5HV8A

Solution structure of an octanoyl- loaded acyl carrier protein domain from module mlsa2 of the mycolactone polyketide synthase.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
95
structure length
95
Chain Sequence
b'GSHMRLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLDLPPTLIFDHPTPHALTQHLHTRLTQSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Type I modular polyketide synthase
publication title Sticky swinging arm dynamics: studies of an acyl carrier protein domain from the mycolactone polyketide synthase.
pubmed doi rcsb
source organism Mycobacterium ulcerans
molecule tags Transferase
total genus 26
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5hv8A00
2K94A 2FQ1A 2M5RA 2K93A 2AF8A 3EJEA 3EJBA 2FQ2A 2LOLA 2PNGA 4H2XC 4H2YC 2FACA 2MF4A 2KOSA 2CG5B 2K2QA 1L0IA 4MRTC 1X3OA 2FAEA 4PXHB 2KGDA 3RG2A 2K0XA 2FADA 2GDWA 2XZ1C 2MR8A 2EHSA 5HV8A 2N98A 4R0MA 2LPKA 2L9FA 2LTEA 1OR5A 2XZ0D 2FVFA 2LIWA 2KGCA 4NEOA 1F80D 1L0HA 2N6YA 2N6ZA 2X2BA 2GDXA 4IZ6A 2KW2A 5KP6B 2LL8A 1NQ4A 2KWLA 2AFDA 2JU2A 1ACPA 1DNYA 2AVAA 2KG6A 1KLPA 2MVVA 2KOQA 3EJDA 3CE7A 2CGQA 3GZLA 2JQ4A 2JGPA 5KP8B 2MVUA 5CZDB 2LIUA 2KR5A 2FVEA 2KGEA 2ROQA 2QNWA 2VSQA 4HKGA 2AFEA 2GDYA 4PWVB 2K0YA 2DNWA 2FQ0A 2K92A 4BPGA 2FHSC 2MR7A 2L0QA 4CA3A 5EJDA 2KG9A 2KGAA 2MY5A 2FVAA 2KOPA 1HY8A 2LMLA 2KG8A 3LMOA 2L22A 4H2WC 2JU1A 2N5HA 2EHTA 5HVCA 2L4BA 1DV5A 1T8KA 2CQ8A 3NY7B 1HQBA 2KOOA 2MD9A 2CNRA 4BPFA 2N5IA 2KORA 1VKUA 5KP7B 4DG9A 2LKIA 4BPHA 3GZMA 2N50A 1AF8A
chains in the Genus database with same CATH superfamily
2M5RA 1YHQP 2GZIA 2OTJP 2PNGA 2JYGA 2KOSA 2LF4A 2FAEA 1S72P 2KGDA 1K8AQ 5HV8A 3DS5A 1VQ5P 2XZ0D 4NEOA 2N6YA 3DPHA 2X2BA 2ERHA 1KC8Q 3HYBA 2JU2A 1VQ7P 2AVAA 2KG6A 1M74A 2OTLP 4M0IA 2MVUA 2GZGA 2KR5A 1VQ9P 2GYKA 5JPAA 2GDYA 5BS2A 2K0YA 2FQ0A 1K30A 2QEXP 1BXIA 2BUOA 2K5XA 2FHSC 2Z44A 2KG9A 1IUQA 1VHNA 1VQ4P 2PEJA 2QA4P 2L22A 1CEIA 1QVFO 1E0HA 3Q20A 2JYLA 2BHVA 1KD1Q 1K73Q 2GZFA 3H4EA 4UHPB 3HZQA 2CNRA 3DS1A 5HGNA 4BPHA 1MZ8A 2PY8A 1Q82Q 1Q7YQ 1YITP 2AF8A 5EW5E 2Z45A 3EJBA 1ZNVA 4H2YC 1GXHA 2MF4A 1KQSO 1VQLP 4PXHB 4MRTC 2VLOA 3DS3A 1A8OA 2EHSA 1GPJA 4XFYA 2L9FA 2LTEA 3CC2P 1OR5A 1RNIA 2PEKA 3DTJA 2LIWA 2KGCA 3CCSP 3G71P 2GDXA 4IZ6A 4U0CA 2KW2A 2LL8A 4COCA 2M8LA 1ACPA 1DNYA 2MVVA 2KOQA 5HGOA 3G6EP 3I55P 3DS4A 2ONTA 2JQ4A 2LIUA 2XT1A 2FVEA 3CMEP 2ROQA 3B4QA 2DGYA 2WPTA 2GZJA 1A43A 3H0DA 3CCQP 4HKGA 4U0FA 4PWVB 1Q86Q 2MR7A 1Z6MA 2JB0A 2PEOA 4QKOA 1EOQA 1IMQA 2FVAA 1M6EX 3G29A 4XFXA 1UNKA 3CCEP 3DS2A 3WBHA 2JU1A 3CD6P 1YIJP 2Z46A 4GR6A 3VRLC 4COPA 1RO0A 4BPFA 1FR2A 3CXCO 3G28A 3GZMA 5F2NA 2K94A 3U43A 2K93A 1BAJA 3EJEA 2EFJA 2FQ2A 7CEIA 4GR2A 4H2XC 3CCMP 2FACA 4PH0A 3G26A 2L6EA 2K2QA 1X3OA 1E6JP 3GJNA 1N8RQ 3CMAP 4XRQA 2MR8A 3G21A 2VLNA 2LPKA 2K0DX 2FVFA 2EIAA 3E2DA 3NTEA 3CCUP 3M1MA 3RG6C 1F80D 1IMPA 3CPWO 5KP6B 2E1MA 3I56P 1RO2A 1KLPA 1ZMBA 3EJDA 2CWOA 3MGEA 1VQNP 2JGPA 1VQPP 2VSQA 3H47A 2AFEA 1EMVA 2DNWA 4IPYA 1YJNP 3CCLP 1VQMP 2L0QA 4CA3A 3CCVP 3CCRP 2JAZA 2MY5A 1YJWP 2M8NA 4XFZA 2KOPA 2LMLA 2KG8A 1NJIQ 3LMOA 5BS1A 4H2WC 2N5HA 2JBGA 2EHTA 5HVCA 5HGLA 4PH1A 1DV5A 1T8KA 1EIAA 3NY7B 1VQKP 1UJZA 2KORA 1VKUA 2LKIA 3OW2O 4F37A 2FQ1A 1VQOP 3G4SP 4WYMA 2LOLA 2CG5B 1D1DA 3GKLC 1L0IA 2EG5A 1M6NA 4U0AA 3B5IA 3RG2A 2K0XA 2FADA 2GDWA 2XZ1C 3CC7P 3CCJP 2N98A 4R0MA 2NO8A 4U0DA 1AUMA 3G0VA 2PEIA 2VLQA 3LRYA 1L0HA 1Q81Q 1GXGA 2N6ZA 1NQ4A 2KWLA 2OARA 3DS0A 2AFDA 1AYIA 3CC4P 2P9XA 3CE7A 2CGQA 3GZLA 5KP8B 2JO0A 1QVGO 5CZDB 2XXMA 1VQ6P 2GZEA 2KGEA 1W2BO 1K9MQ 1YJ9P 1JJ2O 2QNWA 5DCKA 1VQ8P 3P05A 5F2KA 2K92A 4BPGA 5HGMA 1M1KQ 2M8PA 3G1IA 2KODA 5EJDA 2KGAA 2PEMA 2PEQA 4XROA 1HY8A 1QRJA 2VLPA 5F2OA 1YI2P 2L4BA 2XV6A 3G1GA 5I4TG 2CQ8A 1HQBA 2KOOA 2MD9A 1M90Q 2N5IA 5KP7B 2PENA 4DG9A 4U0EA 4QNBA 2N50A 4U0BA 1AF8A
chains in the Genus database with same CATH topology
2K94A 2FQ1A 2M5RA 2K93A 2AF8A 3EJEA 3EJBA 2FQ2A 2LOLA 2PNGA 4H2XC 4H2YC 2FACA 2MF4A 2KOSA 2CG5B 2K2QA 1L0IA 4MRTC 1X3OA 2FAEA 4PXHB 2KGDA 3RG2A 2K0XA 2FADA 2GDWA 2XZ1C 2MR8A 2EHSA 5HV8A 2N98A 4R0MA 2LPKA 2L9FA 2LTEA 1OR5A 2XZ0D 2FVFA 2LIWA 2KGCA 4NEOA 1F80D 1L0HA 2N6YA 2N6ZA 2X2BA 2GDXA 4IZ6A 2KW2A 5KP6B 2LL8A 1NQ4A 2KWLA 2AFDA 2JU2A 1ACPA 1DNYA 2AVAA 2KG6A 1KLPA 2MVVA 2KOQA 3EJDA 3CE7A 2CGQA 3GZLA 2JQ4A 2JGPA 5KP8B 2MVUA 5CZDB 2LIUA 2KR5A 2FVEA 2KGEA 2ROQA 2QNWA 2VSQA 4HKGA 2AFEA 2GDYA 4PWVB 2K0YA 2DNWA 2FQ0A 2K92A 4BPGA 2FHSC 2MR7A 2L0QA 4CA3A 5EJDA 2KG9A 2KGAA 2MY5A 2FVAA 2KOPA 1HY8A 2LMLA 2KG8A 3LMOA 2L22A 4H2WC 2JU1A 2N5HA 2EHTA 5HVCA 2L4BA 1DV5A 1T8KA 2CQ8A 3NY7B 1HQBA 2KOOA 2MD9A 2CNRA 4BPFA 2N5IA 2KORA 1VKUA 5KP7B 4DG9A 2LKIA 4BPHA 3GZMA 2N50A 1AF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K94 A;  2FQ1 A;  2M5R A;  2K93 A;  2AF8 A;  3EJE A;  3EJB A;  2FQ2 A;  2LOL A;  2PNG A;  4H2X C;  4H2Y C;  2FAC A;  2MF4 A;  2KOS A;  2CG5 B;  2K2Q A;  1L0I A;  4MRT C;  1X3O A;  2FAE A;  4PXH B;  2KGD A;  3RG2 A;  2K0X A;  2FAD A;  2GDW A;  2XZ1 C;  2MR8 A;  2EHS A;  5HV8 A;  2N98 A;  4R0M A;  2LPK A;  2L9F A;  2LTE A;  1OR5 A;  2XZ0 D;  2FVF A;  2LIW A;  2KGC A;  4NEO A;  1F80 D;  1L0H A;  2N6Y A;  2N6Z A;  2X2B A;  2GDX A;  4IZ6 A;  2KW2 A;  5KP6 B;  2LL8 A;  1NQ4 A;  2KWL A;  2AFD A;  2JU2 A;  1ACP A;  1DNY A;  2AVA A;  2KG6 A;  1KLP A;  2MVV A;  2KOQ A;  3EJD A;  3CE7 A;  2CGQ A;  3GZL A;  2JQ4 A;  2JGP A;  5KP8 B;  2MVU A;  5CZD B;  2LIU A;  2KR5 A;  2FVE A;  2KGE A;  2ROQ A;  2QNW A;  2VSQ A;  4HKG A;  2AFE A;  2GDY A;  4PWV B;  2K0Y A;  2DNW A;  2FQ0 A;  2K92 A;  4BPG A;  2FHS C;  2MR7 A;  2L0Q A;  4CA3 A;  5EJD A;  2KG9 A;  2KGA A;  2MY5 A;  2FVA A;  2KOP A;  1HY8 A;  2LML A;  2KG8 A;  3LMO A;  2L22 A;  4H2W C;  2JU1 A;  2N5H A;  2EHT A;  5HVC A;  2L4B A;  1DV5 A;  1T8K A;  2CQ8 A;  3NY7 B;  1HQB A;  2KOO A;  2MD9 A;  2CNR A;  4BPF A;  2N5I A;  2KOR A;  1VKU A;  5KP7 B;  4DG9 A;  2LKI A;  4BPH A;  3GZM A;  2N50 A;  1AF8 A; 
#chains in the Genus database with same CATH topology
 2M5R A;  1YHQ P;  2GZI A;  2OTJ P;  2PNG A;  2JYG A;  2KOS A;  2LF4 A;  2FAE A;  1S72 P;  2KGD A;  1K8A Q;  5HV8 A;  3DS5 A;  1VQ5 P;  2XZ0 D;  4NEO A;  2N6Y A;  3DPH A;  2X2B A;  2ERH A;  1KC8 Q;  3HYB A;  2JU2 A;  1VQ7 P;  2AVA A;  2KG6 A;  1M74 A;  2OTL P;  4M0I A;  2MVU A;  2GZG A;  2KR5 A;  1VQ9 P;  2GYK A;  5JPA A;  2GDY A;  5BS2 A;  2K0Y A;  2FQ0 A;  1K30 A;  2QEX P;  1BXI A;  2BUO A;  2K5X A;  2FHS C;  2Z44 A;  2KG9 A;  1IUQ A;  1VHN A;  1VQ4 P;  2PEJ A;  2QA4 P;  2L22 A;  1CEI A;  1QVF O;  1E0H A;  3Q20 A;  2JYL A;  2BHV A;  1KD1 Q;  1K73 Q;  2GZF A;  3H4E A;  4UHP B;  3HZQ A;  2CNR A;  3DS1 A;  5HGN A;  4BPH A;  1MZ8 A;  2PY8 A;  1Q82 Q;  1Q7Y Q;  1YIT P;  2AF8 A;  5EW5 E;  2Z45 A;  3EJB A;  1ZNV A;  4H2Y C;  1GXH A;  2MF4 A;  1KQS O;  1VQL P;  4PXH B;  4MRT C;  2VLO A;  3DS3 A;  1A8O A;  2EHS A;  1GPJ A;  4XFY A;  2L9F A;  2LTE A;  3CC2 P;  1OR5 A;  1RNI A;  2PEK A;  3DTJ A;  2LIW A;  2KGC A;  3CCS P;  3G71 P;  2GDX A;  4IZ6 A;  4U0C A;  2KW2 A;  2LL8 A;  4COC A;  2M8L A;  1ACP A;  1DNY A;  2MVV A;  2KOQ A;  5HGO A;  3G6E P;  3I55 P;  3DS4 A;  2ONT A;  2JQ4 A;  2LIU A;  2XT1 A;  2FVE A;  3CME P;  2ROQ A;  3B4Q A;  2DGY A;  2WPT A;  2GZJ A;  1A43 A;  3H0D A;  3CCQ P;  4HKG A;  4U0F A;  4PWV B;  1Q86 Q;  2MR7 A;  1Z6M A;  2JB0 A;  2PEO A;  4QKO A;  1EOQ A;  1IMQ A;  2FVA A;  1M6E X;  3G29 A;  4XFX A;  1UNK A;  3CCE P;  3DS2 A;  3WBH A;  2JU1 A;  3CD6 P;  1YIJ P;  2Z46 A;  4GR6 A;  3VRL C;  4COP A;  1RO0 A;  4BPF A;  1FR2 A;  3CXC O;  3G28 A;  3GZM A;  5F2N A;  2K94 A;  3U43 A;  2K93 A;  1BAJ A;  3EJE A;  2EFJ A;  2FQ2 A;  7CEI A;  4GR2 A;  4H2X C;  3CCM P;  2FAC A;  4PH0 A;  3G26 A;  2L6E A;  2K2Q A;  1X3O A;  1E6J P;  3GJN A;  1N8R Q;  3CMA P;  4XRQ A;  2MR8 A;  3G21 A;  2VLN A;  2LPK A;  2K0D X;  2FVF A;  2EIA A;  3E2D A;  3NTE A;  3CCU P;  3M1M A;  3RG6 C;  1F80 D;  1IMP A;  3CPW O;  5KP6 B;  2E1M A;  3I56 P;  1RO2 A;  1KLP A;  1ZMB A;  3EJD A;  2CWO A;  3MGE A;  1VQN P;  2JGP A;  1VQP P;  2VSQ A;  3H47 A;  2AFE A;  1EMV A;  2DNW A;  4IPY A;  1YJN P;  3CCL P;  1VQM P;  2L0Q A;  4CA3 A;  3CCV P;  3CCR P;  2JAZ A;  2MY5 A;  1YJW P;  2M8N A;  4XFZ A;  2KOP A;  2LML A;  2KG8 A;  1NJI Q;  3LMO A;  5BS1 A;  4H2W C;  2N5H A;  2JBG A;  2EHT A;  5HVC A;  5HGL A;  4PH1 A;  1DV5 A;  1T8K A;  1EIA A;  3NY7 B;  1VQK P;  1UJZ A;  2KOR A;  1VKU A;  2LKI A;  3OW2 O;  4F37 A;  2FQ1 A;  1VQO P;  3G4S P;  4WYM A;  2LOL A;  2CG5 B;  1D1D A;  3GKL C;  1L0I A;  2EG5 A;  1M6N A;  4U0A A;  3B5I A;  3RG2 A;  2K0X A;  2FAD A;  2GDW A;  2XZ1 C;  3CC7 P;  3CCJ P;  2N98 A;  4R0M A;  2NO8 A;  4U0D A;  1AUM A;  3G0V A;  2PEI A;  2VLQ A;  3LRY A;  1L0H A;  1Q81 Q;  1GXG A;  2N6Z A;  1NQ4 A;  2KWL A;  2OAR A;  3DS0 A;  2AFD A;  1AYI A;  3CC4 P;  2P9X A;  3CE7 A;  2CGQ A;  3GZL A;  5KP8 B;  2JO0 A;  1QVG O;  5CZD B;  2XXM A;  1VQ6 P;  2GZE A;  2KGE A;  1W2B O;  1K9M Q;  1YJ9 P;  1JJ2 O;  2QNW A;  5DCK A;  1VQ8 P;  3P05 A;  5F2K A;  2K92 A;  4BPG A;  5HGM A;  1M1K Q;  2M8P A;  3G1I A;  2KOD A;  5EJD A;  2KGA A;  2PEM A;  2PEQ A;  4XRO A;  1HY8 A;  1QRJ A;  2VLP A;  5F2O A;  1YI2 P;  2L4B A;  2XV6 A;  3G1G A;  5I4T G;  2CQ8 A;  1HQB A;  2KOO A;  2MD9 A;  1M90 Q;  2N5I A;  5KP7 B;  2PEN A;  4DG9 A;  4U0E A;  4QNB A;  2N50 A;  4U0B A;  1AF8 A; 
#chains in the Genus database with same CATH homology
 2K94 A;  2FQ1 A;  2M5R A;  2K93 A;  2AF8 A;  3EJE A;  3EJB A;  2FQ2 A;  2LOL A;  2PNG A;  4H2X C;  4H2Y C;  2FAC A;  2MF4 A;  2KOS A;  2CG5 B;  2K2Q A;  1L0I A;  4MRT C;  1X3O A;  2FAE A;  4PXH B;  2KGD A;  3RG2 A;  2K0X A;  2FAD A;  2GDW A;  2XZ1 C;  2MR8 A;  2EHS A;  5HV8 A;  2N98 A;  4R0M A;  2LPK A;  2L9F A;  2LTE A;  1OR5 A;  2XZ0 D;  2FVF A;  2LIW A;  2KGC A;  4NEO A;  1F80 D;  1L0H A;  2N6Y A;  2N6Z A;  2X2B A;  2GDX A;  4IZ6 A;  2KW2 A;  5KP6 B;  2LL8 A;  1NQ4 A;  2KWL A;  2AFD A;  2JU2 A;  1ACP A;  1DNY A;  2AVA A;  2KG6 A;  1KLP A;  2MVV A;  2KOQ A;  3EJD A;  3CE7 A;  2CGQ A;  3GZL A;  2JQ4 A;  2JGP A;  5KP8 B;  2MVU A;  5CZD B;  2LIU A;  2KR5 A;  2FVE A;  2KGE A;  2ROQ A;  2QNW A;  2VSQ A;  4HKG A;  2AFE A;  2GDY A;  4PWV B;  2K0Y A;  2DNW A;  2FQ0 A;  2K92 A;  4BPG A;  2FHS C;  2MR7 A;  2L0Q A;  4CA3 A;  5EJD A;  2KG9 A;  2KGA A;  2MY5 A;  2FVA A;  2KOP A;  1HY8 A;  2LML A;  2KG8 A;  3LMO A;  2L22 A;  4H2W C;  2JU1 A;  2N5H A;  2EHT A;  5HVC A;  2L4B A;  1DV5 A;  1T8K A;  2CQ8 A;  3NY7 B;  1HQB A;  2KOO A;  2MD9 A;  2CNR A;  4BPF A;  2N5I A;  2KOR A;  1VKU A;  5KP7 B;  4DG9 A;  2LKI A;  4BPH A;  3GZM A;  2N50 A;  1AF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...