB 1Q2NA 3MUDC 3TYYA 3L75D 1KMIZ 1L0NE 2Y9ZA 1P84H 3VMAA 5C39A 2MVVA 2HG5D 2QE7H 1KB9E 3M1MA 1Z6MA 4QNBA 2EFJA 3L74E 2AVAA 2IBZG 3RBXA 1NO4A 2K88A 2WSEJ 3GHGA 1JCCA 5CCHC 2L9FA 1Q86Q 2KYVA 3M9BA 1LTJB 5KJ7D 3L70J 1VKUA 1ZLLA 1OMIA 5E79H 3HD7C 1KB9I 2VLOA 2R5BA 2R3CA 2N6ZA 5L8RJ 1CW5A 2Y0EA 3L73E 3H1LG 3SFEC 2Y0DA 1FC2C 1BXIA 4YTPC 2W8ZA 2XZRA 3CC2P 1J1DB 1YBKA 3A3YB 4I7ZC 2IYPA 3FWNA 1IJDB 4N3YB 1HVVA 1BE3G 4K3AA 4WB4A 2AEMA 3LRYA 1BGYG 2H8PD 5CCGD 1R5SA 1N2DC 3JCUH 3U59A 5KLIC 1S9KE 2EIAA 1GL2A 1BE3E 1RO2A 3HTKA 2FQ0A 4W80A 1KC8Q 1X22A 2H7HA 1QLED 1M1JA 1Y9BA 3GG2A 1UNKA 1U7JA 1S5LX 4BWNA 1VL2A 4DT0A 3AE2C 2Y0CA 3P7KA 3L74J 4BRYA 2J59M 2Q7CA 1N86A 2XU6A 2P7JA 2CK3H 1LT9B 2P9XA 1FZCC 4H13C 4H2XC 3U43A 1PV3A 4XFJA 3V2RA 1VQ5P 1JMMA 2LPKA 4CA3A 4BPFA 1YJWP 1EDJA 1MUUA 3VMZA 1L4AC 2K9JB 4PV1B 1FDOA 2B89A 2UWJE 4B86A 3NTNA 2L5GB 1FJPA 4W7ZA 2KUBA 4YPCA 1IFJA 3G21A 2CNRA 3HD7A 1S3JA 3GLMA 2Z46A 4IOIH 3A7OA 4EI2A 5CJ4A 3Q2YA 1SS1A 3G9RA 3TNUB 2AXCA 4NPDA 2K3RA 3B5ND 3CPWO 5HGLA 1JNMA 2W6JH 3L71J 1AV1A 2LF4A 2XNDH 3BCCJ 4TT3H 3D70A 2KGAA 2GM4A 2YMKA 5APXA 3RK3C 3USSA 4PV1D 2JAZA 5BS1A 4N78D 1JUNA 2E76D 1OX3A 1FOSF 3TGUG 2EHTA 3G26A 2W27A 1GL2C 3NMDA 1W5CE 3L73J 1NJIQ 4LGDE 2LIUA 1QRJA 4HYTB 1NYHA 4I7ZB 3TGUE 3TNUA 3O8ZA 4Y99C 4D6TE 1RE4A 1KILA 2IYOA 4L76A 4PD4H 1JTHA 1NTKE 1K05A 3RBZA 3B5IA 2KLVA 1NU1K 1Q90D 1FZCA 3HZQA 2QM8A 1VF5B 1EC5A 3L70E 1T3UA 2BEQD 1PP9J 2G3AA 2C0WA 3ABVC 1RE4C 3CC4P 3W68A 3CCJP 1HBWA 2O3JA 3A2AA 1M7LA 4WY4D 2P2UA 4OGQB 1G2CA 3C8VA 1UIXA 1D1DA 2IBZD 4HH2A 2KI7B 1JJ2O 2XXMA 2MJZA 2YKPA 2ZJSE 1LP1A 1A8OA 3AE4C 4RO0A 1GD2E 4R4LA 3EFGA 3M9HA 1SQXK 5CJ0A 4JYBA 4PV1C 5AVSB 1VF5C 3B5NA 3KZIH 1ZMEC 3F5HA 3OAKA 4JF7A 2K2QA 4WY4C 3M9QA 3H1KG 5CCGC 2A45H 1HQBA 3L72J 2MY5A 1IMQA 3L71G 1KV4A 2N5IA 2AEJA 3KQGA 1P84I 4WY4B 1AF8A 5KP7B 4H44C 4XRQA 4IL6E 4DJGA 3B71A 1SVFA 2E75B 5APQA 3VOPA 1LJ2A 3DS0A 1Y8AA 3SWKA 1OVVA 3WMM0 5APSA 3VN0A 1GK4A 1L0LK 5TISE 3SWFA 4PH0A 3B4SA 5B66H 1KILC 1DD3A 2X2BA 2E75C 1AA0A 3HYBA 3H32B 5TJHA 3E7KA 3B8EB 2KOOA 2FKWB 2KOSA 4UB6E 3G29A 1U7MA 1KILD 2LKMA 2RN0A 4WVZA 1PGPA 1SFCB 3F89A 1Q7YQ 4F37A 1SQXG 3C9IA 1N73B 3WU2E 1K04A 3HD7B 1SQBJ 3S9OA 1AUMA 2PEIA 2J58A 4WWIA 4RKUJ 2MD9A 2QJYC 1J2JB 2RMZA 2A45I 5KP6B 1URQC 1HF9A 2ZT9B 3VP9A 1MZ9A 1S72P 2D2CC 3MZWB 1M74A 1ZNVA 1ACPA 1OVRA 2E42A 1K73Q 4OGQC 2GYKA 1URQB 1EDKA 1NTMJ 2GZJA 2M3BA 3BVHA 4U3FG 2V7QJ 3CE7A 3RK3E 1K9MQ 1FDIA 5AW2B 4OH8B 5KLVD 4OGQD 1NTZE 3PP5A 3CCEP 1DV5A 3N7NA 1LT1A 1N73A 1PEMA 4RESB 2BCCJ 4UB6H 2J5UA 2L91A 2K37A 1VQ8P 2ZYDA 3CC7P 2OYHC 2K0XA 4BRYB 3TF5A 1USDA 4H0LB 3H1ID 1ZW0A 2CPSA 3AEDC 3TGUD 1SFCA 3H1HG 3WUUA 1AFOA 1SQPJ 3WUTA 1X0TA 2AXTE 1VQLP 2N9BA 4BXLA 2QG4A 3CX5D 2L4BA 2HFED 1UJZA 3NXSA 4L75A 1DNYA 2GZEA 3RL0B 3GZMA 2CGQA 2GA1A 5AW1B 2PRRA 3VMYA 3WU2H 1L0IA 1HUCA 4PD4D 1L0LG 1EOQA 1CSBA 1KFMA 3DS3A 1SFCC 1LWUA 1EMVA 1OZHA 4H0LC 1HGZA 3S1KA 1JY2O 1GU4A 3CCVP 1J1EC 1JY2P 5KKZC 2PGDA 4GDOA 2ZVNB 2N50A 3L72G 5AVVB 3TSIA 2OQQA 3RK2C 2LTEA 2KOGA 1ZV8A 3CCLP 1F80D 5KAIE 1KQSO 3BRTB 5KAIH 2Q3EA 4ZMDA 1JM0A 1L0LD 3P8CE 1L0LE 1SQBD 3LMOA 1EQ7A 1N7SD 1KQLA 1YQ4C 1P84D 3B5NB 2D2CD 2Z5HA 3DTJA 2I1JA 1HJ0A 2Q9IA 1BGYJ 2MF4A 3RL0g 2GDYA 1SQVG 2FHSC 5KJ7A 2AFDA 5CBNA 1K30A 4ZNCA 3H1JJ 3H1IJ 4PD4E 2FQ2A 3SFDC 2E5TA 2BCCD 1PP9E 5EFWB 2VRSA 2Q6QA 3FWLA 3RK2D 3V4WA 3FGAD 1ZOYC 4QKOA 2K0DX 1SQXD 2YO2A 2CWOA 3H4EA 2DW3A 4LC1A 5B5EE 2FFDA 3HE5B 1LTIC 1R5LA 4U0AA 3U1CA 4LLHA 2K93A 1OW6A 1E0HA 1BE3D 2AEFA 5K5GB 1QL1A 4QMAA 4NPEA 1NU1G 1M90Q 1M8OB 4GT1A 1BDDA 3K5BA 5APYA 3LIDA 3CX5H 1YJ9P 1H8AA 2OTLP 2FYUG 3IN6A 3LW5J 2I8DA 2WPTA 1SQVJ 1N7SB 1K8AQ 3L72E 1YQ3C 2JR8A 3GMAA 3PJSK 2FFDC 2L6EA 1U57A 2JP3A 1URQD 1NU1E 3MTUE 4GIFA 2R3SA 3R2PA 2XV6A 1L0NK 2QM7A 4JBZA 1NGMB 5KAFH 2E74C 3NFQA 4H13B 1SQVE 2RH0A 5KP8B 1IK7A 1JY2N 3EWKA 2VLPA 1T8ZA 4IL6X 2BCCE 5CHXA 1SQPG 2AF8A 1FAVA 1LT9A 3H1HJ 2E5YA 2FXOA 3AEFC 1RF1C 5HGMA 1FZAA 2BASA 1SQBK 2Z45A 5KLVJ 2JYGA 4CPGA 3IAOA 1KTMA 2GUVA 3FX0A 3A0HE 3L73G 3MP7B 3PRJA 3HUSA 3SSUA 5F2KA 2GZGA 2QEXP 1SQQK 4AQRD 2K0YA 4JQ0D 1CZQA 1R8EA 4GODA 1L0NJ 2XZ0D 2LOLA 2QRXA 3EFFK 3H32A 2WT7A 1NTKD 3W67A 1GMJA 5H2FE 2QJPB 2H89C 2XV5A 2LXCB 5CBOA 1JO5A 1SQPK 2WPRA 1DIPA 1FU1A 3V5BA 3O6QA 4IZ6A 1KQGB 1ZMBA 3LW5H 4H2YC 3CD6P 3N4XA 1GXHA 2M5AB 1GDTA 1G1JA 4GKGA 2GZIA 2O01N 2P58A 3OW2O 4O9BA 2CQ8A 2NPSD 2KOPA 5TISH 1DD4A 4OVNF 2V7QH 2ITAA 1BCCE 2N5HA 2D2CB 2ZT9D 3M0DA 1G1IA 4KJMA 1YHQP 1ZR4A 3BCCG 2POHA 1JY3P 1FBMA 3G1IA 1PEOA 1NQ4A 3MD0A 2LXBA 4W7YA 3VP8A 2P1JA 4EIJA 2PY8A 1GXGA 1CI6A 1IFMA 2JO0A 3G1GA 1ZP0C 5I4TG 1GK6A 3H1LJ 3D71A 1PFIA 5B66E 5HV8A 1KB9D 3FXEA 4NEOA 2XZ1C 3M0DC 3GHGB 1HGVA 1X3OA 1NU1J 2IFMA 1NTZG 1TU3F 2G8YA 1EZVI 1AQTA 4KHXA 2WPQA 2A45G 2FXPA 3KHUA 3DS5A 2C0XA 1NHLA 1FE6A 2XDJA 3H1LE 3M06A 2NPSC 4U0BA 3H1KE 1VQ4P 2Q5UA 3CWBE 2FYNB 1EIAA 2E43A 3BCCD 4ZKPA 4U0EA 3CXHI 1DEBA 4GR6A 4A7PA 2ERHA 2QJKC 2Y9YA 1M57D 4GOEA 3MHVA 5AVXB 4N78E 4K35A 3G28A 3L71D 1IC2A 3LIEA 2KNCB 3H1JG 1FJKA 3RL0D 2JKVA 2NPSA 2FYUD 3CXHH 2I1KA 2YXRB 3CXHE 2PEJA 4ZKUA 2XKMA 1E5WA 2O01H 2KW2A 3L71E 1S9KD 3H25A 1M6NA 1ZXGA 4UB8E 4N6JA 5F2OA 3V2PA 3I5CA 2FAEA 2JGPA 1YTZI 1MKMA 1E6JP 2FYUE 4HB1A 3QWOC 2OTJP 2R32A 2HLOA 4C46A 1PP9G 4H13D 3SWYA 3WBHA 1SQPE 1SQVK 2A06E 3PLNA 1GU5A 1AQ5A 3E1RA 2ROQA 1VPCA 1YJNP 1JB0J 2ZFCA 2M8RA 3H1KD 3H6PA 1LP1B 3H1LD 2NZ2A 3MUDA 1PEUA 4IFFA 5F2NA 2MKVA 2QA4P 1NTMG 3O6QB 2P10A 1PPJE 3CMAP 1RO0A 3V4QA 4I1LA 2IZ0A 4M3LA 2NO8A 1UIIA 2M3EA 1PZQA 1ZN5A 5AW5B 1A43A 3UIAA 2JU2A 3P8CD 2LIWA 2V4HA 1T8KA 4DZOA 1OFCX 2KWLA 2JO1A 1T6AA 2KG6A 2FADA 1BDCA 1NU1D 2JJLA 3HTKB 1L0ND 1NKZB 3KDPB 1MFZA 4KT0J 1EDLA 3CCSP 2JQ4A 1RQUA 1A02F 3BATA 2FXMA 4U0DA 1FZCB 3A0BH 2PFXA 5DJTB 1H0TB 1HH0A 2W6BA 2N9YB 1QVFO 3JC22 4YXDC 1L0NG 3CL3D 1NTKJ 3G0VA 1IFDA 2IX7C 3CX5E 2YIUB 1VQ6P 2NRGA 3AEGC 2BQ1E 1A02J 2KK7A 2ZAEB 3GF7A 3HE4A 1L4AB 1WT6A 4M0IA 3KXDA 1X9VA 1NTMD 4XFYA 2WQYC 3V6IA 2OARA 2XT1A 2QVAA 5B5EH 2Z5IA 2JBGA 5HGNA 4BPGA 2E74B 1M1KQ 2R5DA 2HPCA 2WZ7A 1CEIA 4XE5B 1RF1B 5H2FH 2KS1B 3KPEA 2YNYA 5KAFE 4XFZA 1VQPP 3A0BE 1L0HA 1VQ9P 1OW7A 2W90A 2IZ1A 2M5RA 2JWAA 2YIUC 2PEQA 4U3FJ 3Q5SA 1QVGO 2QSIA 3B5NC 1DX7A 1X8YA 1KD1Q 2K94A 1KFNA 1PGJA 1BGYE 1SQBG 2E74D 1NTMK 3MIWA 3OJAB 2C9LY 1LTTC 4C7NB 5AW4B 4AUWA 1FZEA 1DEEG 3EQ2A 3CCRP 2E75D 3V2QA 3ZDMA 1KYOD 2W83C 2AFEA 1CI6B 1X79B 1YITP 5AW0B 1GW4A 3CI9A 3P8MC 3L74D 5APWA 2IDBA 3Q20A 2EHSA 3H1HE 1FS0E 1N8RQ 3FXDA 3OA7A 1IFPA 2KGDA 1QGKB 1QL2A 1RH5B 3AEBC 2W6AA 2B87A 3H1JD 3CWBG 3EJDA 3A0HH 1SP4A 4PJ0H 1FZGA 5CZDB 1JEKA 1RQVA 1H88A 1ZRTD 2M5AA 1NTKG 3H1IE 4ASWA 3Q5PA 1JMBA 4D6TJ 5CCHD 1L4AA 1N7SC 3Q3DA 3A5TA 2FYUJ 4WY4A 2KODA 5GTHE 1FR2A 5GTHH 1H0TA 1J1DC 3CLQA 3I56P 2GDXA 5BVZA 2YXQB 1D7MA 1VQMP 1NH4A 3VMXA 2M8NA 1OVUA 3GKLC 2K5XA 1W2BO 1AJYA 5APUA 2KG8A 5KLVE 3VTPC 2O01J 1LTJA 1KZUB 2OYIB 3HUSB 1Z56A 4Z1MH 2B9BA 5AW7B 4HJGH 2JEEA 3BCCE 1E79H 2MVUA 4DG9A 3CCQP 3L75J 3VYIA 1KLPA 1EZVE 4PH1A 1KYOE 1PEQA 2KGCA 1NAFA 3AE3C 3R4YA 2KOQA 2QJKB 2QNWA 1VHNA 4L73A 4GOFA 1SFCD 2WT7B 3RK2B 1HJBA 2PNGA 2E76B 3TGUJ 1VDFA 3DS2A 3L75E 4U3FE 1AVOA 4EDFA 3H0DA 2N1TD 1LGHB 1VF5D 1URQA 5CCGA 4AYCA 2E76C 1HWTC 3NY7B 1L0LJ 4R0MA 4RJTA 2O1JA 5HVCA 1Q82Q 1HY8A 1T3JA 2N6YA 2O1KA 3L35A 2LMLA 2LKIA 1SQVD 1RY3A 2HODB 3MGEA 1PPJD 1VQOP 3L4FA 1NTME 4HKGA 1S5LE 2FBWC 3H1KJ 3D6YA 1N7SA 2K9YA 2WPVB 4C7RA 1N73C 4UHPB 3GZLA 2FVEA 5KKZB 2DGYA 2N98A 2A06G 1PGQA 3L72D 4UB8H 1SQQD 2R44A 1MFTA 1SQXJ 1KORA 3AE7C 1BAJA 4GR2A 2KS1A 3AEAC 2OYHA 2FACA 2HODA 3G4SP 3HE5A 1QX8A 3RGUA 1LTJC 3MGNA 4TLFA 1VQ7P 2KG9A 3PHLA 5KJ7C 2H43A 2KORA 2OYHB 1WMKA 2DNWA 2N1TB 5GTIH 1NWQA 3QH9A 5KLVG 3HE4B 3H1JE 4H2WC 1SQXE 4NPFX 3PH0A 1KB9H 3G6EP 2GDWA 2JWDA 3M0AA 1NTZD 2K9JA 2VSQA 5EW5E 1YIJP 1PP9D 1Y47A 3RL0C 4Y28J 3L37A 2YKOA 1OXZA 3CXCO 3AE9C 2EG5A 3L36A 1BE3J 2BUOA 3DS4A 2Q1KA 2LR2A 3CWBD 2BHVA 1RHZB 3CMEP 1EDIA 1KILE 3L74G 5AVYB 3BASA 5AVZB 4I2LC 4D6TD 2WSFH 2PENA 4XROA 5GTIE 2VLQA 4U0FA 1SQQG 3P32A 3H47A 3RG6C 1J1EB 2CPBA 1NTKK 3GW6A 4I6MC 2GUSA 2WPSA 2ONTA 2FQ1A 3II6A 1M1JB 2K1AA 1Q81Q 2ZT9C 2KZJA 2XNXA 2WVRA 3JCUE 5KLVK 1W2EA 4EYYQ 2P67A 3JSVC 1FDMA 5BU5A 3CXHD
chains in the Genus database with same CATH topology
3G28A 3CCRP 1VQ7P 3CCSP 4PH1A 2E1MA 1K9MQ 1PEQA 2Z44A 5JPAA 3G26A 1KC8Q 4U0DA 3DTJA 1YHQP 1YITP 3CCEP 2M8PA 2PEJA 1NJIQ 1PEMA 3G1IA 1PEOA 1M6EX 1QRJA 3CCMP 3Q20A 4XRQA 1M6NA 1QVFO 1N8RQ 3M1MA 1K30A 2PY8A 5F2OA 3G6EP 4QNBA 2EFJA 3DS0A 3G0VA 1VQ8P 3CC7P 2JO0A 3G1GA 5HGMA 2P9XA 1E6JP 5I4TG 3DS2A 1VQ6P 2OTJP 2BQ1E 1YIJP 2Z45A 3H0DA 2JYGA 1YI2P 4PH0A 1VQ5P 3B5IA 3I55P 3WBHA 4M0IA 3DS1A 4XFXA 1YJWP 1Q86Q 3HZQA 4XFYA 5F2KA 1YJNP 3HYBA 2CWOA 2QEXP 2OARA 2XT1A 3CCUP 3H4EA 3CXCO 2EG5A 1VQLP 1RNIA 1Q82Q 2PEOA 3VRLC 2BUOA 3DS4A 5HGNA 1PEUA 1M1KQ 4IPYA 4U0AA 2BHVA 5HGOA 5DCKA 5F2NA 3CMEP 2PEKA 3G29A 2QA4P 1IUQA 3DS5A 3NTEA 1Q7YQ 3MGEA 3CMAP 4COCA 5BS2A 1RO0A 2JYLA 3G21A 2KODA 1VQOP 3CC4P 1M90Q 2PENA 3CCJP 2Z46A 3I56P 4XFZA 1VQPP 4U0BA 1VQ4P 1AUMA 1EOQA 2PEIA 4WYMA 4XROA 1VQKP 1YJ9P 4U0FA 4COPA 3CC2P 2OTLP 3H47A 2PEMA 3RG6C 3DS3A 1VQMP 1VQ9P 1ZMBA 2M8NA 1D1DA 1EIAA 2PEQA 3CD6P 3CPWO 1W2BO 1JJ2O 1QVGO 2XXMA 5HGLA 2DGYA 1K8AQ 1S72P 2ONTA 1A43A 4U0CA 3E2DA 4U0EA 3LRYA 3CCVP 1A8OA 1KD1Q 1Q81Q 4GR6A 2LF4A 1M74A 1VQNP 3DPHA 1K73Q 2L6EA 3OW2O 1BAJA 4GR2A 2M8LA 3CCLP 3G4SP 2EIAA 3P05A 1KQSO 3G71P 3CCQP 2XV6A 5BS1A 1RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXC O;  3CCR P;  1VQM P;  1VQ9 P;  1VQL P;  1Q82 Q;  3G6E P;  1VQ7 P;  3CCS P;  1K9M Q;  1VQ8 P;  1M1K Q;  3CC7 P;  3CD6 P;  3CPW O;  1W2B O;  1JJ2 O;  1QVG O;  1K8A Q;  1S72 P;  3CME P;  1KC8 Q;  2QA4 P;  1VQ6 P;  3CCV P;  1YHQ P;  1YIJ P;  2OTJ P;  1YIT P;  1KD1 Q;  1Q81 Q;  3CCE P;  1Q7Y Q;  3CMA P;  1YI2 P;  1VQN P;  1VQ5 P;  1NJI Q;  3I55 P;  1VQO P;  1K73 Q;  3CC4 P;  3OW2 O;  1M90 Q;  3CCJ P;  1YJW P;  3I56 P;  3CCM P;  1Q86 Q;  1VQP P;  1VQ4 P;  1YJN P;  3CCL P;  3G4S P;  2QEX P;  1KQS O;  1VQK P;  1YJ9 P;  1QVF O;  3G71 P;  3CCQ P;  3CC2 P;  2OTL P;  1N8R Q;  3CCU P; 
#chains in the Genus database with same CATH topology
 2K92 A;  1GL2 B;  1XTG B;  2C9N Y;  2LL8 A;  2SPZ A;  2YMY A;  2OYI A;  5AVQ B;  5AVR B;  2KLU A;  4BPH A;  2YKQ A;  4Y99 B;  1BSH A;  3RK3 B;  1GPJ A;  4DCK A;  2WSC H;  1BCC D;  5EJD A;  3IR9 A;  2FYU K;  1SQQ E;  3CX5 I;  2WTY A;  2L22 A;  1FZB A;  2FYZ A;  1KYO I;  4MRT C;  2KNC A;  3PTZ A;  1LTA C;  2IPP A;  3B4Q A;  2IBZ E;  4XFX A;  1JY3 N;  3H1H D;  3HRN A;  1JCD A;  1S4X A;  1L2P A;  2N1T C;  4IPY A;  1FZF A;  1IMP A;  5HGO A;  5DCK A;  1SLQ A;  2KB7 P;  2OGU A;  4H44 D;  3U1A A;  4JYC A;  3RK3 D;  1S1C X;  2MR8 A;  3L70 D;  1PL5 A;  2ZYA A;  2JB0 A;  3BRV B;  2KR5 A;  4COP A;  3TK1 A;  2KSE A;  2PEM A;  1FOS E;  2WSC J;  1KN7 A;  5AVW B;  1OWA A;  4U0C A;  3IFM A;  1T2K D;  1LT9 C;  1LNQ A;  2RKL A;  4PXH B;  3DPH A;  1LWU C;  1USE A;  2N1T A;  1RF1 A;  3P05 A;  2WWW A;  2WSE H;  3G71 P;  3CCU P;  3T97 A;  1YTZ T;  4U7J A;  2BEZ F;  2L0Q A;  4C7N A;  2KIK A;  2E1M A;  1H89 A;  1L4A D;  3AE8 C;  2Z44 A;  3HUS C;  1BCC G;  3E1I A;  4IFD K;  2M8P A;  2KGE A;  1M56 D;  3KYQ A;  1M6E X;  2A06 D;  3HD7 D;  3CCM P;  2WIT A;  2OYI C;  2M0B A;  1NOH A;  2VLN A;  1ZR2 A;  4XA4 A;  2GZF A;  3EJE A;  1AVY A;  1GW3 A;  4YXW H;  3WUV A;  3KZI E;  2KP8 A;  2WSF J;  2FVF A;  1WRG A;  2BCC G;  1YI2 P;  3L75 G;  4IFM A;  3I55 P;  2HPC B;  2WMM A;  4PJ0 E;  3DS1 A;  1PIX A;  1GL2 D;  1HTL C;  2IFN A;  2PEO A;  3VRL C;  1RF0 C;  1G2C B;  1IZN B;  3NTE A;  5AVT B;  3CWB J;  4COC A;  4DOJ A;  3AE5 C;  2QJY B;  2YO3 A;  1MV8 A;  1AYI A;  2H88 C;  1JOC A;  2PAJ A;  1BCC J;  2FYN C;  4WYM A;  1QEX A;  2QJP C;  4OWF A;  7CEI A;  1IK9 A;  1OIP A;  2ZXX A;  4D6T G;  3E2D A;  2Z4E A;  1NTZ J;  1LTS C;  3IF4 A;  2B88 A;  3C1L A;  1MZ8 A;  2FVA A;  2OTK E;  5KTB A;  1YYC A;  1PPJ G;  2JU1 A;  2HYN A;  4EOT A;  5AW6 B;  1EXI A;  3M91 A;  1LTB C;  4H44 B;  1LWU B;  1BGY D;  1NTZ K;  3D6Z A;  1T2K C;  1GTW A;  5CMZ A;  4U3F D;  3Q5R A;  2Q3I A;  2KXP B;  1S2E A;  3AEC C;  3AEE C;  3ITK A;  1RE3 C;  1JTH B;  3S4R A;  1XTC C;  2KSJ A;  1P84 E;  1JY3 O;  3GHG C;  2MR7 A;  1SQB E;  5AW9 B;  1SQP D;  1KIL B;  5CCH A;  2WSS H;  2PP6 A;  1DH3 A;  1NKN A;  1IO4 A;  4ASV A;  1KQF B;  1EZV D;  3Q1M A;  2CG5 B;  1NVO A;  2QIW A;  3H1I G;  4MN4 C;  2KZI A;  1OR5 A;  1RNI A;  5KLI B;  4PWV B;  3RG2 A;  3GF3 A;  5E79 E;  1IFN A;  3TDK A;  1RE3 A;  4PD4 I;  2PEK A;  4IL6 H;  2FY8 A;  2ZVO B;  1IUQ A;  2ZYG A;  5BS2 A;  2B87 B;  2JYL A;  5APT A;  5AW8 B;  1RF0 A;  1EXJ A;  1KYO H;  2IBZ I;  1S5L H;  4L74 A;  2ZXE B;  1EZV G;  1VQK P;  4H0L D;  5APV A;  1IFI A;  3EJB A;  1GZL A;  2OYO A;  1OW8 A;  3T97 B;  3L73 D;  2FFD B;  3L70 G;  3G3Z A;  4JPZ B;  1VQN P;  2AXT H;  5DJU B;  3GJN A;  2NPS B;  4R4M A;  2M8L A;  2JDI H;  1ZRT E;  1LTG C;  3AE6 C;  5BU8 B;  1PGO A;  4HKZ H;  1M1J C;  3V2N A;  5M1B A;  2HR3 A;  3AE1 C;  1SQQ J;  5AW3 B;  5JPA A;  1NAY A;  1N7L A;  1BSN A;  4WBA A;  5AVU B;  1Q2N A;  3MUD C;  3TYY A;  3L75 D;  1KMI Z;  1L0N E;  2Y9Z A;  1P84 H;  3VMA A;  5C39 A;  2MVV A;  2HG5 D;  2QE7 H;  1KB9 E;  3M1M A;  1Z6M A;  4QNB A;  2EFJ A;  3L74 E;  2AVA A;  2IBZ G;  3RBX A;  1NO4 A;  2K88 A;  2WSE J;  3GHG A;  1JCC A;  5CCH C;  2L9F A;  1Q86 Q;  2KYV A;  3M9B A;  1LTJ B;  5KJ7 D;  3L70 J;  1VKU A;  1ZLL A;  1OMI A;  5E79 H;  3HD7 C;  1KB9 I;  2VLO A;  2R5B A;  2R3C A;  2N6Z A;  5L8R J;  1CW5 A;  2Y0E A;  3L73 E;  3H1L G;  3SFE C;  2Y0D A;  1FC2 C;  1BXI A;  4YTP C;  2W8Z A;  2XZR A;  3CC2 P;  1J1D B;  1YBK A;  3A3Y B;  4I7Z C;  2IYP A;  3FWN A;  1IJD B;  4N3Y B;  1HVV A;  1BE3 G;  4K3A A;  4WB4 A;  2AEM A;  3LRY A;  1BGY G;  2H8P D;  5CCG D;  1R5S A;  1N2D C;  3JCU H;  3U59 A;  5KLI C;  1S9K E;  2EIA A;  1GL2 A;  1BE3 E;  1RO2 A;  3HTK A;  2FQ0 A;  4W80 A;  1KC8 Q;  1X22 A;  2H7H A;  1QLE D;  1M1J A;  1Y9B A;  3GG2 A;  1UNK A;  1U7J A;  1S5L X;  4BWN A;  1VL2 A;  4DT0 A;  3AE2 C;  2Y0C A;  3P7K A;  3L74 J;  4BRY A;  2J59 M;  2Q7C A;  1N86 A;  2XU6 A;  2P7J A;  2CK3 H;  1LT9 B;  2P9X A;  1FZC C;  4H13 C;  4H2X C;  3U43 A;  1PV3 A;  4XFJ A;  3V2R A;  1VQ5 P;  1JMM A;  2LPK A;  4CA3 A;  4BPF A;  1YJW P;  1EDJ A;  1MUU A;  3VMZ A;  1L4A C;  2K9J B;  4PV1 B;  1FDO A;  2B89 A;  2UWJ E;  4B86 A;  3NTN A;  2L5G B;  1FJP A;  4W7Z A;  2KUB A;  4YPC A;  1IFJ A;  3G21 A;  2CNR A;  3HD7 A;  1S3J A;  3GLM A;  2Z46 A;  4IOI H;  3A7O A;  4EI2 A;  5CJ4 A;  3Q2Y A;  1SS1 A;  3G9R A;  3TNU B;  2AXC A;  4NPD A;  2K3R A;  3B5N D;  3CPW O;  5HGL A;  1JNM A;  2W6J H;  3L71 J;  1AV1 A;  2LF4 A;  2XND H;  3BCC J;  4TT3 H;  3D70 A;  2KGA A;  2GM4 A;  2YMK A;  5APX A;  3RK3 C;  3USS A;  4PV1 D;  2JAZ A;  5BS1 A;  4N78 D;  1JUN A;  2E76 D;  1OX3 A;  1FOS F;  3TGU G;  2EHT A;  3G26 A;  2W27 A;  1GL2 C;  3NMD A;  1W5C E;  3L73 J;  1NJI Q;  4LGD E;  2LIU A;  1QRJ A;  4HYT B;  1NYH A;  4I7Z B;  3TGU E;  3TNU A;  3O8Z A;  4Y99 C;  4D6T E;  1RE4 A;  1KIL A;  2IYO A;  4L76 A;  4PD4 H;  1JTH A;  1NTK E;  1K05 A;  3RBZ A;  3B5I A;  2KLV A;  1NU1 K;  1Q90 D;  1FZC A;  3HZQ A;  2QM8 A;  1VF5 B;  1EC5 A;  3L70 E;  1T3U A;  2BEQ D;  1PP9 J;  2G3A A;  2C0W A;  3ABV C;  1RE4 C;  3CC4 P;  3W68 A;  3CCJ P;  1HBW A;  2O3J A;  3A2A A;  1M7L A;  4WY4 D;  2P2U A;  4OGQ B;  1G2C A;  3C8V A;  1UIX A;  1D1D A;  2IBZ D;  4HH2 A;  2KI7 B;  1JJ2 O;  2XXM A;  2MJZ A;  2YKP A;  2ZJS E;  1LP1 A;  1A8O A;  3AE4 C;  4RO0 A;  1GD2 E;  4R4L A;  3EFG A;  3M9H A;  1SQX K;  5CJ0 A;  4JYB A;  4PV1 C;  5AVS B;  1VF5 C;  3B5N A;  3KZI H;  1ZME C;  3F5H A;  3OAK A;  4JF7 A;  2K2Q A;  4WY4 C;  3M9Q A;  3H1K G;  5CCG C;  2A45 H;  1HQB A;  3L72 J;  2MY5 A;  1IMQ A;  3L71 G;  1KV4 A;  2N5I A;  2AEJ A;  3KQG A;  1P84 I;  4WY4 B;  1AF8 A;  5KP7 B;  4H44 C;  4XRQ A;  4IL6 E;  4DJG A;  3B71 A;  1SVF A;  2E75 B;  5APQ A;  3VOP A;  1LJ2 A;  3DS0 A;  1Y8A A;  3SWK A;  1OVV A;  3WMM 0;  5APS A;  3VN0 A;  1GK4 A;  1L0L K;  5TIS E;  3SWF A;  4PH0 A;  3B4S A;  5B66 H;  1KIL C;  1DD3 A;  2X2B A;  2E75 C;  1AA0 A;  3HYB A;  3H32 B;  5TJH A;  3E7K A;  3B8E B;  2KOO A;  2FKW B;  2KOS A;  4UB6 E;  3G29 A;  1U7M A;  1KIL D;  2LKM A;  2RN0 A;  4WVZ A;  1PGP A;  1SFC B;  3F89 A;  1Q7Y Q;  4F37 A;  1SQX G;  3C9I A;  1N73 B;  3WU2 E;  1K04 A;  3HD7 B;  1SQB J;  3S9O A;  1AUM A;  2PEI A;  2J58 A;  4WWI A;  4RKU J;  2MD9 A;  2QJY C;  1J2J B;  2RMZ A;  2A45 I;  5KP6 B;  1URQ C;  1HF9 A;  2ZT9 B;  3VP9 A;  1MZ9 A;  1S72 P;  2D2C C;  3MZW B;  1M74 A;  1ZNV A;  1ACP A;  1OVR A;  2E42 A;  1K73 Q;  4OGQ C;  2GYK A;  1URQ B;  1EDK A;  1NTM J;  2GZJ A;  2M3B A;  3BVH A;  4U3F G;  2V7Q J;  3CE7 A;  3RK3 E;  1K9M Q;  1FDI A;  5AW2 B;  4OH8 B;  5KLV D;  4OGQ D;  1NTZ E;  3PP5 A;  3CCE P;  1DV5 A;  3N7N A;  1LT1 A;  1N73 A;  1PEM A;  4RES B;  2BCC J;  4UB6 H;  2J5U A;  2L91 A;  2K37 A;  1VQ8 P;  2ZYD A;  3CC7 P;  2OYH C;  2K0X A;  4BRY B;  3TF5 A;  1USD A;  4H0L B;  3H1I D;  1ZW0 A;  2CPS A;  3AED C;  3TGU D;  1SFC A;  3H1H G;  3WUU A;  1AFO A;  1SQP J;  3WUT A;  1X0T A;  2AXT E;  1VQL P;  2N9B A;  4BXL A;  2QG4 A;  3CX5 D;  2L4B A;  2HFE D;  1UJZ A;  3NXS A;  4L75 A;  1DNY A;  2GZE A;  3RL0 B;  3GZM A;  2CGQ A;  2GA1 A;  5AW1 B;  2PRR A;  3VMY A;  3WU2 H;  1L0I A;  1HUC A;  4PD4 D;  1L0L G;  1EOQ A;  1CSB A;  1KFM A;  3DS3 A;  1SFC C;  1LWU A;  1EMV A;  1OZH A;  4H0L C;  1HGZ A;  3S1K A;  1JY2 O;  1GU4 A;  3CCV P;  1J1E C;  1JY2 P;  5KKZ C;  2PGD A;  4GDO A;  2ZVN B;  2N50 A;  3L72 G;  5AVV B;  3TSI A;  2OQQ A;  3RK2 C;  2LTE A;  2KOG A;  1ZV8 A;  3CCL P;  1F80 D;  5KAI E;  1KQS O;  3BRT B;  5KAI H;  2Q3E A;  4ZMD A;  1JM0 A;  1L0L D;  3P8C E;  1L0L E;  1SQB D;  3LMO A;  1EQ7 A;  1N7S D;  1KQL A;  1YQ4 C;  1P84 D;  3B5N B;  2D2C D;  2Z5H A;  3DTJ A;  2I1J A;  1HJ0 A;  2Q9I A;  1BGY J;  2MF4 A;  3RL0 g;  2GDY A;  1SQV G;  2FHS C;  5KJ7 A;  2AFD A;  5CBN A;  1K30 A;  4ZNC A;  3H1J J;  3H1I J;  4PD4 E;  2FQ2 A;  3SFD C;  2E5T A;  2BCC D;  1PP9 E;  5EFW B;  2VRS A;  2Q6Q A;  3FWL A;  3RK2 D;  3V4W A;  3FGA D;  1ZOY C;  4QKO A;  2K0D X;  1SQX D;  2YO2 A;  2CWO A;  3H4E A;  2DW3 A;  4LC1 A;  5B5E E;  2FFD A;  3HE5 B;  1LTI C;  1R5L A;  4U0A A;  3U1C A;  4LLH A;  2K93 A;  1OW6 A;  1E0H A;  1BE3 D;  2AEF A;  5K5G B;  1QL1 A;  4QMA A;  4NPE A;  1NU1 G;  1M90 Q;  1M8O B;  4GT1 A;  1BDD A;  3K5B A;  5APY A;  3LID A;  3CX5 H;  1YJ9 P;  1H8A A;  2OTL P;  2FYU G;  3IN6 A;  3LW5 J;  2I8D A;  2WPT A;  1SQV J;  1N7S B;  1K8A Q;  3L72 E;  1YQ3 C;  2JR8 A;  3GMA A;  3PJS K;  2FFD C;  2L6E A;  1U57 A;  2JP3 A;  1URQ D;  1NU1 E;  3MTU E;  4GIF A;  2R3S A;  3R2P A;  2XV6 A;  1L0N K;  2QM7 A;  4JBZ A;  1NGM B;  5KAF H;  2E74 C;  3NFQ A;  4H13 B;  1SQV E;  2RH0 A;  5KP8 B;  1IK7 A;  1JY2 N;  3EWK A;  2VLP A;  1T8Z A;  4IL6 X;  2BCC E;  5CHX A;  1SQP G;  2AF8 A;  1FAV A;  1LT9 A;  3H1H J;  2E5Y A;  2FXO A;  3AEF C;  1RF1 C;  5HGM A;  1FZA A;  2BAS A;  1SQB K;  2Z45 A;  5KLV J;  2JYG A;  4CPG A;  3IAO A;  1KTM A;  2GUV A;  3FX0 A;  3A0H E;  3L73 G;  3MP7 B;  3PRJ A;  3HUS A;  3SSU A;  5F2K A;  2GZG A;  2QEX P;  1SQQ K;  4AQR D;  2K0Y A;  4JQ0 D;  1CZQ A;  1R8E A;  4GOD A;  1L0N J;  2XZ0 D;  2LOL A;  2QRX A;  3EFF K;  3H32 A;  2WT7 A;  1NTK D;  3W67 A;  1GMJ A;  5H2F E;  2QJP B;  2H89 C;  2XV5 A;  2LXC B;  5CBO A;  1JO5 A;  1SQP K;  2WPR A;  1DIP A;  1FU1 A;  3V5B A;  3O6Q A;  4IZ6 A;  1KQG B;  1ZMB A;  3LW5 H;  4H2Y C;  3CD6 P;  3N4X A;  1GXH A;  2M5A B;  1GDT A;  1G1J A;  4GKG A;  2GZI A;  2O01 N;  2P58 A;  3OW2 O;  4O9B A;  2CQ8 A;  2NPS D;  2KOP A;  5TIS H;  1DD4 A;  4OVN F;  2V7Q H;  2ITA A;  1BCC E;  2N5H A;  2D2C B;  2ZT9 D;  3M0D A;  1G1I A;  4KJM A;  1YHQ P;  1ZR4 A;  3BCC G;  2POH A;  1JY3 P;  1FBM A;  3G1I A;  1PEO A;  1NQ4 A;  3MD0 A;  2LXB A;  4W7Y A;  3VP8 A;  2P1J A;  4EIJ A;  2PY8 A;  1GXG A;  1CI6 A;  1IFM A;  2JO0 A;  3G1G A;  1ZP0 C;  5I4T G;  1GK6 A;  3H1L J;  3D71 A;  1PFI A;  5B66 E;  5HV8 A;  1KB9 D;  3FXE A;  4NEO A;  2XZ1 C;  3M0D C;  3GHG B;  1HGV A;  1X3O A;  1NU1 J;  2IFM A;  1NTZ G;  1TU3 F;  2G8Y A;  1EZV I;  1AQT A;  4KHX A;  2WPQ A;  2A45 G;  2FXP A;  3KHU A;  3DS5 A;  2C0X A;  1NHL A;  1FE6 A;  2XDJ A;  3H1L E;  3M06 A;  2NPS C;  4U0B A;  3H1K E;  1VQ4 P;  2Q5U A;  3CWB E;  2FYN B;  1EIA A;  2E43 A;  3BCC D;  4ZKP A;  4U0E A;  3CXH I;  1DEB A;  4GR6 A;  4A7P A;  2ERH A;  2QJK C;  2Y9Y A;  1M57 D;  4GOE A;  3MHV A;  5AVX B;  4N78 E;  4K35 A;  3G28 A;  3L71 D;  1IC2 A;  3LIE A;  2KNC B;  3H1J G;  1FJK A;  3RL0 D;  2JKV A;  2NPS A;  2FYU D;  3CXH H;  2I1K A;  2YXR B;  3CXH E;  2PEJ A;  4ZKU A;  2XKM A;  1E5W A;  2O01 H;  2KW2 A;  3L71 E;  1S9K D;  3H25 A;  1M6N A;  1ZXG A;  4UB8 E;  4N6J A;  5F2O A;  3V2P A;  3I5C A;  2FAE A;  2JGP A;  1YTZ I;  1MKM A;  1E6J P;  2FYU E;  4HB1 A;  3QWO C;  2OTJ P;  2R32 A;  2HLO A;  4C46 A;  1PP9 G;  4H13 D;  3SWY A;  3WBH A;  1SQP E;  1SQV K;  2A06 E;  3PLN A;  1GU5 A;  1AQ5 A;  3E1R A;  2ROQ A;  1VPC A;  1YJN P;  1JB0 J;  2ZFC A;  2M8R A;  3H1K D;  3H6P A;  1LP1 B;  3H1L D;  2NZ2 A;  3MUD A;  1PEU A;  4IFF A;  5F2N A;  2MKV A;  2QA4 P;  1NTM G;  3O6Q B;  2P10 A;  1PPJ E;  3CMA P;  1RO0 A;  3V4Q A;  4I1L A;  2IZ0 A;  4M3L A;  2NO8 A;  1UII A;  2M3E A;  1PZQ A;  1ZN5 A;  5AW5 B;  1A43 A;  3UIA A;  2JU2 A;  3P8C D;  2LIW A;  2V4H A;  1T8K A;  4DZO A;  1OFC X;  2KWL A;  2JO1 A;  1T6A A;  2KG6 A;  2FAD A;  1BDC A;  1NU1 D;  2JJL A;  3HTK B;  1L0N D;  1NKZ B;  3KDP B;  1MFZ A;  4KT0 J;  1EDL A;  3CCS P;  2JQ4 A;  1RQU A;  1A02 F;  3BAT A;  2FXM A;  4U0D A;  1FZC B;  3A0B H;  2PFX A;  5DJT B;  1H0T B;  1HH0 A;  2W6B A;  2N9Y B;  1QVF O;  3JC2 2;  4YXD C;  1L0N G;  3CL3 D;  1NTK J;  3G0V A;  1IFD A;  2IX7 C;  3CX5 E;  2YIU B;  1VQ6 P;  2NRG A;  3AEG C;  2BQ1 E;  1A02 J;  2KK7 A;  2ZAE B;  3GF7 A;  3HE4 A;  1L4A B;  1WT6 A;  4M0I A;  3KXD A;  1X9V A;  1NTM D;  4XFY A;  2WQY C;  3V6I A;  2OAR A;  2XT1 A;  2QVA A;  5B5E H;  2Z5I A;  2JBG A;  5HGN A;  4BPG A;  2E74 B;  1M1K Q;  2R5D A;  2HPC A;  2WZ7 A;  1CEI A;  4XE5 B;  1RF1 B;  5H2F H;  2KS1 B;  3KPE A;  2YNY A;  5KAF E;  4XFZ A;  1VQP P;  3A0B E;  1L0H A;  1VQ9 P;  1OW7 A;  2W90 A;  2IZ1 A;  2M5R A;  2JWA A;  2YIU C;  2PEQ A;  4U3F J;  3Q5S A;  1QVG O;  2QSI A;  3B5N C;  1DX7 A;  1X8Y A;  1KD1 Q;  2K94 A;  1KFN A;  1PGJ A;  1BGY E;  1SQB G;  2E74 D;  1NTM K;  3MIW A;  3OJA B;  2C9L Y;  1LTT C;  4C7N B;  5AW4 B;  4AUW A;  1FZE A;  1DEE G;  3EQ2 A;  3CCR P;  2E75 D;  3V2Q A;  3ZDM A;  1KYO D;  2W83 C;  2AFE A;  1CI6 B;  1X79 B;  1YIT P;  5AW0 B;  1GW4 A;  3CI9 A;  3P8M C;  3L74 D;  5APW A;  2IDB A;  3Q20 A;  2EHS A;  3H1H E;  1FS0 E;  1N8R Q;  3FXD A;  3OA7 A;  1IFP A;  2KGD A;  1QGK B;  1QL2 A;  1RH5 B;  3AEB C;  2W6A A;  2B87 A;  3H1J D;  3CWB G;  3EJD A;  3A0H H;  1SP4 A;  4PJ0 H;  1FZG A;  5CZD B;  1JEK A;  1RQV A;  1H88 A;  1ZRT D;  2M5A A;  1NTK G;  3H1I E;  4ASW A;  3Q5P A;  1JMB A;  4D6T J;  5CCH D;  1L4A A;  1N7S C;  3Q3D A;  3A5T A;  2FYU J;  4WY4 A;  2KOD A;  5GTH E;  1FR2 A;  5GTH H;  1H0T A;  1J1D C;  3CLQ A;  3I56 P;  2GDX A;  5BVZ A;  2YXQ B;  1D7M A;  1VQM P;  1NH4 A;  3VMX A;  2M8N A;  1OVU A;  3GKL C;  2K5X A;  1W2B O;  1AJY A;  5APU A;  2KG8 A;  5KLV E;  3VTP C;  2O01 J;  1LTJ A;  1KZU B;  2OYI B;  3HUS B;  1Z56 A;  4Z1M H;  2B9B A;  5AW7 B;  4HJG H;  2JEE A;  3BCC E;  1E79 H;  2MVU A;  4DG9 A;  3CCQ P;  3L75 J;  3VYI A;  1KLP A;  1EZV E;  4PH1 A;  1KYO E;  1PEQ A;  2KGC A;  1NAF A;  3AE3 C;  3R4Y A;  2KOQ A;  2QJK B;  2QNW A;  1VHN A;  4L73 A;  4GOF A;  1SFC D;  2WT7 B;  3RK2 B;  1HJB A;  2PNG A;  2E76 B;  3TGU J;  1VDF A;  3DS2 A;  3L75 E;  4U3F E;  1AVO A;  4EDF A;  3H0D A;  2N1T D;  1LGH B;  1VF5 D;  1URQ A;  5CCG A;  4AYC A;  2E76 C;  1HWT C;  3NY7 B;  1L0L J;  4R0M A;  4RJT A;  2O1J A;  5HVC A;  1Q82 Q;  1HY8 A;  1T3J A;  2N6Y A;  2O1K A;  3L35 A;  2LML A;  2LKI A;  1SQV D;  1RY3 A;  2HOD B;  3MGE A;  1PPJ D;  1VQO P;  3L4F A;  1NTM E;  4HKG A;  1S5L E;  2FBW C;  3H1K J;  3D6Y A;  1N7S A;  2K9Y A;  2WPV B;  4C7R A;  1N73 C;  4UHP B;  3GZL A;  2FVE A;  5KKZ B;  2DGY A;  2N98 A;  2A06 G;  1PGQ A;  3L72 D;  4UB8 H;  1SQQ D;  2R44 A;  1MFT A;  1SQX J;  1KOR A;  3AE7 C;  1BAJ A;  4GR2 A;  2KS1 A;  3AEA C;  2OYH A;  2FAC A;  2HOD A;  3G4S P;  3HE5 A;  1QX8 A;  3RGU A;  1LTJ C;  3MGN A;  4TLF A;  1VQ7 P;  2KG9 A;  3PHL A;  5KJ7 C;  2H43 A;  2KOR A;  2OYH B;  1WMK A;  2DNW A;  2N1T B;  5GTI H;  1NWQ A;  3QH9 A;  5KLV G;  3HE4 B;  3H1J E;  4H2W C;  1SQX E;  4NPF X;  3PH0 A;  1KB9 H;  3G6E P;  2GDW A;  2JWD A;  3M0A A;  1NTZ D;  2K9J A;  2VSQ A;  5EW5 E;  1YIJ P;  1PP9 D;  1Y47 A;  3RL0 C;  4Y28 J;  3L37 A;  2YKO A;  1OXZ A;  3CXC O;  3AE9 C;  2EG5 A;  3L36 A;  1BE3 J;  2BUO A;  3DS4 A;  2Q1K A;  2LR2 A;  3CWB D;  2BHV A;  1RHZ B;  3CME P;  1EDI A;  1KIL E;  3L74 G;  5AVY B;  3BAS A;  5AVZ B;  4I2L C;  4D6T D;  2WSF H;  2PEN A;  4XRO A;  5GTI E;  2VLQ A;  4U0F A;  1SQQ G;  3P32 A;  3H47 A;  3RG6 C;  1J1E B;  2CPB A;  1NTK K;  3GW6 A;  4I6M C;  2GUS A;  2WPS A;  2ONT A;  2FQ1 A;  3II6 A;  1M1J B;  2K1A A;  1Q81 Q;  2ZT9 C;  2KZJ A;  2XNX A;  2WVR A;  3JCU E;  5KLV K;  1W2E A;  4EYY Q;  2P67 A;  3JSV C;  1FDM A;  5BU5 A;  3CXH D; 
#chains in the Genus database with same CATH homology
 3G28 A;  3CCR P;  1VQ7 P;  3CCS P;  4PH1 A;  2E1M A;  1K9M Q;  1PEQ A;  2Z44 A;  5JPA A;  3G26 A;  1KC8 Q;  4U0D A;  3DTJ A;  1YHQ P;  1YIT P;  3CCE P;  2M8P A;  2PEJ A;  1NJI Q;  1PEM A;  3G1I A;  1PEO A;  1M6E X;  1QRJ A;  3CCM P;  3Q20 A;  4XRQ A;  1M6N A;  1QVF O;  1N8R Q;  3M1M A;  1K30 A;  2PY8 A;  5F2O A;  3G6E P;  4QNB A;  2EFJ A;  3DS0 A;  3G0V A;  1VQ8 P;  3CC7 P;  2JO0 A;  3G1G A;  5HGM A;  2P9X A;  1E6J P;  5I4T G;  3DS2 A;  1VQ6 P;  2OTJ P;  2BQ1 E;  1YIJ P;  2Z45 A;  3H0D A;  2JYG A;  1YI2 P;  4PH0 A;  1VQ5 P;  3B5I A;  3I55 P;  3WBH A;  4M0I A;  3DS1 A;  4XFX A;  1YJW P;  1Q86 Q;  3HZQ A;  4XFY A;  5F2K A;  1YJN P;  3HYB A;  2CWO A;  2QEX P;  2OAR A;  2XT1 A;  3CCU P;  3H4E A;  3CXC O;  2EG5 A;  1VQL P;  1RNI A;  1Q82 Q;  2PEO A;  3VRL C;  2BUO A;  3DS4 A;  5HGN A;  1PEU A;  1M1K Q;  4IPY A;  4U0A A;  2BHV A;  5HGO A;  5DCK A;  5F2N A;  3CME P;  2PEK A;  3G29 A;  2QA4 P;  1IUQ A;  3DS5 A;  3NTE A;  1Q7Y Q;  3MGE A;  3CMA P;  4COC A;  5BS2 A;  1RO0 A;  2JYL A;  3G21 A;  2KOD A;  1VQO P;  3CC4 P;  1M90 Q;  2PEN A;  3CCJ P;  2Z46 A;  3I56 P;  4XFZ A;  1VQP P;  4U0B A;  1VQ4 P;  1AUM A;  1EOQ A;  2PEI A;  4WYM A;  4XRO A;  1VQK P;  1YJ9 P;  4U0F A;  4COP A;  3CC2 P;  2OTL P;  3H47 A;  2PEM A;  3RG6 C;  3DS3 A;  1VQM P;  1VQ9 P;  1ZMB A;  2M8N A;  1D1D A;  1EIA A;  2PEQ A;  3CD6 P;  3CPW O;  1W2B O;  1JJ2 O;  1QVG O;  2XXM A;  5HGL A;  2DGY A;  1K8A Q;  1S72 P;  2ONT A;  1A43 A;  4U0C A;  3E2D A;  4U0E A;  3LRY A;  3CCV P;  1A8O A;  1KD1 Q;  1Q81 Q;  4GR6 A;  2LF4 A;  1M74 A;  1VQN P;  3DPH A;  1K73 Q;  2L6E A;  3OW2 O;  1BAJ A;  4GR2 A;  2M8L A;  3CCL P;  3G4S P;  2EIA A;  3P05 A;  1KQS O;  3G71 P;  3CCQ P;  2XV6 A;  5BS1 A;  1RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...