5HV8A

Solution structure of an octanoyl- loaded acyl carrier protein domain from module mlsa2 of the mycolactone polyketide synthase.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
95
structure length
95
Chain Sequence
GSHMRLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLDLPPTLIFDHPTPHALTQHLHTRLTQSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Type I modular polyketide synthase
publication title Sticky swinging arm dynamics: studies of an acyl carrier protein domain from the mycolactone polyketide synthase.
pubmed doi rcsb
source organism Mycobacterium ulcerans
total genus 26
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5hv8A00
3LMOA 1DNYA 2AFEA 5CZDB 4H2XC 4H2WC 2DNWA 2GDYA 2LOLA 2LKIA 2MVVA 4R0MA 2JU2A 5KP7B 2LIWA 2FAEA 2KGEA 3NY7B 2L4BA 2K94A 2K2QA 4H2YC 2CQ8A 2X2BA 2CNRA 2MR8A 2FVAA 2L9FA 2FHSC 2N5IA 2EHSA 2AFDA 2FQ2A 2VSQA 2QNWA 2KOSA 4IZ6A 2CGQA 1AF8A 1DV5A 2KGCA 2FACA 1VKUA 2FVEA 2GDWA 2N50A 2KG8A 3GZLA 1HQBA 2LL8A 2JU1A 2XZ1C 4BPFA 2MF4A 2GDXA 3EJEA 1OR5A 2M5RA 2XZ0D 2CG5B 5KP6B 2MR7A 2N5HA 4PXHB 2JQ4A 2KW2A 2LTEA 2LIUA 2KGAA 2KOQA 2JGPA 1L0IA 2MVUA 2AF8A 2K92A 2K0XA 2AVAA 2KG6A 2KR5A 3GZMA 1L0HA 4MRTC 4DG9A 2N6ZA 3CE7A 2KGDA 2N98A 2FADA 3RG2A 2ROQA 3EJBA 2KOPA 2MD9A 2K0YA 2KWLA 4CA3A 5EJDA 2FQ1A 5HVCA 1KLPA 4HKGA 1HY8A 1ACPA 2MY5A 1F80D 2LMLA 1NQ4A 2N6YA 2KOOA 5HV8A 2KORA 2K93A 4BPGA 1T8KA 2FQ0A 3EJDA 2FVFA 2LPKA 1X3OA 2KG9A 4PWVB 2PNGA 4NEOA 2L0QA 2L22A 4BPHA 5KP8B 2EHTA
chains in the Genus database with same CATH superfamily
2AFEA 4PH0A 1VQKP 2K0DX 1IMQA 2XV6A 4H2WC 2PEQA 2VLQA 3RG6C 1Q86Q 2JYGA 5DCKA 1RO2A 1IMPA 2KGEA 3CCEP 3B5IA 2M8NA 4GR6A 2MR8A 2FVAA 3CCRP 1M6NA 2FHSC 2EHSA 1QRJA 2QNWA 2VSQA 2KOSA 2CGQA 2QA4P 1VQOP 5HGLA 4XFYA 3GKLC 4M0IA 4BPFA 2MF4A 3EJEA 5F2OA 2JO0A 3G0VA 1GXHA 1N8RQ 5HGMA 5KP6B 1S72P 2QEXP 2N5HA 3DS5A 2LTEA 2KGAA 3G1GA 3GJNA 2KR5A 5JPAA 1VQLP 2GZFA 4MRTC 3G71P 3E2DA 5BS2A 1VQPP 2ROQA 2MD9A 4CA3A 4U0CA 4U0EA 1QVGO 2MY5A 2E1MA 3DS4A 2LMLA 2KOOA 5HV8A 2KORA 2VLOA 2EG5A 1IUQA 2FQ0A 2FVFA 3HYBA 1X3OA 2KG9A 3HZQA 3CCQP 3LRYA 1YHQP 4PWVB 3G1IA 3OW2O 4NEOA 3CC4P 2KODA 1DNYA 1JJ2O 4QKOA 2GZJA 2DNWA 2Z45A 4WYMA 2GDYA 2LKIA 4IPYA 1M90Q 4R0MA 2JU2A 2FAEA 2L4BA 3CC7P 1A8OA 5BS1A 2L9FA 1QVFO 3CD6P 2AFDA 3CPWO 7CEIA 3CXCO 2P9XA 2K5XA 1AF8A 2CWOA 2GZEA 3DS0A 1VKUA 2OARA 3M1MA 1VQMP 2NO8A 2GZIA 1CEIA 2JBGA 3GZLA 3Q20A 2LL8A 2JU1A 2XZ1C 1OR5A 1VQ5P 2VLNA 5F2NA 1D1DA 2LIUA 3H0DA 4COPA 2JGPA 1M74A 4GR2A 5F2KA 2L6EA 1VQ6P 2ONTA 2JB0A 1L0HA 2PENA 3CE7A 3CCVP 2ERHA 2N98A 3RG2A 3I55P 2JAZA 4XRQA 1UNKA 2FQ1A 1KLPA 1UJZA 4HKGA 2DGYA 2EIAA 3DS3A 1EMVA 2K93A 4U0AA 1AUMA 3EJDA 3MGEA 3CCMP 2PNGA 3G26A 2VLPA 3LMOA 1YJNP 5CZDB 2LF4A 4H2XC 1YJWP 2LOLA 1YI2P 1KC8Q 1Q82Q 2MVVA 1VQ7P 5KP7B 2LIWA 1K8AQ 4H2YC 2X2BA 2XXMA 3G4SP 2FQ2A 1AYIA 2KGCA 2GDWA 2N50A 2PY8A 3G21A 1YITP 2KG8A 1HQBA 1M6EX 2PEMA 2GDXA 3G28A 1Q81Q 2XZ0D 2CG5B 4U0BA 1A43A 2PEIA 2MR7A 4PXHB 3DTJA 2GYKA 3DS1A 2KOQA 1L0IA 2MVUA 2K92A 1VQNP 4XFZA 2AVAA 3WBHA 1FR2A 4U0DA 4DG9A 2N6ZA 5EW5E 1K30A 4XFXA 2PEOA 2FADA 2EFJA 1EIAA 2PEKA 3B4QA 1ZMBA 2KOPA 1Z6MA 1VQ4P 5EJDA 1KD1Q 3VRLC 5HVCA 1K73Q 1HY8A 1YIJP 1NJIQ 1F80D 2Z46A 1NQ4A 2M8LA 5HGNA 4BPGA 3G6EP 1T8KA 1VQ8P 2LPKA 2L0QA 5KP8B 2WPTA 3P05A 4U0FA 3DS2A 1VQ9P 1BAJA 3NY7B 2K94A 3CMEP 2K2QA 1EOQA 2CQ8A 3CMAP 1GPJA 2CNRA 1Q7YQ 3H47A 3CCUP 2N5IA 4IZ6A 1DV5A 2FACA 3DPHA 2GZGA 2PEJA 1W2BO 5HGOA 2FVEA 3CCJP 1K9MQ 1ZNVA 1RNIA 2M5RA 5I4TG 4UHPB 3U43A 3G29A 4QNBA 2JQ4A 2KW2A 2OTLP 1M1KQ 3CCSP 3CCLP 1GXGA 1E6JP 1RO0A 2M8PA 2AF8A 1BXIA 2K0XA 2KG6A 4F37A 3GZMA 4XROA 1E0HA 2KGDA 3H4EA 3EJBA 2K0YA 4COCA 2KWLA 3CC2P 1ACPA 1KQSO 1VHNA 2N6YA 2BHVA 3I56P 2XT1A 2Z44A 1YJ9P 2BUOA 4PH1A 1MZ8A 2JYLA 3NTEA 2OTJP 2L22A 4BPHA 2EHTA
chains in the Genus database with same CATH topology
3LMOA 1DNYA 2AFEA 5CZDB 4H2XC 4H2WC 2DNWA 2GDYA 2LOLA 2LKIA 2MVVA 4R0MA 2JU2A 5KP7B 2LIWA 2FAEA 2KGEA 3NY7B 2L4BA 2K94A 2K2QA 4H2YC 2CQ8A 2X2BA 2CNRA 2MR8A 2FVAA 2L9FA 2FHSC 2N5IA 2EHSA 2AFDA 2FQ2A 2VSQA 2QNWA 2KOSA 4IZ6A 2CGQA 1AF8A 1DV5A 2KGCA 2FACA 1VKUA 2FVEA 2GDWA 2N50A 2KG8A 3GZLA 1HQBA 2LL8A 2JU1A 2XZ1C 4BPFA 2MF4A 2GDXA 3EJEA 1OR5A 2M5RA 2XZ0D 2CG5B 5KP6B 2MR7A 2N5HA 4PXHB 2JQ4A 2KW2A 2LTEA 2LIUA 2KGAA 2KOQA 2JGPA 1L0IA 2MVUA 2AF8A 2K92A 2K0XA 2AVAA 2KG6A 2KR5A 3GZMA 1L0HA 4MRTC 4DG9A 2N6ZA 3CE7A 2KGDA 2N98A 2FADA 3RG2A 2ROQA 3EJBA 2KOPA 2MD9A 2K0YA 2KWLA 4CA3A 5EJDA 2FQ1A 5HVCA 1KLPA 4HKGA 1HY8A 1ACPA 2MY5A 1F80D 2LMLA 1NQ4A 2N6YA 2KOOA 5HV8A 2KORA 2K93A 4BPGA 1T8KA 2FQ0A 3EJDA 2FVFA 2LPKA 1X3OA 2KG9A 4PWVB 2PNGA 4NEOA 2L0QA 2L22A 4BPHA 5KP8B 2EHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LMO A;  1DNY A;  2AFE A;  5CZD B;  4H2X C;  4H2W C;  2DNW A;  2GDY A;  2LOL A;  2LKI A;  2MVV A;  4R0M A;  2JU2 A;  5KP7 B;  2LIW A;  2FAE A;  2KGE A;  3NY7 B;  2L4B A;  2K94 A;  2K2Q A;  4H2Y C;  2CQ8 A;  2X2B A;  2CNR A;  2MR8 A;  2FVA A;  2L9F A;  2FHS C;  2N5I A;  2EHS A;  2AFD A;  2FQ2 A;  2VSQ A;  2QNW A;  2KOS A;  4IZ6 A;  2CGQ A;  1AF8 A;  1DV5 A;  2KGC A;  2FAC A;  1VKU A;  2FVE A;  2GDW A;  2N50 A;  2KG8 A;  3GZL A;  1HQB A;  2LL8 A;  2JU1 A;  2XZ1 C;  4BPF A;  2MF4 A;  2GDX A;  3EJE A;  1OR5 A;  2M5R A;  2XZ0 D;  2CG5 B;  5KP6 B;  2MR7 A;  2N5H A;  4PXH B;  2JQ4 A;  2KW2 A;  2LTE A;  2LIU A;  2KGA A;  2KOQ A;  2JGP A;  1L0I A;  2MVU A;  2AF8 A;  2K92 A;  2K0X A;  2AVA A;  2KG6 A;  2KR5 A;  3GZM A;  1L0H A;  4MRT C;  4DG9 A;  2N6Z A;  3CE7 A;  2KGD A;  2N98 A;  2FAD A;  3RG2 A;  2ROQ A;  3EJB A;  2KOP A;  2MD9 A;  2K0Y A;  2KWL A;  4CA3 A;  5EJD A;  2FQ1 A;  5HVC A;  1KLP A;  4HKG A;  1HY8 A;  1ACP A;  2MY5 A;  1F80 D;  2LML A;  1NQ4 A;  2N6Y A;  2KOO A;  5HV8 A;  2KOR A;  2K93 A;  4BPG A;  1T8K A;  2FQ0 A;  3EJD A;  2FVF A;  2LPK A;  1X3O A;  2KG9 A;  4PWV B;  2PNG A;  4NEO A;  2L0Q A;  2L22 A;  4BPH A;  5KP8 B;  2EHT A; 
#chains in the Genus database with same CATH topology
 2AFE A;  4PH0 A;  1VQK P;  2K0D X;  1IMQ A;  2XV6 A;  4H2W C;  2PEQ A;  2VLQ A;  3RG6 C;  1Q86 Q;  2JYG A;  5DCK A;  1RO2 A;  1IMP A;  2KGE A;  3CCE P;  3B5I A;  2M8N A;  4GR6 A;  2MR8 A;  2FVA A;  3CCR P;  1M6N A;  2FHS C;  2EHS A;  1QRJ A;  2QNW A;  2VSQ A;  2KOS A;  2CGQ A;  2QA4 P;  1VQO P;  5HGL A;  4XFY A;  3GKL C;  4M0I A;  4BPF A;  2MF4 A;  3EJE A;  5F2O A;  2JO0 A;  3G0V A;  1GXH A;  1N8R Q;  5HGM A;  5KP6 B;  1S72 P;  2QEX P;  2N5H A;  3DS5 A;  2LTE A;  2KGA A;  3G1G A;  3GJN A;  2KR5 A;  5JPA A;  1VQL P;  2GZF A;  4MRT C;  3G71 P;  3E2D A;  5BS2 A;  1VQP P;  2ROQ A;  2MD9 A;  4CA3 A;  4U0C A;  4U0E A;  1QVG O;  2MY5 A;  2E1M A;  3DS4 A;  2LML A;  2KOO A;  5HV8 A;  2KOR A;  2VLO A;  2EG5 A;  1IUQ A;  2FQ0 A;  2FVF A;  3HYB A;  1X3O A;  2KG9 A;  3HZQ A;  3CCQ P;  3LRY A;  1YHQ P;  4PWV B;  3G1I A;  3OW2 O;  4NEO A;  3CC4 P;  2KOD A;  1DNY A;  1JJ2 O;  4QKO A;  2GZJ A;  2DNW A;  2Z45 A;  4WYM A;  2GDY A;  2LKI A;  4IPY A;  1M90 Q;  4R0M A;  2JU2 A;  2FAE A;  2L4B A;  3CC7 P;  1A8O A;  5BS1 A;  2L9F A;  1QVF O;  3CD6 P;  2AFD A;  3CPW O;  7CEI A;  3CXC O;  2P9X A;  2K5X A;  1AF8 A;  2CWO A;  2GZE A;  3DS0 A;  1VKU A;  2OAR A;  3M1M A;  1VQM P;  2NO8 A;  2GZI A;  1CEI A;  2JBG A;  3GZL A;  3Q20 A;  2LL8 A;  2JU1 A;  2XZ1 C;  1OR5 A;  1VQ5 P;  2VLN A;  5F2N A;  1D1D A;  2LIU A;  3H0D A;  4COP A;  2JGP A;  1M74 A;  4GR2 A;  5F2K A;  2L6E A;  1VQ6 P;  2ONT A;  2JB0 A;  1L0H A;  2PEN A;  3CE7 A;  3CCV P;  2ERH A;  2N98 A;  3RG2 A;  3I55 P;  2JAZ A;  4XRQ A;  1UNK A;  2FQ1 A;  1KLP A;  1UJZ A;  4HKG A;  2DGY A;  2EIA A;  3DS3 A;  1EMV A;  2K93 A;  4U0A A;  1AUM A;  3EJD A;  3MGE A;  3CCM P;  2PNG A;  3G26 A;  2VLP A;  3LMO A;  1YJN P;  5CZD B;  2LF4 A;  4H2X C;  1YJW P;  2LOL A;  1YI2 P;  1KC8 Q;  1Q82 Q;  2MVV A;  1VQ7 P;  5KP7 B;  2LIW A;  1K8A Q;  4H2Y C;  2X2B A;  2XXM A;  3G4S P;  2FQ2 A;  1AYI A;  2KGC A;  2GDW A;  2N50 A;  2PY8 A;  3G21 A;  1YIT P;  2KG8 A;  1HQB A;  1M6E X;  2PEM A;  2GDX A;  3G28 A;  1Q81 Q;  2XZ0 D;  2CG5 B;  4U0B A;  1A43 A;  2PEI A;  2MR7 A;  4PXH B;  3DTJ A;  2GYK A;  3DS1 A;  2KOQ A;  1L0I A;  2MVU A;  2K92 A;  1VQN P;  4XFZ A;  2AVA A;  3WBH A;  1FR2 A;  4U0D A;  4DG9 A;  2N6Z A;  5EW5 E;  1K30 A;  4XFX A;  2PEO A;  2FAD A;  2EFJ A;  1EIA A;  2PEK A;  3B4Q A;  1ZMB A;  2KOP A;  1Z6M A;  1VQ4 P;  5EJD A;  1KD1 Q;  3VRL C;  5HVC A;  1K73 Q;  1HY8 A;  1YIJ P;  1NJI Q;  1F80 D;  2Z46 A;  1NQ4 A;  2M8L A;  5HGN A;  4BPG A;  3G6E P;  1T8K A;  1VQ8 P;  2LPK A;  2L0Q A;  5KP8 B;  2WPT A;  3P05 A;  4U0F A;  3DS2 A;  1VQ9 P;  1BAJ A;  3NY7 B;  2K94 A;  3CME P;  2K2Q A;  1EOQ A;  2CQ8 A;  3CMA P;  1GPJ A;  2CNR A;  1Q7Y Q;  3H47 A;  3CCU P;  2N5I A;  4IZ6 A;  1DV5 A;  2FAC A;  3DPH A;  2GZG A;  2PEJ A;  1W2B O;  5HGO A;  2FVE A;  3CCJ P;  1K9M Q;  1ZNV A;  1RNI A;  2M5R A;  5I4T G;  4UHP B;  3U43 A;  3G29 A;  4QNB A;  2JQ4 A;  2KW2 A;  2OTL P;  1M1K Q;  3CCS P;  3CCL P;  1GXG A;  1E6J P;  1RO0 A;  2M8P A;  2AF8 A;  1BXI A;  2K0X A;  2KG6 A;  4F37 A;  3GZM A;  4XRO A;  1E0H A;  2KGD A;  3H4E A;  3EJB A;  2K0Y A;  4COC A;  2KWL A;  3CC2 P;  1ACP A;  1KQS O;  1VHN A;  2N6Y A;  2BHV A;  3I56 P;  2XT1 A;  2Z44 A;  1YJ9 P;  2BUO A;  4PH1 A;  1MZ8 A;  2JYL A;  3NTE A;  2OTJ P;  2L22 A;  4BPH A;  2EHT A; 
#chains in the Genus database with same CATH homology
 3LMO A;  1DNY A;  2AFE A;  5CZD B;  4H2X C;  4H2W C;  2DNW A;  2GDY A;  2LOL A;  2LKI A;  2MVV A;  4R0M A;  2JU2 A;  5KP7 B;  2LIW A;  2FAE A;  2KGE A;  3NY7 B;  2L4B A;  2K94 A;  2K2Q A;  4H2Y C;  2CQ8 A;  2X2B A;  2CNR A;  2MR8 A;  2FVA A;  2L9F A;  2FHS C;  2N5I A;  2EHS A;  2AFD A;  2FQ2 A;  2VSQ A;  2QNW A;  2KOS A;  4IZ6 A;  2CGQ A;  1AF8 A;  1DV5 A;  2KGC A;  2FAC A;  1VKU A;  2FVE A;  2GDW A;  2N50 A;  2KG8 A;  3GZL A;  1HQB A;  2LL8 A;  2JU1 A;  2XZ1 C;  4BPF A;  2MF4 A;  2GDX A;  3EJE A;  1OR5 A;  2M5R A;  2XZ0 D;  2CG5 B;  5KP6 B;  2MR7 A;  2N5H A;  4PXH B;  2JQ4 A;  2KW2 A;  2LTE A;  2LIU A;  2KGA A;  2KOQ A;  2JGP A;  1L0I A;  2MVU A;  2AF8 A;  2K92 A;  2K0X A;  2AVA A;  2KG6 A;  2KR5 A;  3GZM A;  1L0H A;  4MRT C;  4DG9 A;  2N6Z A;  3CE7 A;  2KGD A;  2N98 A;  2FAD A;  3RG2 A;  2ROQ A;  3EJB A;  2KOP A;  2MD9 A;  2K0Y A;  2KWL A;  4CA3 A;  5EJD A;  2FQ1 A;  5HVC A;  1KLP A;  4HKG A;  1HY8 A;  1ACP A;  2MY5 A;  1F80 D;  2LML A;  1NQ4 A;  2N6Y A;  2KOO A;  5HV8 A;  2KOR A;  2K93 A;  4BPG A;  1T8K A;  2FQ0 A;  3EJD A;  2FVF A;  2LPK A;  1X3O A;  2KG9 A;  4PWV B;  2PNG A;  4NEO A;  2L0Q A;  2L22 A;  4BPH A;  5KP8 B;  2EHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...