1YIJP

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yijP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yijP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yijP02
1Q82Q 2QEXP 3CC2P 1KQSO 3CC4P 3OW2O 1VQ5P 1K73Q 1S72P 3CCVP 3I56P 3G6EP 1VQ8P 1N8RQ 1VQLP 3CCRP 1Q81Q 1K9MQ 1KC8Q 3CXCO 1VQPP 1QVFO 1VQMP 1YJ9P 1NJIQ 3CD6P 3CC7P 2QA4P 1YITP 1W2BO 3G4SP 1VQOP 1QVGO 3CCUP 3CCJP 3CCEP 3CPWO 1VQ9P 2OTLP 3I55P 1K8AQ 1VQKP 1VQ6P 1M90Q 2OTJP 1YHQP 1Q7YQ 1JJ2O 1YJNP 1YIJP 3CCMP 1VQ4P 3CMEP 3CCSP 1VQNP 1Q86Q 3CCLP 1M1KQ 3G71P 1YJWP 3CMAP 1VQ7P 1KD1Q 3CCQP 1YI2P
chains in the Genus database with same CATH superfamily
1ZMBA 3F5HA 4PJ0H 4U7JA 1JY3P 2OTKE 4C46A 3NXSA 3HRNA 1OVRA 3RK3E 2Z5IA 3HE5B 1GZLA 3CX5D 2BASA 3C8VA 5AW8B 1H88A 1OMIA 2N50A 3BVHA 3CMEP 1VQNP 3JCUE 3R4YA 1ZMEC 3RL0g 4XFXA 2E75C 3BRVB 2FKWB 1K04A 4L74A 3T97B 2K0DX 4H2XC 2FY8A 4ZMDA 5BU8B 3CE7A 2PEIA 3A0HH 3H32A 4GT1A 1FE6A 2K2QA 4AQRD 4WY4A 3LW5H 1URQC 2H89C 2GDXA 2QJYC 1HJ0A 1EMVA 2LPKA 5HGNA 3RK2C 1WRGA 3SFEC 1RQUA 2KLUA 3CCUP 2E76B 1GW4A 1K8AQ 1SFCB 2FYUG 1LWUA 2PP6A 2FFDA 3L70E 3RK3C 1VF5C 1MKMA 3L70J 4IZ6A 2Q3EA 1EXJA 3FXEA 2P7JA 2WPSA 3ITKA 2JAZA 3GW6A 1JJ2O 1X0TA 1U7JA 2P1JA 3AE9C 4H2WC 1Q82Q 1ZRTD 5HV8A 1L4AC 3L74D 1IFPA 1GL2D 2IZ1A 3M9QA 3NFQA 2VLNA 3MGNA 3HE4A 2XZ0D 1OXZA 2FYNB 1PEUA 1JY3N 1L0LE 1EIAA 4XROA 4I6MC 1L0LJ 1G2CB 2CNRA 4U0DA 2EIAA 3L73G 1YBKA 1NTMD 3VMAA 5KKZB 2IPPA 2IZ0A 2P67A 4WY4D 1LTAC 2BEZF 1SQPG 2MJZA 1K05A 1VHNA 2WITA 2XV6A 4I7ZC 4EOTA 2N98A 4U0CA 3KZIE 1PGQA 3AE2C 2NO8A 3SFDC 1LTJA 1K9MQ 1T3JA 4H44B 1LNQA 1QVGO 2B87B 2KB7P 4NPDA 2P9XA 2QJPB 1USEA 2WSEJ 1LGHB 2NPSB 3LIEA 1KILC 1NU1E 1FJKA 4UB8H 2L9FA 3HE5A 1AVOA 1NU1J 1HY8A 2IFMA 4ASWA 1JY2P 2Y9YA 1GU5A 3K5BA 2AEMA 3A5TA 5KLIC 5AW6B 4BXLA 3H6PA 1EDJA 5CCGD 2M3BA 4OWFA 2AXTE 2K37A 2P58A 3AE7C 3VTPC 1KB9D 3U59A 3H0DA 2PEQA 2XXMA 1P84H 1NQ4A 4RKUJ 2W6BA 3CXHI 3VMXA 2CWOA 1X79B 3CC7P 2L6EA 3A0BH 2NRGA 3L74E 1L0LK 1SQBE 1PEOA 2YO2A 2QG4A 1BXIA 1OWAA 3RBXA 3L74J 4F37A 2BCCD 1SQBJ 1FZCB 3QH9A 4PH0A 2HODB 1K30A 2XNDH 1BAJA 2IBZI 1H0TB 3MIWA 1SS1A 5HGMA 1AA0A 4PH1A 1BGYE 1SQVE 1M1KQ 4GODA 4IFFA 3IFMA 5TISH 1PP9E 1QLED 1SQVJ 1BGYJ 5APTA 5AVXB 1WT6A 3IR9A 3G9RA 4M3LA 3LRYA 1PP9J 2R5DA 1N73B 3NY7B 2DNWA 2KGCA 1NOHA 4NPEA 1KQFB 4PWVB 1PZQA 4BPGA 2YKQA 2ZVOB 2G8YA 4HKZH 3DS4A 5H2FE 2YIUC 1L0HA 2W6AA 5AW4B 2FAEA 1G2CA 1JY2N 2IBZD 3H1KE 4HYTB 2BHVA 1JTHB 4GOEA 3JC22 3H1KJ 1OW6A 4PV1D 2LL8A 3B5NB 2JU1A 4GR2A 2JU2A 4NPFX 3KHUA 1GK6A 1YTZI 1N7SD 3CCEP 1FJPA 4WY4C 5AVRB 5KLVD 1RF0A 1MV8A 1SQBK 1SVFA 2K88A 3VRLC 5HGOA 2RH0A 3RG2A 2H43A 5KJ7D 2OYIA 2M0BA 3G6EP 2XKMA 5CZDB 2B87A 1BSNA 3G0VA 2GZEA 3D6ZA 4W7ZA 1Q90D 3TYYA 2O01J 1JB0J 2FFDC 4ZKUA 2FXOA 1SQVK 1DD4A 2Q1KA 5CCHD 3TGUD 2WPRA 1J1EC 1NTMK 5KAFH 2LXBA 2YNYA 5AW0B 2QM7A 5GTHH 2KK7A 5APWA 4UB6E 1L0NG 2QA4P 5AVVB 4U0EA 4U0BA 3PH0A 2OARA 4IFMA 1NH4A 2GUVA 3L75G 3P7KA 5CCGC 5BU5A 3CXHE 1FC2C 1HGZA 2UWJE 2B88A 2LOLA 1EZVD 4R4MA 3A3YB 1Z6MA 1AVYA 2N6YA 4BPHA 1IO4A 3L72D 1A02J 3EFGA 5KAIE 1URQD 3WUVA 1FZCA 2J59M 3H1LE 1DV5A 2FVEA 4RO0A 5HVCA 2LIWA 1FR2A 3H1LJ 4JYBA 1H0TA 2IBZE 4KT0J 4L76A 2KW2A 4U3FD 4H0LB 2JKVA 1JCCA 3JCUH 3RK3D 2ERHA 3CCLP 2L5GB 4OVNF 2N1TB 1SQXE 1J1DB 2MR7A 1UNKA 1VF5D 2XU6A 1BE3E 3KQGA 1SQXJ 4COCA 1N73A 2O3JA 5KLVE 5AVQB 3HD7B 1BE3J 4EIJA 1QGKB 5BS1A 2KOGA 2WSSH 5KLVJ 4WB4A 1E5WA 2Z46A 5M1BA 2FXPA 5E79H 1DX7A 3M0AA 1S9KE 3AECC 2YXQB 3Q5RA 2LIUA 1VQPP 4B86A 2EHTA 2M8NA 3TGUE 1NJIQ 1VQ9P 3EJBA 1E79H 3TGUJ 2ZYGA 3CCMP 3B5NA 1KD1Q 1YTZT 1IUQA 1PGOA 1PGJA 4H13B 3L70D 2AXCA 2A45I 2V7QH 5AW7B 2KNCB 3MTUE 3E1RA 1F80D 4U0AA 1YQ3C 2JEEA 2W27A 1VQ6P 1N7SC 3M1MA 1W2EA 2R3SA 2D2CB 1K73Q 2NZ2A 2E43A 1M8OB 2K1AA 3WU2E 1X3OA 5BS2A 5KJ7C 2R5BA 1PFIA 2AVAA 2PY8A 2MR8A 3L74G 3G29A 3CI9A 1XTGB 1T8ZA 2WSCJ 5CBNA 3CX5H 1CI6A 5CCHC 1L0LD 2IFNA 4U3FE 1A43A 2QJKC 2BUOA 5KLVK 1KV4A 4U3FJ 3M9HA 3Q5PA 5I4TG 3GHGC 3S1KA 3VYIA 2JQ4A 4K35A 1E0HA 2E74D 1BSHA 1NTMG 2H88C 3PJSK 1JEKA 2AFEA 5DJUB 3KZIH 1RE4A 4IL6E 2K5XA 5APQA 1SQQD 2JJLA 2WSFJ 2WSEH 5C39A 4GOFA 4RESB 2MD9A 2CGQA 3EFFK 4N78E 1USDA 5KKZC 5F2KA 1M57D 4R4LA 3DS0A 2KWLA 2KLVA 5CJ4A 1W5CE 3SWYA 1NU1D 3S9OA 1HTLC 4LGDE 2GDWA 4JF7A 2K3RA 2N1TA 3CPWO 2AXTH 1RF0C 1RO0A 2KSJA 3C9IA 4OGQB 3BCCE 2ZXXA 3Q20A 2BQ1E 3H1JD 2C9LY 3D70A 2OYIC 1CSBA 3ABVC 3HD7A 1JMMA 3BCCJ 1IK9A 2C0WA 3M06A 2H7HA 2I1JA 2QJPC 2WZ7A 2RKLA 2FQ1A 1M56D 1VQMP 1ZR2A 2ZYDA 3GG2A 1QL2A 5GTIH 5KP7B 1QRJA 1IFDA 3ZDMA 1RHZB 2N9BA 1DEEG 1U7MA 1JMBA 4Y99B 4JQ0D 4C7NB 1OX3A 1SQBD 5EFWB 2OYHB 3PP5A 1X8YA 2BCCG 2E5YA 2I8DA 2JO1A 1AQTA 1KORA 5AVWB 1MUUA 3IN6A 4QNBA 3FWNA 1LTSC 2ZAEB 4A7PA 1KQSO 1HQBA 2KNCA 2RN0A 2N9YB 1SQVD 1BGYD 3W68A 1PV3A 1KYOI 4COPA 1RNIA 3WUUA 1PP9D 1OFCX 2E75B 5EW5E 2OTLP 1FZCC 1NHLA 1SQQE 4ZNCA 2N5IA 3MUDA 1HVVA 3M91A 3L37A 2GA1A 3MP7B 4C7RA 1SQQJ 3V2QA 2N1TD 3NTNA 3GF7A 2CG5B 3VOPA 3W67A 3AEGC 2OGUA 2QJYB 2W8ZA 2HR3A 3RK2B 2HFED 4D6TD 3TF5A 4XFJA 3L71D 1J2JB 1N73C 3H1KD 2ITAA 3H1HE 2KOQA 2IBZG 1P84I 2EHSA 1KB9H 1NYHA 1OZHA 2O1KA 1KYOD 3H1JE 3H1HJ 1LT9B 2XV5A 3B4QA 4CPGA 3A0HE 2KXPB 5APYA 3DS3A 1NTKE 2FQ0A 1VQ4P 3H1JJ 2Z5HA 2VRSA 4DOJA 3HZQA 1YI2P 3RG6C 1NTKJ 3H47A 2E74C 3T97A 3VN0A 3LW5J 1ZN5A 5KLVG 4Z1MH 3MGEA 3BATA 4PD4I 1L4AB 3CCJP 3V2NA 3B5NC 2EFJA 3G21A 1YHQP 3AEFC 1M1JB 3MZWB 1WMKA 2KOPA 4L75A 2R44A 3AE3C 1OW7A 1Y8AA 3SSUA 2WPQA 2JWAA 1SFCA 3TGUG 5B5EH 4JBZA 1RQVA 2KSEA 3AE4C 3Q1MA 3B5IA 5L8RJ 2HPCB 1SQQK 3V4WA 3CMAP 3R2PA 2M8PA 1QEXA 4DJGA 4YXDC 4U0FA 4I7ZB 1T6AA 3VMZA 3CXHD 5B66E 4PD4D 1IZNB 1EZVG 5KP8B 2Y9ZA 2Z45A 4UHPB 3E1IA 2KGEA 3L36A 4C7NA 1NU1K 2LTEA 2OYHA 1FZBA 3L72G 1AYIA 5AVSB 3OJAB 4K3AA 1KILB 3O6QB 3H1LD 4WBAA 2FACA 2FYZA 4D6TE 3L71E 1PPJD 5DCKA 1SP4A 2WMMA 4XA4A 2KGDA 4D6TJ 1L0IA 5AW1B 5KLIB 3L71J 1ZOYC 2OYOA 3P05A 2JDIH 1LTIC 4KHXA 1KYOE 1RH5B 1T8KA 4U3FG 1T3UA 1DEBA 2PGDA 5CJ0A 1SQXD 1GK4A 4YTPC 2RMZA 5AW3B 2KG6A 1BE3D 1NO4A 2FYUE 3IF4A 1RF1B 4WVZA 2MY5A 5DJTB 1D7MA 2E76D 2FYUJ 1FDOA 1SFCD 2KOOA 4HB1A 3GKLC 1H89A 2ONTA 2YMKA 2WT7B 2N1TC 1J1DC 2NPSA 1S9KD 1LWUC 1S5LE 2H8PD 4O9BA 1GTWA 2LXCB 2Q3IA 4HH2A 4XFZA 2JYLA 1ZW0A 3Q3DA 1BDCA 3H4EA 2VLPA 1GXHA 1P84E 4IL6X 2QIWA 2R32A 1LT9A 3G1IA 2YXRB 1AF8A 2FHSC 3GF3A 2Z4EA 2GM4A 2GYKA 2Y0EA 1NTZD 2PAJA 3U43A 4LLHA 2KUBA 2A06E 1AQ5A 1R8EA 3L70G 1ACPA 4N6JA 3KXDA 5CMZA 4PD4E 1L4AA 3HUSB 3HYBA 3L73E 3CCRP 2LKIA 1M1JA 2LR2A 2XT1A 4GR6A 2WVRA 3L73J 4DT0A 3E2DA 4HKGA 1BCCD 3VP9A 4H13C 1GL2B 1GDTA 4LC1A 1OW8A 4GIFA 2L0QA 2HODA 5TISE 2FVAA 4BPFA 3MD0A 2QRXA 1E6JP 1PPJE 3CCVP 1KQLA 1NVOA 1OIPA 1X9VA 3P8CE 2KYVA 4EYYQ 2HPCA 2D2CC 1R5SA 1L0LG 3I55P 1DIPA 3RL0B 2FYUK 2R3CA 4ASVA 3MUDC 4H44D 1KN7A 1FAVA 3QWOC 2WSFH 3CCQP 1GMJA 4WY4B 2NPSD 2JGPA 1LTJC 4IL6H 2IX7C 3CWBD 3DS1A 4IPYA 1R5LA 2W90A 4XFYA 1NAYA 4BRYB 3N4XA 2DGYA 2KS1B 2LKMA 2ROQA 3KPEA 3D71A 1HUCA 4KJMA 2PFXA 5EJDA 1SQQG 1KILA 2K0YA 3O6QA 3KYQA 1IJDB 1JM0A 1M6NA 4N78D 1T2KD 3N7NA 1FOSE 1JTHA 1VQOP 2DW3A 2AFDA 2KP8A 3CLQA 1NU1G 1A02F 1AFOA 2WQYC 2KG9A 1CW5A 1NTZE 3BCCD 1RF1A 3H1JG 1NTZJ 2K9JB 2Y0CA 3EQ2A 2QM8A 2ZT9B 5K5GB 2KGAA 4Y28J 5KP6B 2PENA 3B71A 2QEXP 2ZFCA 1ZR4A 5KAFE 2E76C 3TNUB 1SFCC 4OGQC 1A8OA 3CX5I 5GTHE 3A7OA 1BCCE 3CD6P 2Y0DA 3FXDA 1BCCJ 3V2PA 3LIDA 2K93A 5AW9B 1YJNP 1SQBG 1HGVA 2C0XA 1AJYA 5AVTB 5APSA 1HWTC 1SQXK 3LMOA 2KZIA 2HLOA 1Y47A 5AW5B 3TK1A 2MVUA 1QVFO 2IYPA 2Q5UA 3VP8A 5CHXA 1LTGC 4Y99C 2O1JA 2K92A 1SQVG 1BGYG 1Q86Q 3CWBE 3HUSA 1EXIA 4ZKPA 1PP9G 4GKGA 2FYNC 1PEMA 2QE7H 3CWBJ 1PEQA 2CPSA 1VQ8P 1N7LA 4JYCA 3V5BA 2C9NY 3B5ND 4I2LC 1GL2A 2PEOA 4IOIH 1G1IA 1GXGA 2Q9IA 3AEAC 3V2RA 2Q6QA 2P2UA 5F2NA 3E7KA 2YKPA 1S72P 3I56P 1Q81Q 2GZGA 1NTZK 4D6TG 3AE8C 3L71G 2BEQD 3RGUA 1Y9BA 1S4XA 3H1HD 3H1KG 4PV1B 4DZOA 2POHA 5E79E 4H44C 5AVZB 2KR5A 2FADA 3CC2P 1ZP0C 2Z44A 3SWKA 1N7SB 4M0IA 1NTKD 4BRYA 2M5RA 2MVVA 2X2BA 2KS1A 2NPSC 1IFMA 1L0NE 3DS2A 2E42A 2VLQA 2WPVB 3NTEA 1KLPA 3C1LA 3GJNA 3AE1C 1L0NJ 3L75E 2B9BA 3B4SA 2PEKA 1KFNA 1LT9C 3L75J 1Z56A 3U1CA 2J58A 2FBWC 2KORA 4CA3A 2L4BA 3AEEC 1DD3A 2GUSA 1AUMA 3TDKA 2JB0A 5APXA 3GZLA 1T2KC 2QJKB 4JPZB 2V7QJ 2GZJA 5CCGA 1VQ7P 5AVYB 3GHGB 3AE5C 3H1ID 2I1KA 3G28A 1KILE 1M1JC 2Q7CA 4YPCA 2K9JA 1S5LX 3WBHA 2VLOA 1Q2NA 5B66H 3HTKB 2W83C 2A06G 1HH0A 3TNUA 3G71P 1YJWP 3RL0D 3CX5E 2ZVNB 2JWDA 2M5AB 4H0LD 2KODA 3P8MC 4PJ0E 3H25A 2K0XA 1NKNA 2PEJA 2CQ8A 1URQB 3I5CA 5H2FH 1FZEA 1FBMA 1KB9I 2O01N 1EQ7A 2WWWA 2XNXA 3HD7D 1KQGB 3H1LG 3M0DA 1JY3O 1KYOH 1PPJG 2YKOA 1CZQA 2K9YA 2QSIA 3AEBC 2OYIB 2HYNA 3RK3B 1L0NK 1YITP 1LJ2A 1RE3A 1HBWA 3M9BA 5AW2B 3GZMA 1VF5B 2OTJP 1ZNVA 2WTYA 1SQXG 3USSA 2KIKA 5BVZA 5APUA 4EI2A 2FYUD 3OW2O 1BE3G 4MN4C 1JNMA 2O01H 1DNYA 4DG9A 2J5UA 3DS5A 1QX8A 1S5LH 4H13D 1SLQA 1DH3A 2LMLA 3AEDC 5JPAA 1IFJA 3KDPB 3Q2YA 1JOCA 1VQ5P 1UIIA 3DTJA 1RF1C 2ZT9D 1VQLP 1N8RQ 3EWKA 2D2CD 4UB6H 4W7YA 1EOQA 1P84D 1LP1B 1ZRTE 5GTIE 1EDLA 3G26A 3FX0A 3H1IE 3G3ZA 1KTMA 2GZIA 2XZ1C 2KI7B 3OA7A 1OVVA 3CCSP 2M8RA 1TU3F 1EC5A 1N7SA 3CXHH 3H1IJ 4PD4H 1JO5A 1NTZG 2IYOA 2A06D 4WWIA 5KJ7A 3AE6C 4AYCA 1MFTA 5KAIH 2AF8A 3L73D 2JBGA 1M74A 2AEJA 2N6ZA 1NTME 1UIXA 2KOSA 1LTTC 1SQPD 2FXMA 1BDDA 1NTMJ 5CCHA 3GMAA 2EG5A 1X22A 1BCCG 3BRTB 1M7LA 1G1JA 5APVA 4EDFA 1YJ9P 1N2DC 1PL5A 4L73A 2GDYA 1MFZA 2XDJA 3GHGA 3HUSC 2ZYAA 5CBOA 3P8CD 1NTKK 3PTZA 1H8AA 1RE4C 3GLMA 1M6EX 4HJGH 3HTKA 3DPHA 5AVUB 1AV1A 1GL2C 1EDIA 2E74B 1LT1A 3PRJA 1PIXA 1NWQA 1CEIA 4TLFA 3Q5SA 1VKUA 2M5AA 1U57A 3CWBG 1NAFA 2HG5D 3FGAD 5TJHA 1IFNA 3S4RA 2E1MA 4UB8E 1VDFA 4OGQD 1URQA 1GU4A 2YO3A 3RL0C 4I1LA 4H0LC 2B89A 2W6JH 3PLNA 1KB9E 3CXCO 3II6A 4OH8B 2CK3H 1GD2E 1VQKP 3B8EB 1FDIA 1HJBA 1VL2A 3V6IA 1EZVI 4RJTA 3HD7C 4W80A 1JY2O 1YQ4C 1FS0E 1KC8Q 3SWFA 2BCCE 1KZUB 1IC2A 2K94A 3A0BE 1YYCA 2L22A 2N5HA 1HF9A 3BCCG 1FZGA 2BCCJ 2JP3A 1GPJA 2M3EA 1MZ8A 4H2YC 1IMQA 1PGPA 3WU2H 1CI6B 1S2EA 2MKVA 5B5EE 1W2BO 3F89A 1JUNA 1NKZB 2G3AA 2WSCH 1SQPE 3MHVA 3NMDA 4DCKA 4IFDK 2JO0A 1YIJP 1IFIA 1FZAA 2E75D 4BWNA 2YIUB 1SQPJ 2WPTA 1LP1A 2GZFA 2KG8A 2ZT9C 4TT3H 1RY3A 1EDKA 1D1DA 1S1CX 3H32B 2SPZA 1ZLLA 4R0MA 2PRRA 2V4HA 3VMYA 3CC4P 1IK7A 1XTCC 3RK2D 4XE5B 2A45G 3OAKA 1NGMB 5KTBA 1LTBC 1JCDA 2P10A 3L35A 4AUWA 1VPCA 1MZ9A 1L2PA 1M90Q 3M0DC 4YXWH 3PHLA 1LWUB 2ZJSE 2VSQA 2PEMA 2FQ2A 1UJZA 5HGLA 2FFDB 4MRTC 3WMM0 4GDOA 1RE3C 1J1EB 3RBZA 2JR8A 1FU1A 2LF4A 3P32A 4WYMA 1L4AD 1IMPA 1N86A 2L91A 2XZRA 5F2OA 3FWLA 2KZJA 3H1HG 3A2AA 3EJEA 3JSVC 2E5TA 3WUTA 2ZXEB 3G4SP 2CPBA 4XRQA 1NTKG 1SQPK 3HE4B 3EJDA 3L4FA 2QVAA 3IAOA 1L0ND 1ZV8A 1KMIZ 2FVFA 4N3YB 2JYGA 1RO2A 2WT7A 2AEFA 3G1GA 1GW3A 3UIAA 1OR5A 3L75D 4PV1C 4PXHB 1ZXGA 3BASA 4QKOA 1EZVE 2YMYA 1KFMA 3D6YA 2PNGA 1Q7YQ 3U1AA 2OQQA 1FZFA 7CEIA 3V4QA 1S3JA 2QNWA 3L72E 4QMAA 2A45H 1QL1A 3L72J 1OVUA 1FDMA 3TSIA 1LTJB 3H1IG 1KILD 2MF4A 3O8ZA 4NEOA 3CL3D 2IDBA 2M8LA 2OYHC 1FOSF
chains in the Genus database with same CATH topology
1Q82Q 2PEMA 1ZMBA 2KODA 5HGLA 4GR2A 1S72P 1K73Q 2CWOA 3HYBA 3I56P 3CCRP 1Q81Q 2PEJA 5BS2A 1KC8Q 1VQMP 2XT1A 3CC7P 4GR6A 2PY8A 2L6EA 3CCEP 5DCKA 1PEUA 1EIAA 2LF4A 3G29A 1QRJA 4XROA 3DS3A 3E2DA 4WYMA 1M74A 1VQ4P 3CMEP 1VQNP 1PEOA 3CCLP 3P05A 3VRLC 5HGOA 3HZQA 2PENA 1YI2P 2QEXP 5F2OA 3RG6C 4XFXA 3H47A 4U0DA 2EIAA 2Z44A 3CC2P 1E6JP 1A43A 2EG5A 3CCVP 4M0IA 3G6EP 4COCA 1A8OA 4PH0A 2BUOA 1K30A 3MGEA 3G0VA 1YJ9P 3DS2A 1BAJA 3CD6P 1YITP 1W2BO 3G4SP 5BS1A 3CCJP 5I4TG 3NTEA 3I55P 2PEIA 2EFJA 4XRQA 2OTJP 3G21A 5HGMA 1YHQP 2JO0A 1YJNP 1YIJP 2XV6A 4PH1A 2Z46A 4QNBA 1M1KQ 2PEKA 3CCQP 4U0CA 1KQSO 1M6EX 2JYGA 1RO2A 3OW2O 3G1GA 3DPHA 3DS1A 3LRYA 5HGNA 1K9MQ 2ONTA 4IPYA 4COPA 1VQPP 1QVFO 2M8NA 3DS5A 4XFYA 1RNIA 1AUMA 1NJIQ 2QA4P 1QVGO 3CCUP 2DGYA 4U0EA 4U0BA 1VQ9P 2OTLP 1K8AQ 2OARA 2P9XA 1Q7YQ 3CCMP 3B5IA 4XFZA 1Q86Q 2JYLA 1VQ7P 5F2KA 5JPAA 3H4EA 2E1MA 3CMAP 1KD1Q 1D1DA 1IUQA 3DS0A 3CC4P 2M8PA 1PEMA 3G28A 1VQ5P 1PEQA 3DTJA 3G1IA 4U0FA 1N8RQ 1VQ8P 1VQLP 1M6NA 3CXCO 3DS4A 3WBHA 1EOQA 2PEOA 1VQOP 4U0AA 3CPWO 2Z45A 3G26A 1VQKP 1VQ6P 1M90Q 1RO0A 1JJ2O 2BHVA 3M1MA 3CCSP 3Q20A 2BQ1E 3H0DA 3G71P 2PEQA 1YJWP 2M8LA 2XXMA 5F2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 Q;  2QEX P;  3CC2 P;  1KQS O;  3CC4 P;  3OW2 O;  1VQ5 P;  1K73 Q;  1S72 P;  3CCV P;  3I56 P;  3G6E P;  1VQ8 P;  1N8R Q;  1VQL P;  3CCR P;  1Q81 Q;  1K9M Q;  1KC8 Q;  3CXC O;  1VQP P;  1QVF O;  1VQM P;  1YJ9 P;  1NJI Q;  3CD6 P;  3CC7 P;  2QA4 P;  1YIT P;  1W2B O;  3G4S P;  1VQO P;  1QVG O;  3CCU P;  3CCJ P;  3CCE P;  3CPW O;  1VQ9 P;  2OTL P;  3I55 P;  1K8A Q;  1VQK P;  1VQ6 P;  1M90 Q;  2OTJ P;  1YHQ P;  1Q7Y Q;  1JJ2 O;  1YJN P;  1YIJ P;  3CCM P;  1VQ4 P;  3CME P;  3CCS P;  1VQN P;  1Q86 Q;  3CCL P;  1M1K Q;  3G71 P;  1YJW P;  3CMA P;  1VQ7 P;  1KD1 Q;  3CCQ P;  1YI2 P; 
#chains in the Genus database with same CATH topology
 1ZMB A;  3F5H A;  4PJ0 H;  4U7J A;  1JY3 P;  2OTK E;  4C46 A;  3NXS A;  3HRN A;  1OVR A;  3RK3 E;  2Z5I A;  3HE5 B;  1GZL A;  3CX5 D;  2BAS A;  3C8V A;  5AW8 B;  1H88 A;  1OMI A;  2N50 A;  3BVH A;  3CME P;  1VQN P;  3JCU E;  3R4Y A;  1ZME C;  3RL0 g;  4XFX A;  2E75 C;  3BRV B;  2FKW B;  1K04 A;  4L74 A;  3T97 B;  2K0D X;  4H2X C;  2FY8 A;  4ZMD A;  5BU8 B;  3CE7 A;  2PEI A;  3A0H H;  3H32 A;  4GT1 A;  1FE6 A;  2K2Q A;  4AQR D;  4WY4 A;  3LW5 H;  1URQ C;  2H89 C;  2GDX A;  2QJY C;  1HJ0 A;  1EMV A;  2LPK A;  5HGN A;  3RK2 C;  1WRG A;  3SFE C;  1RQU A;  2KLU A;  3CCU P;  2E76 B;  1GW4 A;  1K8A Q;  1SFC B;  2FYU G;  1LWU A;  2PP6 A;  2FFD A;  3L70 E;  3RK3 C;  1VF5 C;  1MKM A;  3L70 J;  4IZ6 A;  2Q3E A;  1EXJ A;  3FXE A;  2P7J A;  2WPS A;  3ITK A;  2JAZ A;  3GW6 A;  1JJ2 O;  1X0T A;  1U7J A;  2P1J A;  3AE9 C;  4H2W C;  1Q82 Q;  1ZRT D;  5HV8 A;  1L4A C;  3L74 D;  1IFP A;  1GL2 D;  2IZ1 A;  3M9Q A;  3NFQ A;  2VLN A;  3MGN A;  3HE4 A;  2XZ0 D;  1OXZ A;  2FYN B;  1PEU A;  1JY3 N;  1L0L E;  1EIA A;  4XRO A;  4I6M C;  1L0L J;  1G2C B;  2CNR A;  4U0D A;  2EIA A;  3L73 G;  1YBK A;  1NTM D;  3VMA A;  5KKZ B;  2IPP A;  2IZ0 A;  2P67 A;  4WY4 D;  1LTA C;  2BEZ F;  1SQP G;  2MJZ A;  1K05 A;  1VHN A;  2WIT A;  2XV6 A;  4I7Z C;  4EOT A;  2N98 A;  4U0C A;  3KZI E;  1PGQ A;  3AE2 C;  2NO8 A;  3SFD C;  1LTJ A;  1K9M Q;  1T3J A;  4H44 B;  1LNQ A;  1QVG O;  2B87 B;  2KB7 P;  4NPD A;  2P9X A;  2QJP B;  1USE A;  2WSE J;  1LGH B;  2NPS B;  3LIE A;  1KIL C;  1NU1 E;  1FJK A;  4UB8 H;  2L9F A;  3HE5 A;  1AVO A;  1NU1 J;  1HY8 A;  2IFM A;  4ASW A;  1JY2 P;  2Y9Y A;  1GU5 A;  3K5B A;  2AEM A;  3A5T A;  5KLI C;  5AW6 B;  4BXL A;  3H6P A;  1EDJ A;  5CCG D;  2M3B A;  4OWF A;  2AXT E;  2K37 A;  2P58 A;  3AE7 C;  3VTP C;  1KB9 D;  3U59 A;  3H0D A;  2PEQ A;  2XXM A;  1P84 H;  1NQ4 A;  4RKU J;  2W6B A;  3CXH I;  3VMX A;  2CWO A;  1X79 B;  3CC7 P;  2L6E A;  3A0B H;  2NRG A;  3L74 E;  1L0L K;  1SQB E;  1PEO A;  2YO2 A;  2QG4 A;  1BXI A;  1OWA A;  3RBX A;  3L74 J;  4F37 A;  2BCC D;  1SQB J;  1FZC B;  3QH9 A;  4PH0 A;  2HOD B;  1K30 A;  2XND H;  1BAJ A;  2IBZ I;  1H0T B;  3MIW A;  1SS1 A;  5HGM A;  1AA0 A;  4PH1 A;  1BGY E;  1SQV E;  1M1K Q;  4GOD A;  4IFF A;  3IFM A;  5TIS H;  1PP9 E;  1QLE D;  1SQV J;  1BGY J;  5APT A;  5AVX B;  1WT6 A;  3IR9 A;  3G9R A;  4M3L A;  3LRY A;  1PP9 J;  2R5D A;  1N73 B;  3NY7 B;  2DNW A;  2KGC A;  1NOH A;  4NPE A;  1KQF B;  4PWV B;  1PZQ A;  4BPG A;  2YKQ A;  2ZVO B;  2G8Y A;  4HKZ H;  3DS4 A;  5H2F E;  2YIU C;  1L0H A;  2W6A A;  5AW4 B;  2FAE A;  1G2C A;  1JY2 N;  2IBZ D;  3H1K E;  4HYT B;  2BHV A;  1JTH B;  4GOE A;  3JC2 2;  3H1K J;  1OW6 A;  4PV1 D;  2LL8 A;  3B5N B;  2JU1 A;  4GR2 A;  2JU2 A;  4NPF X;  3KHU A;  1GK6 A;  1YTZ I;  1N7S D;  3CCE P;  1FJP A;  4WY4 C;  5AVR B;  5KLV D;  1RF0 A;  1MV8 A;  1SQB K;  1SVF A;  2K88 A;  3VRL C;  5HGO A;  2RH0 A;  3RG2 A;  2H43 A;  5KJ7 D;  2OYI A;  2M0B A;  3G6E P;  2XKM A;  5CZD B;  2B87 A;  1BSN A;  3G0V A;  2GZE A;  3D6Z A;  4W7Z A;  1Q90 D;  3TYY A;  2O01 J;  1JB0 J;  2FFD C;  4ZKU A;  2FXO A;  1SQV K;  1DD4 A;  2Q1K A;  5CCH D;  3TGU D;  2WPR A;  1J1E C;  1NTM K;  5KAF H;  2LXB A;  2YNY A;  5AW0 B;  2QM7 A;  5GTH H;  2KK7 A;  5APW A;  4UB6 E;  1L0N G;  2QA4 P;  5AVV B;  4U0E A;  4U0B A;  3PH0 A;  2OAR A;  4IFM A;  1NH4 A;  2GUV A;  3L75 G;  3P7K A;  5CCG C;  5BU5 A;  3CXH E;  1FC2 C;  1HGZ A;  2UWJ E;  2B88 A;  2LOL A;  1EZV D;  4R4M A;  3A3Y B;  1Z6M A;  1AVY A;  2N6Y A;  4BPH A;  1IO4 A;  3L72 D;  1A02 J;  3EFG A;  5KAI E;  1URQ D;  3WUV A;  1FZC A;  2J59 M;  3H1L E;  1DV5 A;  2FVE A;  4RO0 A;  5HVC A;  2LIW A;  1FR2 A;  3H1L J;  4JYB A;  1H0T A;  2IBZ E;  4KT0 J;  4L76 A;  2KW2 A;  4U3F D;  4H0L B;  2JKV A;  1JCC A;  3JCU H;  3RK3 D;  2ERH A;  3CCL P;  2L5G B;  4OVN F;  2N1T B;  1SQX E;  1J1D B;  2MR7 A;  1UNK A;  1VF5 D;  2XU6 A;  1BE3 E;  3KQG A;  1SQX J;  4COC A;  1N73 A;  2O3J A;  5KLV E;  5AVQ B;  3HD7 B;  1BE3 J;  4EIJ A;  1QGK B;  5BS1 A;  2KOG A;  2WSS H;  5KLV J;  4WB4 A;  1E5W A;  2Z46 A;  5M1B A;  2FXP A;  5E79 H;  1DX7 A;  3M0A A;  1S9K E;  3AEC C;  2YXQ B;  3Q5R A;  2LIU A;  1VQP P;  4B86 A;  2EHT A;  2M8N A;  3TGU E;  1NJI Q;  1VQ9 P;  3EJB A;  1E79 H;  3TGU J;  2ZYG A;  3CCM P;  3B5N A;  1KD1 Q;  1YTZ T;  1IUQ A;  1PGO A;  1PGJ A;  4H13 B;  3L70 D;  2AXC A;  2A45 I;  2V7Q H;  5AW7 B;  2KNC B;  3MTU E;  3E1R A;  1F80 D;  4U0A A;  1YQ3 C;  2JEE A;  2W27 A;  1VQ6 P;  1N7S C;  3M1M A;  1W2E A;  2R3S A;  2D2C B;  1K73 Q;  2NZ2 A;  2E43 A;  1M8O B;  2K1A A;  3WU2 E;  1X3O A;  5BS2 A;  5KJ7 C;  2R5B A;  1PFI A;  2AVA A;  2PY8 A;  2MR8 A;  3L74 G;  3G29 A;  3CI9 A;  1XTG B;  1T8Z A;  2WSC J;  5CBN A;  3CX5 H;  1CI6 A;  5CCH C;  1L0L D;  2IFN A;  4U3F E;  1A43 A;  2QJK C;  2BUO A;  5KLV K;  1KV4 A;  4U3F J;  3M9H A;  3Q5P A;  5I4T G;  3GHG C;  3S1K A;  3VYI A;  2JQ4 A;  4K35 A;  1E0H A;  2E74 D;  1BSH A;  1NTM G;  2H88 C;  3PJS K;  1JEK A;  2AFE A;  5DJU B;  3KZI H;  1RE4 A;  4IL6 E;  2K5X A;  5APQ A;  1SQQ D;  2JJL A;  2WSF J;  2WSE H;  5C39 A;  4GOF A;  4RES B;  2MD9 A;  2CGQ A;  3EFF K;  4N78 E;  1USD A;  5KKZ C;  5F2K A;  1M57 D;  4R4L A;  3DS0 A;  2KWL A;  2KLV A;  5CJ4 A;  1W5C E;  3SWY A;  1NU1 D;  3S9O A;  1HTL C;  4LGD E;  2GDW A;  4JF7 A;  2K3R A;  2N1T A;  3CPW O;  2AXT H;  1RF0 C;  1RO0 A;  2KSJ A;  3C9I A;  4OGQ B;  3BCC E;  2ZXX A;  3Q20 A;  2BQ1 E;  3H1J D;  2C9L Y;  3D70 A;  2OYI C;  1CSB A;  3ABV C;  3HD7 A;  1JMM A;  3BCC J;  1IK9 A;  2C0W A;  3M06 A;  2H7H A;  2I1J A;  2QJP C;  2WZ7 A;  2RKL A;  2FQ1 A;  1M56 D;  1VQM P;  1ZR2 A;  2ZYD A;  3GG2 A;  1QL2 A;  5GTI H;  5KP7 B;  1QRJ A;  1IFD A;  3ZDM A;  1RHZ B;  2N9B A;  1DEE G;  1U7M A;  1JMB A;  4Y99 B;  4JQ0 D;  4C7N B;  1OX3 A;  1SQB D;  5EFW B;  2OYH B;  3PP5 A;  1X8Y A;  2BCC G;  2E5Y A;  2I8D A;  2JO1 A;  1AQT A;  1KOR A;  5AVW B;  1MUU A;  3IN6 A;  4QNB A;  3FWN A;  1LTS C;  2ZAE B;  4A7P A;  1KQS O;  1HQB A;  2KNC A;  2RN0 A;  2N9Y B;  1SQV D;  1BGY D;  3W68 A;  1PV3 A;  1KYO I;  4COP A;  1RNI A;  3WUU A;  1PP9 D;  1OFC X;  2E75 B;  5EW5 E;  2OTL P;  1FZC C;  1NHL A;  1SQQ E;  4ZNC A;  2N5I A;  3MUD A;  1HVV A;  3M91 A;  3L37 A;  2GA1 A;  3MP7 B;  4C7R A;  1SQQ J;  3V2Q A;  2N1T D;  3NTN A;  3GF7 A;  2CG5 B;  3VOP A;  3W67 A;  3AEG C;  2OGU A;  2QJY B;  2W8Z A;  2HR3 A;  3RK2 B;  2HFE D;  4D6T D;  3TF5 A;  4XFJ A;  3L71 D;  1J2J B;  1N73 C;  3H1K D;  2ITA A;  3H1H E;  2KOQ A;  2IBZ G;  1P84 I;  2EHS A;  1KB9 H;  1NYH A;  1OZH A;  2O1K A;  1KYO D;  3H1J E;  3H1H J;  1LT9 B;  2XV5 A;  3B4Q A;  4CPG A;  3A0H E;  2KXP B;  5APY A;  3DS3 A;  1NTK E;  2FQ0 A;  1VQ4 P;  3H1J J;  2Z5H A;  2VRS A;  4DOJ A;  3HZQ A;  1YI2 P;  3RG6 C;  1NTK J;  3H47 A;  2E74 C;  3T97 A;  3VN0 A;  3LW5 J;  1ZN5 A;  5KLV G;  4Z1M H;  3MGE A;  3BAT A;  4PD4 I;  1L4A B;  3CCJ P;  3V2N A;  3B5N C;  2EFJ A;  3G21 A;  1YHQ P;  3AEF C;  1M1J B;  3MZW B;  1WMK A;  2KOP A;  4L75 A;  2R44 A;  3AE3 C;  1OW7 A;  1Y8A A;  3SSU A;  2WPQ A;  2JWA A;  1SFC A;  3TGU G;  5B5E H;  4JBZ A;  1RQV A;  2KSE A;  3AE4 C;  3Q1M A;  3B5I A;  5L8R J;  2HPC B;  1SQQ K;  3V4W A;  3CMA P;  3R2P A;  2M8P A;  1QEX A;  4DJG A;  4YXD C;  4U0F A;  4I7Z B;  1T6A A;  3VMZ A;  3CXH D;  5B66 E;  4PD4 D;  1IZN B;  1EZV G;  5KP8 B;  2Y9Z A;  2Z45 A;  4UHP B;  3E1I A;  2KGE A;  3L36 A;  4C7N A;  1NU1 K;  2LTE A;  2OYH A;  1FZB A;  3L72 G;  1AYI A;  5AVS B;  3OJA B;  4K3A A;  1KIL B;  3O6Q B;  3H1L D;  4WBA A;  2FAC A;  2FYZ A;  4D6T E;  3L71 E;  1PPJ D;  5DCK A;  1SP4 A;  2WMM A;  4XA4 A;  2KGD A;  4D6T J;  1L0I A;  5AW1 B;  5KLI B;  3L71 J;  1ZOY C;  2OYO A;  3P05 A;  2JDI H;  1LTI C;  4KHX A;  1KYO E;  1RH5 B;  1T8K A;  4U3F G;  1T3U A;  1DEB A;  2PGD A;  5CJ0 A;  1SQX D;  1GK4 A;  4YTP C;  2RMZ A;  5AW3 B;  2KG6 A;  1BE3 D;  1NO4 A;  2FYU E;  3IF4 A;  1RF1 B;  4WVZ A;  2MY5 A;  5DJT B;  1D7M A;  2E76 D;  2FYU J;  1FDO A;  1SFC D;  2KOO A;  4HB1 A;  3GKL C;  1H89 A;  2ONT A;  2YMK A;  2WT7 B;  2N1T C;  1J1D C;  2NPS A;  1S9K D;  1LWU C;  1S5L E;  2H8P D;  4O9B A;  1GTW A;  2LXC B;  2Q3I A;  4HH2 A;  4XFZ A;  2JYL A;  1ZW0 A;  3Q3D A;  1BDC A;  3H4E A;  2VLP A;  1GXH A;  1P84 E;  4IL6 X;  2QIW A;  2R32 A;  1LT9 A;  3G1I A;  2YXR B;  1AF8 A;  2FHS C;  3GF3 A;  2Z4E A;  2GM4 A;  2GYK A;  2Y0E A;  1NTZ D;  2PAJ A;  3U43 A;  4LLH A;  2KUB A;  2A06 E;  1AQ5 A;  1R8E A;  3L70 G;  1ACP A;  4N6J A;  3KXD A;  5CMZ A;  4PD4 E;  1L4A A;  3HUS B;  3HYB A;  3L73 E;  3CCR P;  2LKI A;  1M1J A;  2LR2 A;  2XT1 A;  4GR6 A;  2WVR A;  3L73 J;  4DT0 A;  3E2D A;  4HKG A;  1BCC D;  3VP9 A;  4H13 C;  1GL2 B;  1GDT A;  4LC1 A;  1OW8 A;  4GIF A;  2L0Q A;  2HOD A;  5TIS E;  2FVA A;  4BPF A;  3MD0 A;  2QRX A;  1E6J P;  1PPJ E;  3CCV P;  1KQL A;  1NVO A;  1OIP A;  1X9V A;  3P8C E;  2KYV A;  4EYY Q;  2HPC A;  2D2C C;  1R5S A;  1L0L G;  3I55 P;  1DIP A;  3RL0 B;  2FYU K;  2R3C A;  4ASV A;  3MUD C;  4H44 D;  1KN7 A;  1FAV A;  3QWO C;  2WSF H;  3CCQ P;  1GMJ A;  4WY4 B;  2NPS D;  2JGP A;  1LTJ C;  4IL6 H;  2IX7 C;  3CWB D;  3DS1 A;  4IPY A;  1R5L A;  2W90 A;  4XFY A;  1NAY A;  4BRY B;  3N4X A;  2DGY A;  2KS1 B;  2LKM A;  2ROQ A;  3KPE A;  3D71 A;  1HUC A;  4KJM A;  2PFX A;  5EJD A;  1SQQ G;  1KIL A;  2K0Y A;  3O6Q A;  3KYQ A;  1IJD B;  1JM0 A;  1M6N A;  4N78 D;  1T2K D;  3N7N A;  1FOS E;  1JTH A;  1VQO P;  2DW3 A;  2AFD A;  2KP8 A;  3CLQ A;  1NU1 G;  1A02 F;  1AFO A;  2WQY C;  2KG9 A;  1CW5 A;  1NTZ E;  3BCC D;  1RF1 A;  3H1J G;  1NTZ J;  2K9J B;  2Y0C A;  3EQ2 A;  2QM8 A;  2ZT9 B;  5K5G B;  2KGA A;  4Y28 J;  5KP6 B;  2PEN A;  3B71 A;  2QEX P;  2ZFC A;  1ZR4 A;  5KAF E;  2E76 C;  3TNU B;  1SFC C;  4OGQ C;  1A8O A;  3CX5 I;  5GTH E;  3A7O A;  1BCC E;  3CD6 P;  2Y0D A;  3FXD A;  1BCC J;  3V2P A;  3LID A;  2K93 A;  5AW9 B;  1YJN P;  1SQB G;  1HGV A;  2C0X A;  1AJY A;  5AVT B;  5APS A;  1HWT C;  1SQX K;  3LMO A;  2KZI A;  2HLO A;  1Y47 A;  5AW5 B;  3TK1 A;  2MVU A;  1QVF O;  2IYP A;  2Q5U A;  3VP8 A;  5CHX A;  1LTG C;  4Y99 C;  2O1J A;  2K92 A;  1SQV G;  1BGY G;  1Q86 Q;  3CWB E;  3HUS A;  1EXI A;  4ZKP A;  1PP9 G;  4GKG A;  2FYN C;  1PEM A;  2QE7 H;  3CWB J;  1PEQ A;  2CPS A;  1VQ8 P;  1N7L A;  4JYC A;  3V5B A;  2C9N Y;  3B5N D;  4I2L C;  1GL2 A;  2PEO A;  4IOI H;  1G1I A;  1GXG A;  2Q9I A;  3AEA C;  3V2R A;  2Q6Q A;  2P2U A;  5F2N A;  3E7K A;  2YKP A;  1S72 P;  3I56 P;  1Q81 Q;  2GZG A;  1NTZ K;  4D6T G;  3AE8 C;  3L71 G;  2BEQ D;  3RGU A;  1Y9B A;  1S4X A;  3H1H D;  3H1K G;  4PV1 B;  4DZO A;  2POH A;  5E79 E;  4H44 C;  5AVZ B;  2KR5 A;  2FAD A;  3CC2 P;  1ZP0 C;  2Z44 A;  3SWK A;  1N7S B;  4M0I A;  1NTK D;  4BRY A;  2M5R A;  2MVV A;  2X2B A;  2KS1 A;  2NPS C;  1IFM A;  1L0N E;  3DS2 A;  2E42 A;  2VLQ A;  2WPV B;  3NTE A;  1KLP A;  3C1L A;  3GJN A;  3AE1 C;  1L0N J;  3L75 E;  2B9B A;  3B4S A;  2PEK A;  1KFN A;  1LT9 C;  3L75 J;  1Z56 A;  3U1C A;  2J58 A;  2FBW C;  2KOR A;  4CA3 A;  2L4B A;  3AEE C;  1DD3 A;  2GUS A;  1AUM A;  3TDK A;  2JB0 A;  5APX A;  3GZL A;  1T2K C;  2QJK B;  4JPZ B;  2V7Q J;  2GZJ A;  5CCG A;  1VQ7 P;  5AVY B;  3GHG B;  3AE5 C;  3H1I D;  2I1K A;  3G28 A;  1KIL E;  1M1J C;  2Q7C A;  4YPC A;  2K9J A;  1S5L X;  3WBH A;  2VLO A;  1Q2N A;  5B66 H;  3HTK B;  2W83 C;  2A06 G;  1HH0 A;  3TNU A;  3G71 P;  1YJW P;  3RL0 D;  3CX5 E;  2ZVN B;  2JWD A;  2M5A B;  4H0L D;  2KOD A;  3P8M C;  4PJ0 E;  3H25 A;  2K0X A;  1NKN A;  2PEJ A;  2CQ8 A;  1URQ B;  3I5C A;  5H2F H;  1FZE A;  1FBM A;  1KB9 I;  2O01 N;  1EQ7 A;  2WWW A;  2XNX A;  3HD7 D;  1KQG B;  3H1L G;  3M0D A;  1JY3 O;  1KYO H;  1PPJ G;  2YKO A;  1CZQ A;  2K9Y A;  2QSI A;  3AEB C;  2OYI B;  2HYN A;  3RK3 B;  1L0N K;  1YIT P;  1LJ2 A;  1RE3 A;  1HBW A;  3M9B A;  5AW2 B;  3GZM A;  1VF5 B;  2OTJ P;  1ZNV A;  2WTY A;  1SQX G;  3USS A;  2KIK A;  5BVZ A;  5APU A;  4EI2 A;  2FYU D;  3OW2 O;  1BE3 G;  4MN4 C;  1JNM A;  2O01 H;  1DNY A;  4DG9 A;  2J5U A;  3DS5 A;  1QX8 A;  1S5L H;  4H13 D;  1SLQ A;  1DH3 A;  2LML A;  3AED C;  5JPA A;  1IFJ A;  3KDP B;  3Q2Y A;  1JOC A;  1VQ5 P;  1UII A;  3DTJ A;  1RF1 C;  2ZT9 D;  1VQL P;  1N8R Q;  3EWK A;  2D2C D;  4UB6 H;  4W7Y A;  1EOQ A;  1P84 D;  1LP1 B;  1ZRT E;  5GTI E;  1EDL A;  3G26 A;  3FX0 A;  3H1I E;  3G3Z A;  1KTM A;  2GZI A;  2XZ1 C;  2KI7 B;  3OA7 A;  1OVV A;  3CCS P;  2M8R A;  1TU3 F;  1EC5 A;  1N7S A;  3CXH H;  3H1I J;  4PD4 H;  1JO5 A;  1NTZ G;  2IYO A;  2A06 D;  4WWI A;  5KJ7 A;  3AE6 C;  4AYC A;  1MFT A;  5KAI H;  2AF8 A;  3L73 D;  2JBG A;  1M74 A;  2AEJ A;  2N6Z A;  1NTM E;  1UIX A;  2KOS A;  1LTT C;  1SQP D;  2FXM A;  1BDD A;  1NTM J;  5CCH A;  3GMA A;  2EG5 A;  1X22 A;  1BCC G;  3BRT B;  1M7L A;  1G1J A;  5APV A;  4EDF A;  1YJ9 P;  1N2D C;  1PL5 A;  4L73 A;  2GDY A;  1MFZ A;  2XDJ A;  3GHG A;  3HUS C;  2ZYA A;  5CBO A;  3P8C D;  1NTK K;  3PTZ A;  1H8A A;  1RE4 C;  3GLM A;  1M6E X;  4HJG H;  3HTK A;  3DPH A;  5AVU B;  1AV1 A;  1GL2 C;  1EDI A;  2E74 B;  1LT1 A;  3PRJ A;  1PIX A;  1NWQ A;  1CEI A;  4TLF A;  3Q5S A;  1VKU A;  2M5A A;  1U57 A;  3CWB G;  1NAF A;  2HG5 D;  3FGA D;  5TJH A;  1IFN A;  3S4R A;  2E1M A;  4UB8 E;  1VDF A;  4OGQ D;  1URQ A;  1GU4 A;  2YO3 A;  3RL0 C;  4I1L A;  4H0L C;  2B89 A;  2W6J H;  3PLN A;  1KB9 E;  3CXC O;  3II6 A;  4OH8 B;  2CK3 H;  1GD2 E;  1VQK P;  3B8E B;  1FDI A;  1HJB A;  1VL2 A;  3V6I A;  1EZV I;  4RJT A;  3HD7 C;  4W80 A;  1JY2 O;  1YQ4 C;  1FS0 E;  1KC8 Q;  3SWF A;  2BCC E;  1KZU B;  1IC2 A;  2K94 A;  3A0B E;  1YYC A;  2L22 A;  2N5H A;  1HF9 A;  3BCC G;  1FZG A;  2BCC J;  2JP3 A;  1GPJ A;  2M3E A;  1MZ8 A;  4H2Y C;  1IMQ A;  1PGP A;  3WU2 H;  1CI6 B;  1S2E A;  2MKV A;  5B5E E;  1W2B O;  3F89 A;  1JUN A;  1NKZ B;  2G3A A;  2WSC H;  1SQP E;  3MHV A;  3NMD A;  4DCK A;  4IFD K;  2JO0 A;  1YIJ P;  1IFI A;  1FZA A;  2E75 D;  4BWN A;  2YIU B;  1SQP J;  2WPT A;  1LP1 A;  2GZF A;  2KG8 A;  2ZT9 C;  4TT3 H;  1RY3 A;  1EDK A;  1D1D A;  1S1C X;  3H32 B;  2SPZ A;  1ZLL A;  4R0M A;  2PRR A;  2V4H A;  3VMY A;  3CC4 P;  1IK7 A;  1XTC C;  3RK2 D;  4XE5 B;  2A45 G;  3OAK A;  1NGM B;  5KTB A;  1LTB C;  1JCD A;  2P10 A;  3L35 A;  4AUW A;  1VPC A;  1MZ9 A;  1L2P A;  1M90 Q;  3M0D C;  4YXW H;  3PHL A;  1LWU B;  2ZJS E;  2VSQ A;  2PEM A;  2FQ2 A;  1UJZ A;  5HGL A;  2FFD B;  4MRT C;  3WMM 0;  4GDO A;  1RE3 C;  1J1E B;  3RBZ A;  2JR8 A;  1FU1 A;  2LF4 A;  3P32 A;  4WYM A;  1L4A D;  1IMP A;  1N86 A;  2L91 A;  2XZR A;  5F2O A;  3FWL A;  2KZJ A;  3H1H G;  3A2A A;  3EJE A;  3JSV C;  2E5T A;  3WUT A;  2ZXE B;  3G4S P;  2CPB A;  4XRQ A;  1NTK G;  1SQP K;  3HE4 B;  3EJD A;  3L4F A;  2QVA A;  3IAO A;  1L0N D;  1ZV8 A;  1KMI Z;  2FVF A;  4N3Y B;  2JYG A;  1RO2 A;  2WT7 A;  2AEF A;  3G1G A;  1GW3 A;  3UIA A;  1OR5 A;  3L75 D;  4PV1 C;  4PXH B;  1ZXG A;  3BAS A;  4QKO A;  1EZV E;  2YMY A;  1KFM A;  3D6Y A;  2PNG A;  1Q7Y Q;  3U1A A;  2OQQ A;  1FZF A;  7CEI A;  3V4Q A;  1S3J A;  2QNW A;  3L72 E;  4QMA A;  2A45 H;  1QL1 A;  3L72 J;  1OVU A;  1FDM A;  3TSI A;  1LTJ B;  3H1I G;  1KIL D;  2MF4 A;  3O8Z A;  4NEO A;  3CL3 D;  2IDB A;  2M8L A;  2OYH C;  1FOS F; 
#chains in the Genus database with same CATH homology
 1Q82 Q;  2PEM A;  1ZMB A;  2KOD A;  5HGL A;  4GR2 A;  1S72 P;  1K73 Q;  2CWO A;  3HYB A;  3I56 P;  3CCR P;  1Q81 Q;  2PEJ A;  5BS2 A;  1KC8 Q;  1VQM P;  2XT1 A;  3CC7 P;  4GR6 A;  2PY8 A;  2L6E A;  3CCE P;  5DCK A;  1PEU A;  1EIA A;  2LF4 A;  3G29 A;  1QRJ A;  4XRO A;  3DS3 A;  3E2D A;  4WYM A;  1M74 A;  1VQ4 P;  3CME P;  1VQN P;  1PEO A;  3CCL P;  3P05 A;  3VRL C;  5HGO A;  3HZQ A;  2PEN A;  1YI2 P;  2QEX P;  5F2O A;  3RG6 C;  4XFX A;  3H47 A;  4U0D A;  2EIA A;  2Z44 A;  3CC2 P;  1E6J P;  1A43 A;  2EG5 A;  3CCV P;  4M0I A;  3G6E P;  4COC A;  1A8O A;  4PH0 A;  2BUO A;  1K30 A;  3MGE A;  3G0V A;  1YJ9 P;  3DS2 A;  1BAJ A;  3CD6 P;  1YIT P;  1W2B O;  3G4S P;  5BS1 A;  3CCJ P;  5I4T G;  3NTE A;  3I55 P;  2PEI A;  2EFJ A;  4XRQ A;  2OTJ P;  3G21 A;  5HGM A;  1YHQ P;  2JO0 A;  1YJN P;  1YIJ P;  2XV6 A;  4PH1 A;  2Z46 A;  4QNB A;  1M1K Q;  2PEK A;  3CCQ P;  4U0C A;  1KQS O;  1M6E X;  2JYG A;  1RO2 A;  3OW2 O;  3G1G A;  3DPH A;  3DS1 A;  3LRY A;  5HGN A;  1K9M Q;  2ONT A;  4IPY A;  4COP A;  1VQP P;  1QVF O;  2M8N A;  3DS5 A;  4XFY A;  1RNI A;  1AUM A;  1NJI Q;  2QA4 P;  1QVG O;  3CCU P;  2DGY A;  4U0E A;  4U0B A;  1VQ9 P;  2OTL P;  1K8A Q;  2OAR A;  2P9X A;  1Q7Y Q;  3CCM P;  3B5I A;  4XFZ A;  1Q86 Q;  2JYL A;  1VQ7 P;  5F2K A;  5JPA A;  3H4E A;  2E1M A;  3CMA P;  1KD1 Q;  1D1D A;  1IUQ A;  3DS0 A;  3CC4 P;  2M8P A;  1PEM A;  3G28 A;  1VQ5 P;  1PEQ A;  3DTJ A;  3G1I A;  4U0F A;  1N8R Q;  1VQ8 P;  1VQL P;  1M6N A;  3CXC O;  3DS4 A;  3WBH A;  1EOQ A;  2PEO A;  1VQO P;  4U0A A;  3CPW O;  2Z45 A;  3G26 A;  1VQK P;  1VQ6 P;  1M90 Q;  1RO0 A;  1JJ2 O;  2BHV A;  3M1M A;  3CCS P;  3Q20 A;  2BQ1 E;  3H0D A;  3G71 P;  2PEQ A;  1YJW P;  2M8L A;  2XXM A;  5F2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...