1YIJP

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 50
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1yijP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1yijP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1yijP02
3G6EP 1VQ9P 1QVFO 3CCSP 1YJWP 1S72P 1VQOP 3CPWO 3CCEP 2OTLP 1W2BO 3I55P 3G71P 1VQNP 1VQ6P 1KD1Q 1VQKP 3CC7P 3CCRP 1YITP 1NJIQ 1VQ4P 1K73Q 1VQ7P 3CCUP 3CCLP 3OW2O 1YHQP 1Q81Q 1KC8Q 3CC2P 3CD6P 3CC4P 1VQMP 1N8RQ 1K9MQ 1Q82Q 1Q7YQ 3CCVP 3I56P 2QA4P 1JJ2O 3CMAP 3CCQP 2OTJP 1YI2P 3CCJP 1Q86Q 1YJNP 1VQ8P 3CMEP 1QVGO 1M1KQ 1YIJP 1VQLP 3G4SP 1YJ9P 2QEXP 1VQPP 1K8AQ 1KQSO 3CCMP 1VQ5P 3CXCO 1M90Q
chains in the Genus database with same CATH superfamily
4XFZA 2GZIA 2FYZA 2Z5HA 3H25A 1ZMEC 5HGOA 2VSQA 4DCKA 2QJKB 2X2BA 1S1CX 3HD7D 1NOHA 2NPSD 1LT9A 3H1HE 5KJ7C 5GTHE 1WRGA 1YJNP 3A2AA 2KSEA 2BCCG 3TF5A 1PEQA 3JC22 3D71A 3W67A 5AVTB 3HUSC 1VHNA 1OWAA 1L0NJ 3QH9A 1A02F 1CW5A 1EOQA 3R4YA 5AW0B 1SQVK 1EZVI 1SQXK 2ZVNB 1KFMA 2E75B 1X22A 1NO4A 2P9XA 4PJ0E 2QRXA 1LTBC 2L22A 1SQQK 3V4QA 2LIUA 3H4EA 4EDFA 3MD0A 1G1IA 1NAFA 5AVWB 3P8CE 3M0DC 1RF0A 1TU3F 3GZMA 2KYVA 4GDOA 5KTBA 3TYYA 1S5LH 2M8NA 1LJ2A 4WY4D 2FXMA 4EYYQ 4NPFX 1Z56A 5GTIH 3IFMA 2K37A 1Q7YQ 2NPSC 2KGCA 4N6JA 3CCQP 2KR5A 1LWUA 2QSIA 2IBZG 2R3SA 2ZAEB 1RF1C 2Q7CA 4WVZA 2KOPA 1JB0J 4WYMA 3QWOC 4HKGA 2Z4EA 1RO2A 1LTAC 1OW6A 4I7ZC 2WSCH 2FYNC 5BS1A 1EDIA 4RJTA 3CLQA 3VRLC 4Y99B 3PJSK 1BGYJ 1FZAA 3H1KG 1S2EA 1ZXGA 3AECC 2KIKA 1XTCC 2IX7C 3CX5H 3O6QB 4U3FD 2H89C 4H2XC 5AW1B 3CWBJ 3PTZA 1MZ9A 3N7NA 2G3AA 1NTZJ 5KAIE 3V2RA 3A5TA 4OVNF 2Q1KA 3PH0A 2D2CB 1ZMBA 4HYTB 2W27A 2ZT9D 3U59A 4W7ZA 2ZYDA 3B71A 2KXPB 1L0LD 5AVXB 4YPCA 2JWAA 1BSHA 4DJGA 2Z45A 1PL5A 2OTJP 1BCCD 3A0HH 2KOSA 1M7LA 1LWUB 2RKLA 3O8ZA 2QEXP 3EJEA 3G71P 2LPKA 4M3LA 1EDLA 4M0IA 1PPJG 2KLUA 5KAFH 2M8LA 4PXHB 3V6IA 2WSCJ 1PZQA 3AE8C 2N1TD 2E74D 1QRJA 1HF9A 3MUDC 3HYBA 4PD4H 4IFFA 3RK2B 4L75A 1PFIA 3M06A 2C0XA 2FYUD 1P84H 4NPDA 2N98A 5BU5A 2PEQA 2AEJA 2ZT9C 1LGHB 2V7QJ 1VQ7P 1JY3O 3BATA 5AW4B 1YQ4C 1EDKA 1SQPK 2GZEA 1JY2N 5EFWB 2ROQA 1NTMJ 3VMZA 2WSFH 4W7YA 3VMYA 2XKMA 2O01H 1W2EA 3LIDA 3VOPA 3AE6C 2FFDC 4N3YB 2EHSA 1VF5B 2N1TC 1AF8A 2E74C 1GDTA 3B5NA 1Q82Q 2OYIC 1RH5B 3KYQA 1NU1D 3HTKB 3NTEA 1HJ0A 5KLVK 2L6EA 2CQ8A 1WT6A 2Y0EA 4QMAA 3P8CD 4ZMDA 1KYOE 1IFDA 1Q2NA 2E5TA 5AW2B 2OYHA 2R5DA 3G26A 2QJPB 2YKPA 2W8ZA 2B89A 2WITA 3TDKA 1SQBD 2KSJA 2BUOA 5I4TG 3SWYA 3TGUG 2KOQA 3L73E 2E75D 3BVHA 1FR2A 1LTTC 2AXTE 2PP6A 1GMJA 5BU8B 5CHXA 3H1IE 1N7SB 3L72E 2O1JA 1FJPA 4GOEA 2QJKC 1E0HA 1SQVG 1EZVE 1SQXG 1FZCA 2W83C 3FX0A 2JJLA 1FU1A 3OAKA 2Z44A 4IOIH 1SQQG 2XT1A 3H0DA 1KILA 1ZRTE 1RE4C 2YNYA 2H8PD 1ZV8A 2AFDA 1QX8A 1KTMA 2RN0A 3ABVC 2MJZA 1Q86Q 1NTKJ 3P32A 2E75C 1GL2B 1UNKA 1NTME 2GDYA 5H2FE 1K04A 1NJIQ 3OA7A 1QL2A 2LXBA 3AE2C 2J58A 4IPYA 3EQ2A 3FGAD 4AQRD 2C0WA 2A45I 5APUA 1LTJA 4YXWH 2V4HA 1S72P 2XV5A 3L4FA 1M1JA 2KGEA 3K5BA 2MVVA 4H44B 3MGNA 1A8OA 1AYIA 4D6TG 2PNGA 1N73A 2RMZA 2D2CD 1H0TA 2KG6A 2KOOA 3FWLA 3KZIE 1S5LX 3CCEP 4U3FJ 3TNUB 2E5YA 4Y99C 2LR2A 3L71G 3G9RA 1KILB 4BPFA 2FADA 5KP7B 4HH2A 1CZQA 1VQ8P 3CXHE 3FWNA 1FOSE 1E5WA 1AVYA 2VLNA 3HE5A 3DS1A 3OW2O 1EIAA 4BWNA 2L0QA 5E79E 2D2CC 4BXLA 1AVOA 2O01N 3L35A 2CGQA 3WMM0 2IYPA 2N6YA 5TJHA 1VQLP 3MP7B 4ASVA 2FACA 3EJBA 3H1LJ 4OWFA 3G28A 1L4AA 1CI6B 3V4WA 2XZRA 4GKGA 1M1JB 2JKVA 2WSEH 1YYCA 3I56P 2DNWA 1PEOA 2AXCA 1NGMB 1PPJD 2FYUJ 3KPEA 1UJZA 1VF5D 2K3RA 3VMAA 1JY3N 1PP9G 1SQPG 3GZLA 2BQ1E 1FAVA 4OH8B 4GR2A 1T8ZA 2FHSC 5BVZA 3EFGA 4CA3A 3H1HJ 4CPGA 3H1ID 2ZVOB 3Q3DA 3JSVC 3S1KA 2AFEA 3D70A 2HODA 3H32B 1PGPA 2GUSA 3D6YA 1X3OA 3CCSP 3S9OA 1JMBA 1VQNP 4XA4A 2VLQA 4HJGH 1NTZK 5KLVG 1AQ5A 3GHGB 2GUVA 5EJDA 2XXMA 3WBHA 2WQYC 1LT1A 2MR7A 3WU2E 1NU1J 5AVQB 2W90A 3IF4A 2K92A 1VF5C 5KAIH 1T8KA 2QJYB 5APYA 4H0LB 1OVVA 2PEIA 3RG2A 1IMQA 5CCHA 2P10A 1N7SD 3MHVA 3HZQA 2Q9IA 4IFDK 1NHLA 2JQ4A 3LW5J 2KNCA 3CD6P 2H88C 1HGZA 2IPPA 1SQBJ 1L0LE 2P2UA 1FDIA 2B9BA 3VTPC 1JCDA 1E79H 1BCCE 2QM8A 1PEMA 1G1JA 1Y47A 1GXGA 3B4QA 2QJPC 3DS4A 2KWLA 2CWOA 4LGDE 3F5HA 2BEQD 1L2PA 2E1MA 3TGUD 1GL2D 5F2OA 2PRRA 1FDOA 1E6JP 3MIWA 2FBWC 3NTNA 2ZXEB 2E76D 1N7SC 2FYUE 2Z5IA 2VLOA 1IFJA 1JO5A 4XE5B 1FBMA 1T6AA 3U1AA 2EIAA 3Q5PA 3CE7A 1JOCA 2OTKE 1SQQD 2Y0DA 4WBAA 1DEBA 2RH0A 3CXHD 2MKVA 4COCA 4WWIA 4H44D 1AA0A 5CMZA 4EI2A 3Q5SA 1H88A 3AE7C 5B5EH 2A06G 3C9IA 3V2QA 1GL2C 3KXDA 5APVA 4IL6H 2P58A 2NZ2A 4L73A 2E76C 1NU1E 2N50A 1IZNB 1H89A 1N7LA 1KYOH 2MVUA 3CPWO 2HPCB 3HE4B 1BE3E 2ZFCA 4UB6H 2YKOA 4UB8H 4XFJA 3GKLC 1HUCA 2Q3IA 1IFIA 2L5GB 3CMAP 1FE6A 3CI9A 3FXEA 2JBGA 1SQBE 4H44C 1SFCA 1L0NG 4PV1B 1QEXA 2IFNA 1GXHA 1KC8Q 2YMKA 1URQA 3L71D 2L4BA 2MY5A 2FAEA 3W68A 2WT7A 3A0BE 3EJDA 1JEKA 2KUBA 2POHA 1LT9B 2NO8A 3V5BA 3BASA 2BCCE 4IFMA 1NTKK 2BEZF 3RK3B 2V7QH 5CBNA 4C7NA 1H8AA 5AW8B 2W6AA 1JM0A 2YXQB 1J2JB 3JCUH 3AE5C 5H2FH 2EHTA 3C1LA 1LTGC 2Y9YA 3GF3A 3EWKA 2L91A 3CCUP 2WPQA 1KB9D 1W5CE 3CXHI 1R8EA 1IUQA 1BGYG 2K9JA 3L73J 4IZ6A 2VLPA 2IBZE 3PP5A 3EFFK 3H1IJ 1PP9D 1SQPD 2K93A 3CWBG 2YXRB 3L72J 1RY3A 5TISE 2FVEA 3RBXA 1JY2P 1NTZG 1SP4A 5AW7B 1NQ4A 1QVGO 1KQLA 3L70G 4MRTC 1KFNA 2WT7B 2E43A 2IZ0A 1VQ6P 1VQKP 1RE3C 1IC2A 1GD2E 2P67A 2GZGA 1FZBA 5KLVD 2KODA 3GHGC 1YBKA 1M1KQ 2AVAA 2QJYC 1OVRA 1J1EB 2Z46A 5F2NA 2KS1A 1D7MA 2Q5UA 4U7JA 1EZVG 1RNIA 4NPEA 4EOTA 2QE7H 3AEFC 2DGYA 1HBWA 3KQGA 2YO3A 1MZ8A 1HJBA 5KJ7A 3TGUJ 1BE3D 1VQ4P 1Q81Q 1PGJA 3E7KA 3HUSA 3G0VA 3CCVP 3NMDA 5HVCA 1NTMG 3P8MC 2FQ1A 1PPJE 2ZYGA 3B5IA 2W6BA 2JYLA 2ZYAA 2K9YA 3CCMP 2KG8A 1YTZI 1KB9I 2JO0A 3CC7P 1BDDA 1BDCA 2Y0CA 5CJ0A 4JYCA 5KP8B 3M0DA 3VP8A 3U43A 5GTIE 1PGOA 2JYGA 5C39A 1S9KD 4PWVB 2I1JA 3HD7A 1YIJP 2NPSA 2GA1A 3D6ZA 3VP9A 2AF8A 1NKNA 2BCCD 4AUWA 2N9YB 2HYNA 4U0DA 1RF1A 3BCCG 1BSNA 1JNMA 5HGLA 4DG9A 2A06D 1OMIA 5CCGD 2KS1B 1LTIC 2XNXA 3B5NB 2N5IA 1L0IA 1QLED 2WPTA 2XU6A 3DTJA 1YJWP 2M5RA 2I8DA 3S4RA 4YTPC 2K5XA 3SSUA 5B66E 1NYHA 1K73Q 3H1JG 4AYCA 4H13B 4I6MC 3PRJA 4WY4A 4TLFA 5M1BA 1OW7A 2WSSH 2OYHB 3RK3D 2LKMA 1KMIZ 2N9BA 5HV8A 2KK7A 1KQFB 2IBZD 3MGEA 4IL6X 2IFMA 1NKZB 3TGUE 3L71J 5CCGC 1EXIA 2XNDH 1HGVA 1NTKG 3I5CA 1EMVA 3ZDMA 3CL3D 3HD7B 2FVAA 1SQVE 2K0YA 1FZCB 2CPBA 1LT9C 1SQXE 1KV4A 3H1KD 4K35A 1SQQE 5GTHH 1L0NK 3RK3C 4B86A 2A45H 3AE9C 1K8AQ 1AJYA 3MUDA 1FZGA 1P84E 2FYNB 2Q3EA 3RK2D 1L0LJ 2PEKA 2LKIA 1DEEG 1G2CA 3KDPB 4TT3H 1BCCJ 2WPRA 2QA4P 4PJ0H 4OGQB 3LRYA 2PEJA 4H2YC 1A43A 5CZDB 1RF0C 1FOSF 4WY4B 1JY3P 4U3FG 1R5LA 1N86A 3T97A 1LTJB 2M8PA 3V2PA 4Z1MH 1USDA 1MFZA 1LWUC 1LNQA 1SS1A 3LW5H 3LIEA 2FFDA 1IK7A 2N1TA 2GDWA 3CWBD 3CMEP 2OYIA 2JEEA 1NTZD 3BRTB 1VQ5P 1N73B 1H0TB 4PH0A 3RK2C 2Q6QA 3L70D 2JWDA 3G3ZA 5KLVJ 1JTHA 4GR6A 2ZXXA 4L74A 1M8OB 5CBOA 3L74G 1OVUA 3L71E 1YI2P 3AEDC 2K94A 2IBZI 3H1LG 1ACPA 4I1LA 3Q2YA 3G29A 2CNRA 3IR9A 4MN4C 1ZR4A 4DT0A 2PFXA 1A02J 3L75G 5AVRB 3SFEC 3HRNA 2VRSA 5F2KA 3USSA 1ZR2A 1GU5A 3HE5B 1ZOYC 3AE1C 4ZNCA 2FYUG 2EG5A 3AEEC 1LTSC 3AEGC 1R5SA 3CXCO 4WB4A 2KB7P 1BE3J 2MR8A 1JCCA 1DD4A 2JU2A 3H1HG 2AEMA 3CX5D 1KB9E 1L4AB 3Q5RA 2A45G 2UWJE 3IAOA 1DNYA 3R2PA 1RE4A 4LC1A 3RL0B 2L9FA 1DH3A 2JU1A 3B4SA 4RESB 3E1IA 4O9BA 3MZWB 2XV6A 4I2LC 3Q1MA 3B5ND 3GF7A 1UIIA 1QGKB 1NU1G 5TISH 1PP9E 1SQPE 2J59M 5APTA 3TSIA 1JTHB 3AE3C 5CJ4A 2FXPA 4KHXA 1AUMA 5DJUB 1GPJA 3AE4C 1QL1A 2ITAA 2BCCJ 4H13D 4JPZB 2HODB 3P05A 1SQVD 2O3JA 1NTMK 1SQXD 1YHQP 3II6A 2QM7A 1K9MQ 5KLVE 1VKUA 4C7RA 4NEOA 4PD4D 3BCCD 4BPHA 5AW5B 1SVFA 1M6NA 2KG9A 1ZN5A 3B5NC 1P84D 2GZFA 4A7PA 3IN6A 1S3JA 1D1DA 3OJAB 3G1IA 1UIXA 2KNCB 3H1JD 1OXZA 4H13C 5DCKA 3G4SP 1X0TA 1RQVA 3MTUE 5APSA 3O6QA 4U0BA 1GK4A 1KILD 2OYHC 4DZOA 5L8RJ 2PGDA 4RKUJ 2N5HA 2DW3A 2YMYA 2OARA 3A3YB 1RHZB 2SPZA 3L36A 5DJTB 2I1KA 4D6TD 1NTKD 3ITKA 1ZLLA 3CX5I 4OGQD 1HTLC 1CSBA 2AXTH 3H1KJ 2KI7B 3HD7C 3M91A 1FS0E 2ONTA 1NVOA 5KP6B 1FZCC 2C9NY 1VPCA 5AW6B 1S9KE 3C8VA 1KILC 1YTZT 5KKZB 2PEOA 4GIFA 2R32A 2WZ7A 3KHUA 5AVYB 2XZ0D 2K0XA 1J1DB 2YKQA 2JGPA 2NRGA 3VMXA 4R4LA 2A06E 2QG4A 5HGMA 1BXIA 1MUUA 2KZJA 1BAJA 1EC5A 3H6PA 1GW4A 1U7MA 2K88A 4OGQC 1OW8A 1PV3A 5B66H 1GTWA 4WY4C 4XFXA 4PH1A 3F89A 1IO4A 1LTJC 1K30A 3DS2A 3RL0g 3DPHA 4PD4I 2M3EA 4BRYA 3M1MA 5HGNA 2QNWA 3AEBC 2QIWA 2AEFA 1M74A 1M1JC 1P84I 1DD3A 2H43A 3RK3E 1VQPP 3L70J 2OTLP 1OZHA 3AEAC 1SFCB 1JUNA 4H0LD 1N73C 4U0EA 1L0NE 2HFED 1IFNA 3HTKA 2CG5B 3TK1A 2M5AA 5APQA 2H7HA 3KZIH 3L74D 1URQB 4W80A 1L4AD 1QVFO 4KJMA 4ZKUA 1FDMA 3B8EB 2GYKA 4JQ0D 2KGDA 4N78D 2LL8A 3H1LD 3GW6A 3VN0A 5EW5E 1VL2A 3RL0D 5AVZB 2KGAA 3H1KE 1SLQA 3L75D 1AV1A 2YIUB 3CXHH 4C7NB 3L73G 3NXSA 1L0LK 1ZW0A 1IK9A 2B88A 4H0LC 4EIJA 3H1IG 5APXA 1N7SA 3UIAA 3L72G 2JO1A 1K05A 5E79H 2HG5D 3H1HD 2GZJA 2CPSA 3G21A 4BRYB 2BHVA 1L4AC 4HKZH 2YO2A 2JAZA 4R0MA 5KLIB 1F80D 4F37A 1FZEA 1Z6MA 5JPAA 2FKWB 2K9JB 3RL0C 1BGYE 1KN7A 2FYUK 5B5EE 3GG2A 4QNBA 3E2DA 4IL6E 1KQGB 1GL2A 4Y28J 3CWBE 2M5AB 2LF4A 5CCHD 3E1RA 1EXJA 2XDJA 1YJ9P 1NTZE 4XFYA 1SQVJ 1RQUA 2LTEA 1SQXJ 2ERHA 1YITP 4RO0A 3L70E 1IJDB 2KLVA 1SQQJ 4UB6E 1VQMP 1S5LE 4UB8E 2K1AA 2JR8A 2PEMA 3BCCJ 2KP8A 1S4XA 1M57D 1GK6A 2PAJA 4GOFA 2BASA 3V2NA 1MFTA 2GDXA 3DS5A 4XROA 1NU1K 1NH4A 2OQQA 1OIPA 4L76A 1DV5A 1Y8AA 2R3CA 3WU2H 1PGQA 1N8RQ 3H1JJ 4XRQA 1T3UA 2LXCB 3PLNA 1L0HA 5CCHC 2XZ1C 4PV1D 4U0CA 2WSFJ 3TNUA 2G8YA 3VYIA 2O01J 1SQBK 1MKMA 1W2BO 3I55P 2K2QA 5AW9B 3CCRP 2OYOA 3WUVA 1KB9H 1GW3A 2R44A 5AVSB 2LOLA 4C46A 5AW3B 3NY7B 3CX5E 3RGUA 2JP3A 2HLOA 3SFDC 4HB1A 4D6TJ 1MV8A 2E42A 3HUSB 4R4MA 3CC4P 2O1KA 3JCUE 2JB0A 2IDBA 2WTYA 1VQOP 1Q90D 1M56D 2E76B 1CEIA 1OR5A 1GZLA 1GU4A 1ZNVA 1L0ND 3SWKA 4JBZA 4PV1C 2WMMA 7CEIA 1FC2C 4JF7A 1FZFA 1YQ3C 3A0HE 1CI6A 2FXOA 1HH0A 2KORA 2C9LY 3NFQA 2NPSB 1XTGB 2ZJSE 5KKZC 2LIWA 1HY8A 2FQ0A 5KAFE 2M3BA 1RF1B 1SFCD 2LMLA 1J1DC 4PD4E 3BCCE 4QKOA 4K3AA 3PHLA 4I7ZB 1EQ7A 1NWQA 5AVVB 3SWFA 3CCLP 1URQD 2KW2A 3RG6C 3H32A 1RE3A 2QVAA 3N4XA 2PENA 3H1JE 3DS0A 1KORA 3L37A 4H2WC 2WWWA 2MD9A 3GHGA 2W6JH 3G6EP 1OX3A 3LMOA 1KILE 3U1CA 1PP9J 1SQPJ 1N2DC 2N6ZA 1BGYD 3M9HA 5APWA 1U57A 2B87A 1RO0A 1SFCC 2J5UA 1FJKA 3L74J 3GJNA 1KZUB 1X9VA 2WPSA 1LP1A 1KLPA 1IFMA 4COPA 4D6TE 1NTKE 2WVRA 2FY8A 1HVVA 2OGUA 1KYOD 2IYOA 3M9QA 2Y9ZA 1L0LG 2CK3H 1URQC 1WMKA 3L75J 1BCCG 3GMAA 1U7JA 3A7OA 3WUTA 3A0BH 2FQ2A 4JYBA 3RBZA 2YIUC 1M90Q 4UHPB 3L73D 4DOJA 2HR3A 4GODA 4GT1A 1AQTA 2GM4A 1ZP0C 4U0AA 3FXDA 3L72D 1T2KD 1PEUA 2KZIA 2P1JA 3CCJP 1G2CB 1J1EC 1DX7A 3GLMA 1EZVD 2ZT9B 1JMMA 4KT0J 1EDJA 4ASWA 1VQ9P 3T97B 1ZRTD 1M6EX 4U3FE 5KLIC 1HWTC 1HQBA 2K0DX 4U0FA 1JJ2O 2KOGA 1DIPA 1X79B 5BS2A 2B87B 1IFPA 4YXDC 2FFDB 1LP1B 2N1TB 1NTMD 2WPVB 2E74B 3P7KA 1JY2O 1OFCX 2OYIB 1AFOA 1USEA 2M0BA 2WSEJ 3BRVB 3CC2P 3Q20A 2MF4A 3M9BA 2M8RA 1T2KC 2EFJA 3DS3A 3WUUA 3G1GA 2PY8A 3H47A 2P7JA 4ZKPA 5KJ7D 3L74E 1BE3G 2HPCA 1KQSO 2IZ1A 4BPGA 3HE4A 2R5BA 5K5GB 1KD1Q 1T3JA 4N78E 3H1LE 3M0AA 1SQBG 1IMPA 2FVFA 1X8YA 3L75E 5AVUB 2JDIH 1VDFA 1NAYA 1Y9BA 1KYOI 5CCGA 4LLHA 1PIXA
chains in the Genus database with same CATH topology
3DS4A 4U0BA 2CWOA 2OTLP 4XFZA 1VQ6P 3G28A 1VQKP 1YITP 1NJIQ 2E1MA 4U0EA 4U0DA 2PEKA 1KC8Q 5HGOA 1VQMP 4IPYA 1Q82Q 5F2OA 5HGLA 2KODA 2PEMA 3I56P 4U0AA 2QA4P 1PEOA 1PEUA 3LRYA 2PEJA 1E6JP 3CCJP 1A43A 2OARA 3NTEA 1YJNP 1M1KQ 2L6EA 1PEQA 3DS5A 4XROA 1VQ9P 1QVFO 3DTJA 1YJWP 1S72P 2BQ1E 2M8PA 4GR2A 2XV6A 1ZMBA 1M6EX 1K73Q 2EIAA 3CCLP 2Z46A 1EOQA 5F2NA 1N8RQ 4XRQA 3RG6C 1A8OA 2ONTA 3G26A 4U0FA 1JJ2O 1RNIA 2Z45A 2PENA 2P9XA 2OTJP 4U0CA 3CMEP 1AUMA 5BS2A 3DS0A 2DGYA 4COCA 2BUOA 2QEXP 5I4TG 3H4EA 1VQ5P 2PEOA 3G6EP 3CCSP 3CCEP 1W2BO 4PH0A 3P05A 3I55P 3G71P 1VQNP 3MGEA 3CCRP 4M0IA 1VQ4P 2M8NA 3CCUP 2XXMA 3WBHA 1YHQP 1Q81Q 3CC2P 2M8LA 4GR6A 3Q20A 1K9MQ 1Q7YQ 3G0VA 1QRJA 2EFJA 1RO0A 3DS3A 3CCVP 3CCQP 3G1GA 3HYBA 5HGMA 2PY8A 3H47A 1YI2P 1IUQA 3B5IA 1BAJA 2JYLA 3G21A 1VQ8P 2BHVA 2PEIA 1KQSO 3CCMP 3CC4P 4COPA 3G29A 1M6NA 1VQOP 3CPWO 2Z44A 3HZQA 4XFXA 5JPAA 2JO0A 4PH1A 1KD1Q 2PEQA 4WYMA 3CC7P 1D1DA 2XT1A 3H0DA 1VQ7P 1K30A 3DS1A 3DS2A 5F2KA 3OW2O 1EIAA 3CD6P 3DPHA 1RO2A 3G1IA 4QNBA 3E2DA 3M1MA 5HGNA 2JYGA 2EG5A 3CMAP 5BS1A 1Q86Q 2LF4A 1QVGO 1M74A 1PEMA 1YIJP 3VRLC 1VQLP 5DCKA 3G4SP 1YJ9P 1VQPP 1K8AQ 4XFYA 3CXCO 1M90Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E P;  1VQ9 P;  1QVF O;  3CCS P;  1YJW P;  1S72 P;  1VQO P;  3CPW O;  3CCE P;  2OTL P;  1W2B O;  3I55 P;  3G71 P;  1VQN P;  1VQ6 P;  1KD1 Q;  1VQK P;  3CC7 P;  3CCR P;  1YIT P;  1NJI Q;  1VQ4 P;  1K73 Q;  1VQ7 P;  3CCU P;  3CCL P;  3OW2 O;  1YHQ P;  1Q81 Q;  1KC8 Q;  3CC2 P;  3CD6 P;  3CC4 P;  1VQM P;  1N8R Q;  1K9M Q;  1Q82 Q;  1Q7Y Q;  3CCV P;  3I56 P;  2QA4 P;  1JJ2 O;  3CMA P;  3CCQ P;  2OTJ P;  1YI2 P;  3CCJ P;  1Q86 Q;  1YJN P;  1VQ8 P;  3CME P;  1QVG O;  1M1K Q;  1YIJ P;  1VQL P;  3G4S P;  1YJ9 P;  2QEX P;  1VQP P;  1K8A Q;  1KQS O;  3CCM P;  1VQ5 P;  3CXC O;  1M90 Q; 
#chains in the Genus database with same CATH topology
 4XFZ A;  2GZI A;  2FYZ A;  2Z5H A;  3H25 A;  1ZME C;  5HGO A;  2VSQ A;  4DCK A;  2QJK B;  2X2B A;  1S1C X;  3HD7 D;  1NOH A;  2NPS D;  1LT9 A;  3H1H E;  5KJ7 C;  5GTH E;  1WRG A;  1YJN P;  3A2A A;  2KSE A;  2BCC G;  3TF5 A;  1PEQ A;  3JC2 2;  3D71 A;  3W67 A;  5AVT B;  3HUS C;  1VHN A;  1OWA A;  1L0N J;  3QH9 A;  1A02 F;  1CW5 A;  1EOQ A;  3R4Y A;  5AW0 B;  1SQV K;  1EZV I;  1SQX K;  2ZVN B;  1KFM A;  2E75 B;  1X22 A;  1NO4 A;  2P9X A;  4PJ0 E;  2QRX A;  1LTB C;  2L22 A;  1SQQ K;  3V4Q A;  2LIU A;  3H4E A;  4EDF A;  3MD0 A;  1G1I A;  1NAF A;  5AVW B;  3P8C E;  3M0D C;  1RF0 A;  1TU3 F;  3GZM A;  2KYV A;  4GDO A;  5KTB A;  3TYY A;  1S5L H;  2M8N A;  1LJ2 A;  4WY4 D;  2FXM A;  4EYY Q;  4NPF X;  1Z56 A;  5GTI H;  3IFM A;  2K37 A;  1Q7Y Q;  2NPS C;  2KGC A;  4N6J A;  3CCQ P;  2KR5 A;  1LWU A;  2QSI A;  2IBZ G;  2R3S A;  2ZAE B;  1RF1 C;  2Q7C A;  4WVZ A;  2KOP A;  1JB0 J;  4WYM A;  3QWO C;  4HKG A;  2Z4E A;  1RO2 A;  1LTA C;  1OW6 A;  4I7Z C;  2WSC H;  2FYN C;  5BS1 A;  1EDI A;  4RJT A;  3CLQ A;  3VRL C;  4Y99 B;  3PJS K;  1BGY J;  1FZA A;  3H1K G;  1S2E A;  1ZXG A;  3AEC C;  2KIK A;  1XTC C;  2IX7 C;  3CX5 H;  3O6Q B;  4U3F D;  2H89 C;  4H2X C;  5AW1 B;  3CWB J;  3PTZ A;  1MZ9 A;  3N7N A;  2G3A A;  1NTZ J;  5KAI E;  3V2R A;  3A5T A;  4OVN F;  2Q1K A;  3PH0 A;  2D2C B;  1ZMB A;  4HYT B;  2W27 A;  2ZT9 D;  3U59 A;  4W7Z A;  2ZYD A;  3B71 A;  2KXP B;  1L0L D;  5AVX B;  4YPC A;  2JWA A;  1BSH A;  4DJG A;  2Z45 A;  1PL5 A;  2OTJ P;  1BCC D;  3A0H H;  2KOS A;  1M7L A;  1LWU B;  2RKL A;  3O8Z A;  2QEX P;  3EJE A;  3G71 P;  2LPK A;  4M3L A;  1EDL A;  4M0I A;  1PPJ G;  2KLU A;  5KAF H;  2M8L A;  4PXH B;  3V6I A;  2WSC J;  1PZQ A;  3AE8 C;  2N1T D;  2E74 D;  1QRJ A;  1HF9 A;  3MUD C;  3HYB A;  4PD4 H;  4IFF A;  3RK2 B;  4L75 A;  1PFI A;  3M06 A;  2C0X A;  2FYU D;  1P84 H;  4NPD A;  2N98 A;  5BU5 A;  2PEQ A;  2AEJ A;  2ZT9 C;  1LGH B;  2V7Q J;  1VQ7 P;  1JY3 O;  3BAT A;  5AW4 B;  1YQ4 C;  1EDK A;  1SQP K;  2GZE A;  1JY2 N;  5EFW B;  2ROQ A;  1NTM J;  3VMZ A;  2WSF H;  4W7Y A;  3VMY A;  2XKM A;  2O01 H;  1W2E A;  3LID A;  3VOP A;  3AE6 C;  2FFD C;  4N3Y B;  2EHS A;  1VF5 B;  2N1T C;  1AF8 A;  2E74 C;  1GDT A;  3B5N A;  1Q82 Q;  2OYI C;  1RH5 B;  3KYQ A;  1NU1 D;  3HTK B;  3NTE A;  1HJ0 A;  5KLV K;  2L6E A;  2CQ8 A;  1WT6 A;  2Y0E A;  4QMA A;  3P8C D;  4ZMD A;  1KYO E;  1IFD A;  1Q2N A;  2E5T A;  5AW2 B;  2OYH A;  2R5D A;  3G26 A;  2QJP B;  2YKP A;  2W8Z A;  2B89 A;  2WIT A;  3TDK A;  1SQB D;  2KSJ A;  2BUO A;  5I4T G;  3SWY A;  3TGU G;  2KOQ A;  3L73 E;  2E75 D;  3BVH A;  1FR2 A;  1LTT C;  2AXT E;  2PP6 A;  1GMJ A;  5BU8 B;  5CHX A;  3H1I E;  1N7S B;  3L72 E;  2O1J A;  1FJP A;  4GOE A;  2QJK C;  1E0H A;  1SQV G;  1EZV E;  1SQX G;  1FZC A;  2W83 C;  3FX0 A;  2JJL A;  1FU1 A;  3OAK A;  2Z44 A;  4IOI H;  1SQQ G;  2XT1 A;  3H0D A;  1KIL A;  1ZRT E;  1RE4 C;  2YNY A;  2H8P D;  1ZV8 A;  2AFD A;  1QX8 A;  1KTM A;  2RN0 A;  3ABV C;  2MJZ A;  1Q86 Q;  1NTK J;  3P32 A;  2E75 C;  1GL2 B;  1UNK A;  1NTM E;  2GDY A;  5H2F E;  1K04 A;  1NJI Q;  3OA7 A;  1QL2 A;  2LXB A;  3AE2 C;  2J58 A;  4IPY A;  3EQ2 A;  3FGA D;  4AQR D;  2C0W A;  2A45 I;  5APU A;  1LTJ A;  4YXW H;  2V4H A;  1S72 P;  2XV5 A;  3L4F A;  1M1J A;  2KGE A;  3K5B A;  2MVV A;  4H44 B;  3MGN A;  1A8O A;  1AYI A;  4D6T G;  2PNG A;  1N73 A;  2RMZ A;  2D2C D;  1H0T A;  2KG6 A;  2KOO A;  3FWL A;  3KZI E;  1S5L X;  3CCE P;  4U3F J;  3TNU B;  2E5Y A;  4Y99 C;  2LR2 A;  3L71 G;  3G9R A;  1KIL B;  4BPF A;  2FAD A;  5KP7 B;  4HH2 A;  1CZQ A;  1VQ8 P;  3CXH E;  3FWN A;  1FOS E;  1E5W A;  1AVY A;  2VLN A;  3HE5 A;  3DS1 A;  3OW2 O;  1EIA A;  4BWN A;  2L0Q A;  5E79 E;  2D2C C;  4BXL A;  1AVO A;  2O01 N;  3L35 A;  2CGQ A;  3WMM 0;  2IYP A;  2N6Y A;  5TJH A;  1VQL P;  3MP7 B;  4ASV A;  2FAC A;  3EJB A;  3H1L J;  4OWF A;  3G28 A;  1L4A A;  1CI6 B;  3V4W A;  2XZR A;  4GKG A;  1M1J B;  2JKV A;  2WSE H;  1YYC A;  3I56 P;  2DNW A;  1PEO A;  2AXC A;  1NGM B;  1PPJ D;  2FYU J;  3KPE A;  1UJZ A;  1VF5 D;  2K3R A;  3VMA A;  1JY3 N;  1PP9 G;  1SQP G;  3GZL A;  2BQ1 E;  1FAV A;  4OH8 B;  4GR2 A;  1T8Z A;  2FHS C;  5BVZ A;  3EFG A;  4CA3 A;  3H1H J;  4CPG A;  3H1I D;  2ZVO B;  3Q3D A;  3JSV C;  3S1K A;  2AFE A;  3D70 A;  2HOD A;  3H32 B;  1PGP A;  2GUS A;  3D6Y A;  1X3O A;  3CCS P;  3S9O A;  1JMB A;  1VQN P;  4XA4 A;  2VLQ A;  4HJG H;  1NTZ K;  5KLV G;  1AQ5 A;  3GHG B;  2GUV A;  5EJD A;  2XXM A;  3WBH A;  2WQY C;  1LT1 A;  2MR7 A;  3WU2 E;  1NU1 J;  5AVQ B;  2W90 A;  3IF4 A;  2K92 A;  1VF5 C;  5KAI H;  1T8K A;  2QJY B;  5APY A;  4H0L B;  1OVV A;  2PEI A;  3RG2 A;  1IMQ A;  5CCH A;  2P10 A;  1N7S D;  3MHV A;  3HZQ A;  2Q9I A;  4IFD K;  1NHL A;  2JQ4 A;  3LW5 J;  2KNC A;  3CD6 P;  2H88 C;  1HGZ A;  2IPP A;  1SQB J;  1L0L E;  2P2U A;  1FDI A;  2B9B A;  3VTP C;  1JCD A;  1E79 H;  1BCC E;  2QM8 A;  1PEM A;  1G1J A;  1Y47 A;  1GXG A;  3B4Q A;  2QJP C;  3DS4 A;  2KWL A;  2CWO A;  4LGD E;  3F5H A;  2BEQ D;  1L2P A;  2E1M A;  3TGU D;  1GL2 D;  5F2O A;  2PRR A;  1FDO A;  1E6J P;  3MIW A;  2FBW C;  3NTN A;  2ZXE B;  2E76 D;  1N7S C;  2FYU E;  2Z5I A;  2VLO A;  1IFJ A;  1JO5 A;  4XE5 B;  1FBM A;  1T6A A;  3U1A A;  2EIA A;  3Q5P A;  3CE7 A;  1JOC A;  2OTK E;  1SQQ D;  2Y0D A;  4WBA A;  1DEB A;  2RH0 A;  3CXH D;  2MKV A;  4COC A;  4WWI A;  4H44 D;  1AA0 A;  5CMZ A;  4EI2 A;  3Q5S A;  1H88 A;  3AE7 C;  5B5E H;  2A06 G;  3C9I A;  3V2Q A;  1GL2 C;  3KXD A;  5APV A;  4IL6 H;  2P58 A;  2NZ2 A;  4L73 A;  2E76 C;  1NU1 E;  2N50 A;  1IZN B;  1H89 A;  1N7L A;  1KYO H;  2MVU A;  3CPW O;  2HPC B;  3HE4 B;  1BE3 E;  2ZFC A;  4UB6 H;  2YKO A;  4UB8 H;  4XFJ A;  3GKL C;  1HUC A;  2Q3I A;  1IFI A;  2L5G B;  3CMA P;  1FE6 A;  3CI9 A;  3FXE A;  2JBG A;  1SQB E;  4H44 C;  1SFC A;  1L0N G;  4PV1 B;  1QEX A;  2IFN A;  1GXH A;  1KC8 Q;  2YMK A;  1URQ A;  3L71 D;  2L4B A;  2MY5 A;  2FAE A;  3W68 A;  2WT7 A;  3A0B E;  3EJD A;  1JEK A;  2KUB A;  2POH A;  1LT9 B;  2NO8 A;  3V5B A;  3BAS A;  2BCC E;  4IFM A;  1NTK K;  2BEZ F;  3RK3 B;  2V7Q H;  5CBN A;  4C7N A;  1H8A A;  5AW8 B;  2W6A A;  1JM0 A;  2YXQ B;  1J2J B;  3JCU H;  3AE5 C;  5H2F H;  2EHT A;  3C1L A;  1LTG C;  2Y9Y A;  3GF3 A;  3EWK A;  2L91 A;  3CCU P;  2WPQ A;  1KB9 D;  1W5C E;  3CXH I;  1R8E A;  1IUQ A;  1BGY G;  2K9J A;  3L73 J;  4IZ6 A;  2VLP A;  2IBZ E;  3PP5 A;  3EFF K;  3H1I J;  1PP9 D;  1SQP D;  2K93 A;  3CWB G;  2YXR B;  3L72 J;  1RY3 A;  5TIS E;  2FVE A;  3RBX A;  1JY2 P;  1NTZ G;  1SP4 A;  5AW7 B;  1NQ4 A;  1QVG O;  1KQL A;  3L70 G;  4MRT C;  1KFN A;  2WT7 B;  2E43 A;  2IZ0 A;  1VQ6 P;  1VQK P;  1RE3 C;  1IC2 A;  1GD2 E;  2P67 A;  2GZG A;  1FZB A;  5KLV D;  2KOD A;  3GHG C;  1YBK A;  1M1K Q;  2AVA A;  2QJY C;  1OVR A;  1J1E B;  2Z46 A;  5F2N A;  2KS1 A;  1D7M A;  2Q5U A;  4U7J A;  1EZV G;  1RNI A;  4NPE A;  4EOT A;  2QE7 H;  3AEF C;  2DGY A;  1HBW A;  3KQG A;  2YO3 A;  1MZ8 A;  1HJB A;  5KJ7 A;  3TGU J;  1BE3 D;  1VQ4 P;  1Q81 Q;  1PGJ A;  3E7K A;  3HUS A;  3G0V A;  3CCV P;  3NMD A;  5HVC A;  1NTM G;  3P8M C;  2FQ1 A;  1PPJ E;  2ZYG A;  3B5I A;  2W6B A;  2JYL A;  2ZYA A;  2K9Y A;  3CCM P;  2KG8 A;  1YTZ I;  1KB9 I;  2JO0 A;  3CC7 P;  1BDD A;  1BDC A;  2Y0C A;  5CJ0 A;  4JYC A;  5KP8 B;  3M0D A;  3VP8 A;  3U43 A;  5GTI E;  1PGO A;  2JYG A;  5C39 A;  1S9K D;  4PWV B;  2I1J A;  3HD7 A;  1YIJ P;  2NPS A;  2GA1 A;  3D6Z A;  3VP9 A;  2AF8 A;  1NKN A;  2BCC D;  4AUW A;  2N9Y B;  2HYN A;  4U0D A;  1RF1 A;  3BCC G;  1BSN A;  1JNM A;  5HGL A;  4DG9 A;  2A06 D;  1OMI A;  5CCG D;  2KS1 B;  1LTI C;  2XNX A;  3B5N B;  2N5I A;  1L0I A;  1QLE D;  2WPT A;  2XU6 A;  3DTJ A;  1YJW P;  2M5R A;  2I8D A;  3S4R A;  4YTP C;  2K5X A;  3SSU A;  5B66 E;  1NYH A;  1K73 Q;  3H1J G;  4AYC A;  4H13 B;  4I6M C;  3PRJ A;  4WY4 A;  4TLF A;  5M1B A;  1OW7 A;  2WSS H;  2OYH B;  3RK3 D;  2LKM A;  1KMI Z;  2N9B A;  5HV8 A;  2KK7 A;  1KQF B;  2IBZ D;  3MGE A;  4IL6 X;  2IFM A;  1NKZ B;  3TGU E;  3L71 J;  5CCG C;  1EXI A;  2XND H;  1HGV A;  1NTK G;  3I5C A;  1EMV A;  3ZDM A;  3CL3 D;  3HD7 B;  2FVA A;  1SQV E;  2K0Y A;  1FZC B;  2CPB A;  1LT9 C;  1SQX E;  1KV4 A;  3H1K D;  4K35 A;  1SQQ E;  5GTH H;  1L0N K;  3RK3 C;  4B86 A;  2A45 H;  3AE9 C;  1K8A Q;  1AJY A;  3MUD A;  1FZG A;  1P84 E;  2FYN B;  2Q3E A;  3RK2 D;  1L0L J;  2PEK A;  2LKI A;  1DEE G;  1G2C A;  3KDP B;  4TT3 H;  1BCC J;  2WPR A;  2QA4 P;  4PJ0 H;  4OGQ B;  3LRY A;  2PEJ A;  4H2Y C;  1A43 A;  5CZD B;  1RF0 C;  1FOS F;  4WY4 B;  1JY3 P;  4U3F G;  1R5L A;  1N86 A;  3T97 A;  1LTJ B;  2M8P A;  3V2P A;  4Z1M H;  1USD A;  1MFZ A;  1LWU C;  1LNQ A;  1SS1 A;  3LW5 H;  3LIE A;  2FFD A;  1IK7 A;  2N1T A;  2GDW A;  3CWB D;  3CME P;  2OYI A;  2JEE A;  1NTZ D;  3BRT B;  1VQ5 P;  1N73 B;  1H0T B;  4PH0 A;  3RK2 C;  2Q6Q A;  3L70 D;  2JWD A;  3G3Z A;  5KLV J;  1JTH A;  4GR6 A;  2ZXX A;  4L74 A;  1M8O B;  5CBO A;  3L74 G;  1OVU A;  3L71 E;  1YI2 P;  3AED C;  2K94 A;  2IBZ I;  3H1L G;  1ACP A;  4I1L A;  3Q2Y A;  3G29 A;  2CNR A;  3IR9 A;  4MN4 C;  1ZR4 A;  4DT0 A;  2PFX A;  1A02 J;  3L75 G;  5AVR B;  3SFE C;  3HRN A;  2VRS A;  5F2K A;  3USS A;  1ZR2 A;  1GU5 A;  3HE5 B;  1ZOY C;  3AE1 C;  4ZNC A;  2FYU G;  2EG5 A;  3AEE C;  1LTS C;  3AEG C;  1R5S A;  3CXC O;  4WB4 A;  2KB7 P;  1BE3 J;  2MR8 A;  1JCC A;  1DD4 A;  2JU2 A;  3H1H G;  2AEM A;  3CX5 D;  1KB9 E;  1L4A B;  3Q5R A;  2A45 G;  2UWJ E;  3IAO A;  1DNY A;  3R2P A;  1RE4 A;  4LC1 A;  3RL0 B;  2L9F A;  1DH3 A;  2JU1 A;  3B4S A;  4RES B;  3E1I A;  4O9B A;  3MZW B;  2XV6 A;  4I2L C;  3Q1M A;  3B5N D;  3GF7 A;  1UII A;  1QGK B;  1NU1 G;  5TIS H;  1PP9 E;  1SQP E;  2J59 M;  5APT A;  3TSI A;  1JTH B;  3AE3 C;  5CJ4 A;  2FXP A;  4KHX A;  1AUM A;  5DJU B;  1GPJ A;  3AE4 C;  1QL1 A;  2ITA A;  2BCC J;  4H13 D;  4JPZ B;  2HOD B;  3P05 A;  1SQV D;  2O3J A;  1NTM K;  1SQX D;  1YHQ P;  3II6 A;  2QM7 A;  1K9M Q;  5KLV E;  1VKU A;  4C7R A;  4NEO A;  4PD4 D;  3BCC D;  4BPH A;  5AW5 B;  1SVF A;  1M6N A;  2KG9 A;  1ZN5 A;  3B5N C;  1P84 D;  2GZF A;  4A7P A;  3IN6 A;  1S3J A;  1D1D A;  3OJA B;  3G1I A;  1UIX A;  2KNC B;  3H1J D;  1OXZ A;  4H13 C;  5DCK A;  3G4S P;  1X0T A;  1RQV A;  3MTU E;  5APS A;  3O6Q A;  4U0B A;  1GK4 A;  1KIL D;  2OYH C;  4DZO A;  5L8R J;  2PGD A;  4RKU J;  2N5H A;  2DW3 A;  2YMY A;  2OAR A;  3A3Y B;  1RHZ B;  2SPZ A;  3L36 A;  5DJT B;  2I1K A;  4D6T D;  1NTK D;  3ITK A;  1ZLL A;  3CX5 I;  4OGQ D;  1HTL C;  1CSB A;  2AXT H;  3H1K J;  2KI7 B;  3HD7 C;  3M91 A;  1FS0 E;  2ONT A;  1NVO A;  5KP6 B;  1FZC C;  2C9N Y;  1VPC A;  5AW6 B;  1S9K E;  3C8V A;  1KIL C;  1YTZ T;  5KKZ B;  2PEO A;  4GIF A;  2R32 A;  2WZ7 A;  3KHU A;  5AVY B;  2XZ0 D;  2K0X A;  1J1D B;  2YKQ A;  2JGP A;  2NRG A;  3VMX A;  4R4L A;  2A06 E;  2QG4 A;  5HGM A;  1BXI A;  1MUU A;  2KZJ A;  1BAJ A;  1EC5 A;  3H6P A;  1GW4 A;  1U7M A;  2K88 A;  4OGQ C;  1OW8 A;  1PV3 A;  5B66 H;  1GTW A;  4WY4 C;  4XFX A;  4PH1 A;  3F89 A;  1IO4 A;  1LTJ C;  1K30 A;  3DS2 A;  3RL0 g;  3DPH A;  4PD4 I;  2M3E A;  4BRY A;  3M1M A;  5HGN A;  2QNW A;  3AEB C;  2QIW A;  2AEF A;  1M74 A;  1M1J C;  1P84 I;  1DD3 A;  2H43 A;  3RK3 E;  1VQP P;  3L70 J;  2OTL P;  1OZH A;  3AEA C;  1SFC B;  1JUN A;  4H0L D;  1N73 C;  4U0E A;  1L0N E;  2HFE D;  1IFN A;  3HTK A;  2CG5 B;  3TK1 A;  2M5A A;  5APQ A;  2H7H A;  3KZI H;  3L74 D;  1URQ B;  4W80 A;  1L4A D;  1QVF O;  4KJM A;  4ZKU A;  1FDM A;  3B8E B;  2GYK A;  4JQ0 D;  2KGD A;  4N78 D;  2LL8 A;  3H1L D;  3GW6 A;  3VN0 A;  5EW5 E;  1VL2 A;  3RL0 D;  5AVZ B;  2KGA A;  3H1K E;  1SLQ A;  3L75 D;  1AV1 A;  2YIU B;  3CXH H;  4C7N B;  3L73 G;  3NXS A;  1L0L K;  1ZW0 A;  1IK9 A;  2B88 A;  4H0L C;  4EIJ A;  3H1I G;  5APX A;  1N7S A;  3UIA A;  3L72 G;  2JO1 A;  1K05 A;  5E79 H;  2HG5 D;  3H1H D;  2GZJ A;  2CPS A;  3G21 A;  4BRY B;  2BHV A;  1L4A C;  4HKZ H;  2YO2 A;  2JAZ A;  4R0M A;  5KLI B;  1F80 D;  4F37 A;  1FZE A;  1Z6M A;  5JPA A;  2FKW B;  2K9J B;  3RL0 C;  1BGY E;  1KN7 A;  2FYU K;  5B5E E;  3GG2 A;  4QNB A;  3E2D A;  4IL6 E;  1KQG B;  1GL2 A;  4Y28 J;  3CWB E;  2M5A B;  2LF4 A;  5CCH D;  3E1R A;  1EXJ A;  2XDJ A;  1YJ9 P;  1NTZ E;  4XFY A;  1SQV J;  1RQU A;  2LTE A;  1SQX J;  2ERH A;  1YIT P;  4RO0 A;  3L70 E;  1IJD B;  2KLV A;  1SQQ J;  4UB6 E;  1VQM P;  1S5L E;  4UB8 E;  2K1A A;  2JR8 A;  2PEM A;  3BCC J;  2KP8 A;  1S4X A;  1M57 D;  1GK6 A;  2PAJ A;  4GOF A;  2BAS A;  3V2N A;  1MFT A;  2GDX A;  3DS5 A;  4XRO A;  1NU1 K;  1NH4 A;  2OQQ A;  1OIP A;  4L76 A;  1DV5 A;  1Y8A A;  2R3C A;  3WU2 H;  1PGQ A;  1N8R Q;  3H1J J;  4XRQ A;  1T3U A;  2LXC B;  3PLN A;  1L0H A;  5CCH C;  2XZ1 C;  4PV1 D;  4U0C A;  2WSF J;  3TNU A;  2G8Y A;  3VYI A;  2O01 J;  1SQB K;  1MKM A;  1W2B O;  3I55 P;  2K2Q A;  5AW9 B;  3CCR P;  2OYO A;  3WUV A;  1KB9 H;  1GW3 A;  2R44 A;  5AVS B;  2LOL A;  4C46 A;  5AW3 B;  3NY7 B;  3CX5 E;  3RGU A;  2JP3 A;  2HLO A;  3SFD C;  4HB1 A;  4D6T J;  1MV8 A;  2E42 A;  3HUS B;  4R4M A;  3CC4 P;  2O1K A;  3JCU E;  2JB0 A;  2IDB A;  2WTY A;  1VQO P;  1Q90 D;  1M56 D;  2E76 B;  1CEI A;  1OR5 A;  1GZL A;  1GU4 A;  1ZNV A;  1L0N D;  3SWK A;  4JBZ A;  4PV1 C;  2WMM A;  7CEI A;  1FC2 C;  4JF7 A;  1FZF A;  1YQ3 C;  3A0H E;  1CI6 A;  2FXO A;  1HH0 A;  2KOR A;  2C9L Y;  3NFQ A;  2NPS B;  1XTG B;  2ZJS E;  5KKZ C;  2LIW A;  1HY8 A;  2FQ0 A;  5KAF E;  2M3B A;  1RF1 B;  1SFC D;  2LML A;  1J1D C;  4PD4 E;  3BCC E;  4QKO A;  4K3A A;  3PHL A;  4I7Z B;  1EQ7 A;  1NWQ A;  5AVV B;  3SWF A;  3CCL P;  1URQ D;  2KW2 A;  3RG6 C;  3H32 A;  1RE3 A;  2QVA A;  3N4X A;  2PEN A;  3H1J E;  3DS0 A;  1KOR A;  3L37 A;  4H2W C;  2WWW A;  2MD9 A;  3GHG A;  2W6J H;  3G6E P;  1OX3 A;  3LMO A;  1KIL E;  3U1C A;  1PP9 J;  1SQP J;  1N2D C;  2N6Z A;  1BGY D;  3M9H A;  5APW A;  1U57 A;  2B87 A;  1RO0 A;  1SFC C;  2J5U A;  1FJK A;  3L74 J;  3GJN A;  1KZU B;  1X9V A;  2WPS A;  1LP1 A;  1KLP A;  1IFM A;  4COP A;  4D6T E;  1NTK E;  2WVR A;  2FY8 A;  1HVV A;  2OGU A;  1KYO D;  2IYO A;  3M9Q A;  2Y9Z A;  1L0L G;  2CK3 H;  1URQ C;  1WMK A;  3L75 J;  1BCC G;  3GMA A;  1U7J A;  3A7O A;  3WUT A;  3A0B H;  2FQ2 A;  4JYB A;  3RBZ A;  2YIU C;  1M90 Q;  4UHP B;  3L73 D;  4DOJ A;  2HR3 A;  4GOD A;  4GT1 A;  1AQT A;  2GM4 A;  1ZP0 C;  4U0A A;  3FXD A;  3L72 D;  1T2K D;  1PEU A;  2KZI A;  2P1J A;  3CCJ P;  1G2C B;  1J1E C;  1DX7 A;  3GLM A;  1EZV D;  2ZT9 B;  1JMM A;  4KT0 J;  1EDJ A;  4ASW A;  1VQ9 P;  3T97 B;  1ZRT D;  1M6E X;  4U3F E;  5KLI C;  1HWT C;  1HQB A;  2K0D X;  4U0F A;  1JJ2 O;  2KOG A;  1DIP A;  1X79 B;  5BS2 A;  2B87 B;  1IFP A;  4YXD C;  2FFD B;  1LP1 B;  2N1T B;  1NTM D;  2WPV B;  2E74 B;  3P7K A;  1JY2 O;  1OFC X;  2OYI B;  1AFO A;  1USE A;  2M0B A;  2WSE J;  3BRV B;  3CC2 P;  3Q20 A;  2MF4 A;  3M9B A;  2M8R A;  1T2K C;  2EFJ A;  3DS3 A;  3WUU A;  3G1G A;  2PY8 A;  3H47 A;  2P7J A;  4ZKP A;  5KJ7 D;  3L74 E;  1BE3 G;  2HPC A;  1KQS O;  2IZ1 A;  4BPG A;  3HE4 A;  2R5B A;  5K5G B;  1KD1 Q;  1T3J A;  4N78 E;  3H1L E;  3M0A A;  1SQB G;  1IMP A;  2FVF A;  1X8Y A;  3L75 E;  5AVU B;  2JDI H;  1VDF A;  1NAY A;  1Y9B A;  1KYO I;  5CCG A;  4LLH A;  1PIX A; 
#chains in the Genus database with same CATH homology
 3DS4 A;  4U0B A;  2CWO A;  2OTL P;  4XFZ A;  1VQ6 P;  3G28 A;  1VQK P;  1YIT P;  1NJI Q;  2E1M A;  4U0E A;  4U0D A;  2PEK A;  1KC8 Q;  5HGO A;  1VQM P;  4IPY A;  1Q82 Q;  5F2O A;  5HGL A;  2KOD A;  2PEM A;  3I56 P;  4U0A A;  2QA4 P;  1PEO A;  1PEU A;  3LRY A;  2PEJ A;  1E6J P;  3CCJ P;  1A43 A;  2OAR A;  3NTE A;  1YJN P;  1M1K Q;  2L6E A;  1PEQ A;  3DS5 A;  4XRO A;  1VQ9 P;  1QVF O;  3DTJ A;  1YJW P;  1S72 P;  2BQ1 E;  2M8P A;  4GR2 A;  2XV6 A;  1ZMB A;  1M6E X;  1K73 Q;  2EIA A;  3CCL P;  2Z46 A;  1EOQ A;  5F2N A;  1N8R Q;  4XRQ A;  3RG6 C;  1A8O A;  2ONT A;  3G26 A;  4U0F A;  1JJ2 O;  1RNI A;  2Z45 A;  2PEN A;  2P9X A;  2OTJ P;  4U0C A;  3CME P;  1AUM A;  5BS2 A;  3DS0 A;  2DGY A;  4COC A;  2BUO A;  2QEX P;  5I4T G;  3H4E A;  1VQ5 P;  2PEO A;  3G6E P;  3CCS P;  3CCE P;  1W2B O;  4PH0 A;  3P05 A;  3I55 P;  3G71 P;  1VQN P;  3MGE A;  3CCR P;  4M0I A;  1VQ4 P;  2M8N A;  3CCU P;  2XXM A;  3WBH A;  1YHQ P;  1Q81 Q;  3CC2 P;  2M8L A;  4GR6 A;  3Q20 A;  1K9M Q;  1Q7Y Q;  3G0V A;  1QRJ A;  2EFJ A;  1RO0 A;  3DS3 A;  3CCV P;  3CCQ P;  3G1G A;  3HYB A;  5HGM A;  2PY8 A;  3H47 A;  1YI2 P;  1IUQ A;  3B5I A;  1BAJ A;  2JYL A;  3G21 A;  1VQ8 P;  2BHV A;  2PEI A;  1KQS O;  3CCM P;  3CC4 P;  4COP A;  3G29 A;  1M6N A;  1VQO P;  3CPW O;  2Z44 A;  3HZQ A;  4XFX A;  5JPA A;  2JO0 A;  4PH1 A;  1KD1 Q;  2PEQ A;  4WYM A;  3CC7 P;  1D1D A;  2XT1 A;  3H0D A;  1VQ7 P;  1K30 A;  3DS1 A;  3DS2 A;  5F2K A;  3OW2 O;  1EIA A;  3CD6 P;  3DPH A;  1RO2 A;  3G1I A;  4QNB A;  3E2D A;  3M1M A;  5HGN A;  2JYG A;  2EG5 A;  3CMA P;  5BS1 A;  1Q86 Q;  2LF4 A;  1QVG O;  1M74 A;  1PEM A;  1YIJ P;  3VRL C;  1VQL P;  5DCK A;  3G4S P;  1YJ9 P;  1VQP P;  1K8A Q;  4XFY A;  3CXC O;  1M90 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...