5HV8A

Solution structure of an octanoyl- loaded acyl carrier protein domain from module mlsa2 of the mycolactone polyketide synthase.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
95
structure length
95
Chain Sequence
GSHMRLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLDLPPTLIFDHPTPHALTQHLHTRLTQSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sticky swinging arm dynamics: studies of an acyl carrier protein domain from the mycolactone polyketide synthase.
pubmed doi rcsb
source organism Mycobacterium ulcerans
molecule tags Transferase
molecule keywords Type I modular polyketide synthase
total genus 26
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5hv8A00
2MVUA 2AVAA 1OR5A 2FVAA 2KGCA 4BPFA 5CZDB 1X3OA 5KP6B 2L22A 5HVCA 2MY5A 2FQ1A 3CE7A 4H2YC 2K92A 4BPGA 5EJDA 4NEOA 2GDYA 2X2BA 4BPHA 1L0HA 1NQ4A 1L0IA 2GDWA 2AFEA 2FVEA 2JU2A 2KOQA 3EJEA 2KR5A 2M5RA 2N50A 1AF8A 2ROQA 2AFDA 2XZ0D 4HKGA 3GZMA 2K0XA 2L9FA 2GDXA 2QNWA 2CGQA 2FVFA 2K94A 2XZ1C 2CQ8A 5KP7B 2EHTA 2LIUA 2KGDA 4PWVB 4H2XC 4DG9A 1DNYA 2KOSA 2FQ2A 2LL8A 2LPKA 1DV5A 2MR8A 4CA3A 2KGAA 2EHSA 2KOOA 2KORA 2K2QA 2FAEA 3GZLA 1F80D 2AF8A 3LMOA 3NY7B 2N5IA 4H2WC 5HV8A 5KP8B 2JU1A 2FHSC 2K93A 2MD9A 1T8KA 2N5HA 2KG8A 2FADA 2LOLA 2KOPA 3EJBA 2JGPA 2LKIA 2FACA 4MRTC 2LMLA 2LIWA 2LTEA 2VSQA 1ACPA 2N6ZA 1HY8A 1VKUA 2N98A 2PNGA 2KG9A 2CNRA 1KLPA 2KG6A 2MR7A 2K0YA 4R0MA 2MF4A 2L4BA 2FQ0A 2CG5B 4IZ6A 1HQBA 2JQ4A 4PXHB 2KWLA 3RG2A 3EJDA 2N6YA 2DNWA 2L0QA 2KW2A 2MVVA 2KGEA
chains in the Genus database with same CATH superfamily
2DGYA 2KODA 1QVGO 2FVAA 2KGCA 3I56P 4BPFA 5CZDB 1VQMP 2PY8A 2L22A 1VQ7P 5BS1A 2MY5A 3CC2P 3G4SP 5F2OA 4BPGA 2QA4P 1UJZA 4NEOA 1NQ4A 2GDWA 1L0IA 2NO8A 1YIJP 2XXMA 2JU2A 2GZFA 3EJEA 2KR5A 1AF8A 2ROQA 4U0AA 2AFDA 2XZ0D 1KD1Q 3P05A 2L9FA 2VLOA 3B5IA 4U0DA 1VQ5P 1S72P 2OARA 1A43A 1E6JP 5JPAA 3CPWO 2M8NA 4H2XC 2K5XA 3CCUP 2FQ2A 1EMVA 2VLPA 2PENA 2JO0A 2KORA 2KOOA 2K2QA 2PEJA 4GR6A 3HZQA 1FR2A 1M6EX 2N5IA 1YJ9P 2JYLA 1ZNVA 3I55P 1Q81Q 2K93A 2MD9A 2K0DX 3M1MA 1M1KQ 2N5HA 3DS1A 2LOLA 2KOPA 4U0EA 1K30A 1W2BO 2JGPA 1K8AQ 5HGMA 1MZ8A 2LIWA 2VSQA 1ACPA 2N6ZA 1VKUA 2PNGA 5EW5E 4GR2A 3CCMP 2MR7A 2K0YA 2PEQA 1ZMBA 1BAJA 1CEIA 3DS2A 2M8PA 2DNWA 2MVUA 3MGEA 1RO0A 3DPHA 3CCJP 1EIAA 1VQKP 3G0VA 1RO2A 1K73Q 1YITP 5HVCA 3CCRP 2K92A 1YHQP 2JYGA 1Q82Q 1L0HA 2PEIA 2FVEA 3G71P 1BXIA 2N50A 7CEIA 2CWOA 4HKGA 3H4EA 1IUQA 1QVFO 2GDXA 2FVFA 2XZ1C 2CQ8A 2KGDA 2BHVA 1M90Q 1DNYA 1KQSO 3U43A 3LMOA 3CC4P 1UNKA 5F2KA 4H2WC 4U0CA 5HV8A 1VQOP 4XRQA 3DTJA 1YJNP 2VLQA 1T8KA 1VQNP 2FADA 1VQ8P 2QEXP 2EFJA 3CMAP 2FACA 2VLNA 5F2NA 2LTEA 2N98A 4QNBA 3CXCO 2Z46A 2KG6A 4XFYA 3DS0A 4R0MA 2L4BA 4XFZA 1GXGA 2FQ0A 1E0HA 4IZ6A 3G1GA 3RG2A 3DS5A 1N8RQ 1OR5A 4XFXA 5HGNA 1Q7YQ 3GKLC 1VQ6P 3WBHA 2GDYA 4BPHA 1VQLP 3H47A 2KOQA 2M5RA 2BUOA 3CCSP 3CCVP 2XT1A 2OTLP 2QNWA 1D1DA 2CGQA 2K94A 3Q20A 1EOQA 2EIAA 2EHTA 2JBGA 2LIUA 5HGOA 1VQPP 3G6EP 3CC7P 1AUMA 1VQ9P 2PEOA 2KOSA 2LPKA 2ONTA 2L6EA 2KGAA 2FAEA 4PH1A 4COPA 1F80D 2P9XA 5DCKA 1GXHA 4UHPB 3G29A 2Z44A 5KP8B 2FHSC 3OW2O 4QKOA 2KG8A 3G21A 3CCLP 1RNIA 2LMLA 1VQ4P 2KG9A 2PEMA 2CNRA 2E1MA 4M0IA 2MF4A 1YI2P 4XROA 2JAZA 3DS4A 1HQBA 2GZIA 4PXHB 3G28A 4WYMA 2GZJA 2N6YA 4U0FA 2L0QA 2MVVA 1X3OA 3B4QA 2AVAA 1M6NA 5KP6B 5HGLA 2FQ1A 3CE7A 4H2YC 4COCA 5EJDA 2X2BA 2AFEA 3CD6P 4U0BA 3G1IA 2M8LA 3VRLC 1AYIA 3GZMA 2K0XA 1GPJA 3DS3A 3NTEA 5KP7B 1KC8Q 3G26A 4PWVB 4DG9A 2JB0A 3E2DA 1IMPA 2LL8A 1DV5A 2MR8A 2PEKA 4CA3A 1Z6MA 2EHSA 3HYBA 3GZLA 2AF8A 2GZEA 3NY7B 5I4TG 2OTJP 3CMEP 3RG6C 2GZGA 2JU1A 2ERHA 1K9MQ 3CCEP 1A8OA 2XV6A 3EJBA 1JJ2O 3LRYA 2LKIA 5BS2A 4MRTC 1Q86Q 1VHNA 3H0DA 1HY8A 4IPYA 1YJWP 1NJIQ 1M74A 1KLPA 3GJNA 1QRJA 2Z45A 3CCQP 2LF4A 2EG5A 1IMQA 2GYKA 2CG5B 2JQ4A 2KWLA 3EJDA 4PH0A 4F37A 2WPTA 2KW2A 2KGEA
chains in the Genus database with same CATH topology
2MVUA 2AVAA 1OR5A 2FVAA 2KGCA 4BPFA 5CZDB 1X3OA 5KP6B 2L22A 5HVCA 2MY5A 2FQ1A 3CE7A 4H2YC 2K92A 4BPGA 5EJDA 4NEOA 2GDYA 2X2BA 4BPHA 1L0HA 1NQ4A 1L0IA 2GDWA 2AFEA 2FVEA 2JU2A 2KOQA 3EJEA 2KR5A 2M5RA 2N50A 1AF8A 2ROQA 2AFDA 2XZ0D 4HKGA 3GZMA 2K0XA 2L9FA 2GDXA 2QNWA 2CGQA 2FVFA 2K94A 2XZ1C 2CQ8A 5KP7B 2EHTA 2LIUA 2KGDA 4PWVB 4H2XC 4DG9A 1DNYA 2KOSA 2FQ2A 2LL8A 2LPKA 1DV5A 2MR8A 4CA3A 2KGAA 2EHSA 2KOOA 2KORA 2K2QA 2FAEA 3GZLA 1F80D 2AF8A 3LMOA 3NY7B 2N5IA 4H2WC 5HV8A 5KP8B 2JU1A 2FHSC 2K93A 2MD9A 1T8KA 2N5HA 2KG8A 2FADA 2LOLA 2KOPA 3EJBA 2JGPA 2LKIA 2FACA 4MRTC 2LMLA 2LIWA 2LTEA 2VSQA 1ACPA 2N6ZA 1HY8A 1VKUA 2N98A 2PNGA 2KG9A 2CNRA 1KLPA 2KG6A 2MR7A 2K0YA 4R0MA 2MF4A 2L4BA 2FQ0A 2CG5B 4IZ6A 1HQBA 2JQ4A 4PXHB 2KWLA 3RG2A 3EJDA 2N6YA 2DNWA 2L0QA 2KW2A 2MVVA 2KGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MVU A;  2AVA A;  1OR5 A;  2FVA A;  2KGC A;  4BPF A;  5CZD B;  1X3O A;  5KP6 B;  2L22 A;  5HVC A;  2MY5 A;  2FQ1 A;  3CE7 A;  4H2Y C;  2K92 A;  4BPG A;  5EJD A;  4NEO A;  2GDY A;  2X2B A;  4BPH A;  1L0H A;  1NQ4 A;  1L0I A;  2GDW A;  2AFE A;  2FVE A;  2JU2 A;  2KOQ A;  3EJE A;  2KR5 A;  2M5R A;  2N50 A;  1AF8 A;  2ROQ A;  2AFD A;  2XZ0 D;  4HKG A;  3GZM A;  2K0X A;  2L9F A;  2GDX A;  2QNW A;  2CGQ A;  2FVF A;  2K94 A;  2XZ1 C;  2CQ8 A;  5KP7 B;  2EHT A;  2LIU A;  2KGD A;  4PWV B;  4H2X C;  4DG9 A;  1DNY A;  2KOS A;  2FQ2 A;  2LL8 A;  2LPK A;  1DV5 A;  2MR8 A;  4CA3 A;  2KGA A;  2EHS A;  2KOO A;  2KOR A;  2K2Q A;  2FAE A;  3GZL A;  1F80 D;  2AF8 A;  3LMO A;  3NY7 B;  2N5I A;  4H2W C;  5HV8 A;  5KP8 B;  2JU1 A;  2FHS C;  2K93 A;  2MD9 A;  1T8K A;  2N5H A;  2KG8 A;  2FAD A;  2LOL A;  2KOP A;  3EJB A;  2JGP A;  2LKI A;  2FAC A;  4MRT C;  2LML A;  2LIW A;  2LTE A;  2VSQ A;  1ACP A;  2N6Z A;  1HY8 A;  1VKU A;  2N98 A;  2PNG A;  2KG9 A;  2CNR A;  1KLP A;  2KG6 A;  2MR7 A;  2K0Y A;  4R0M A;  2MF4 A;  2L4B A;  2FQ0 A;  2CG5 B;  4IZ6 A;  1HQB A;  2JQ4 A;  4PXH B;  2KWL A;  3RG2 A;  3EJD A;  2N6Y A;  2DNW A;  2L0Q A;  2KW2 A;  2MVV A;  2KGE A; 
#chains in the Genus database with same CATH topology
 2DGY A;  2KOD A;  1QVG O;  2FVA A;  2KGC A;  3I56 P;  4BPF A;  5CZD B;  1VQM P;  2PY8 A;  2L22 A;  1VQ7 P;  5BS1 A;  2MY5 A;  3CC2 P;  3G4S P;  5F2O A;  4BPG A;  2QA4 P;  1UJZ A;  4NEO A;  1NQ4 A;  2GDW A;  1L0I A;  2NO8 A;  1YIJ P;  2XXM A;  2JU2 A;  2GZF A;  3EJE A;  2KR5 A;  1AF8 A;  2ROQ A;  4U0A A;  2AFD A;  2XZ0 D;  1KD1 Q;  3P05 A;  2L9F A;  2VLO A;  3B5I A;  4U0D A;  1VQ5 P;  1S72 P;  2OAR A;  1A43 A;  1E6J P;  5JPA A;  3CPW O;  2M8N A;  4H2X C;  2K5X A;  3CCU P;  2FQ2 A;  1EMV A;  2VLP A;  2PEN A;  2JO0 A;  2KOR A;  2KOO A;  2K2Q A;  2PEJ A;  4GR6 A;  3HZQ A;  1FR2 A;  1M6E X;  2N5I A;  1YJ9 P;  2JYL A;  1ZNV A;  3I55 P;  1Q81 Q;  2K93 A;  2MD9 A;  2K0D X;  3M1M A;  1M1K Q;  2N5H A;  3DS1 A;  2LOL A;  2KOP A;  4U0E A;  1K30 A;  1W2B O;  2JGP A;  1K8A Q;  5HGM A;  1MZ8 A;  2LIW A;  2VSQ A;  1ACP A;  2N6Z A;  1VKU A;  2PNG A;  5EW5 E;  4GR2 A;  3CCM P;  2MR7 A;  2K0Y A;  2PEQ A;  1ZMB A;  1BAJ A;  1CEI A;  3DS2 A;  2M8P A;  2DNW A;  2MVU A;  3MGE A;  1RO0 A;  3DPH A;  3CCJ P;  1EIA A;  1VQK P;  3G0V A;  1RO2 A;  1K73 Q;  1YIT P;  5HVC A;  3CCR P;  2K92 A;  1YHQ P;  2JYG A;  1Q82 Q;  1L0H A;  2PEI A;  2FVE A;  3G71 P;  1BXI A;  2N50 A;  7CEI A;  2CWO A;  4HKG A;  3H4E A;  1IUQ A;  1QVF O;  2GDX A;  2FVF A;  2XZ1 C;  2CQ8 A;  2KGD A;  2BHV A;  1M90 Q;  1DNY A;  1KQS O;  3U43 A;  3LMO A;  3CC4 P;  1UNK A;  5F2K A;  4H2W C;  4U0C A;  5HV8 A;  1VQO P;  4XRQ A;  3DTJ A;  1YJN P;  2VLQ A;  1T8K A;  1VQN P;  2FAD A;  1VQ8 P;  2QEX P;  2EFJ A;  3CMA P;  2FAC A;  2VLN A;  5F2N A;  2LTE A;  2N98 A;  4QNB A;  3CXC O;  2Z46 A;  2KG6 A;  4XFY A;  3DS0 A;  4R0M A;  2L4B A;  4XFZ A;  1GXG A;  2FQ0 A;  1E0H A;  4IZ6 A;  3G1G A;  3RG2 A;  3DS5 A;  1N8R Q;  1OR5 A;  4XFX A;  5HGN A;  1Q7Y Q;  3GKL C;  1VQ6 P;  3WBH A;  2GDY A;  4BPH A;  1VQL P;  3H47 A;  2KOQ A;  2M5R A;  2BUO A;  3CCS P;  3CCV P;  2XT1 A;  2OTL P;  2QNW A;  1D1D A;  2CGQ A;  2K94 A;  3Q20 A;  1EOQ A;  2EIA A;  2EHT A;  2JBG A;  2LIU A;  5HGO A;  1VQP P;  3G6E P;  3CC7 P;  1AUM A;  1VQ9 P;  2PEO A;  2KOS A;  2LPK A;  2ONT A;  2L6E A;  2KGA A;  2FAE A;  4PH1 A;  4COP A;  1F80 D;  2P9X A;  5DCK A;  1GXH A;  4UHP B;  3G29 A;  2Z44 A;  5KP8 B;  2FHS C;  3OW2 O;  4QKO A;  2KG8 A;  3G21 A;  3CCL P;  1RNI A;  2LML A;  1VQ4 P;  2KG9 A;  2PEM A;  2CNR A;  2E1M A;  4M0I A;  2MF4 A;  1YI2 P;  4XRO A;  2JAZ A;  3DS4 A;  1HQB A;  2GZI A;  4PXH B;  3G28 A;  4WYM A;  2GZJ A;  2N6Y A;  4U0F A;  2L0Q A;  2MVV A;  1X3O A;  3B4Q A;  2AVA A;  1M6N A;  5KP6 B;  5HGL A;  2FQ1 A;  3CE7 A;  4H2Y C;  4COC A;  5EJD A;  2X2B A;  2AFE A;  3CD6 P;  4U0B A;  3G1I A;  2M8L A;  3VRL C;  1AYI A;  3GZM A;  2K0X A;  1GPJ A;  3DS3 A;  3NTE A;  5KP7 B;  1KC8 Q;  3G26 A;  4PWV B;  4DG9 A;  2JB0 A;  3E2D A;  1IMP A;  2LL8 A;  1DV5 A;  2MR8 A;  2PEK A;  4CA3 A;  1Z6M A;  2EHS A;  3HYB A;  3GZL A;  2AF8 A;  2GZE A;  3NY7 B;  5I4T G;  2OTJ P;  3CME P;  3RG6 C;  2GZG A;  2JU1 A;  2ERH A;  1K9M Q;  3CCE P;  1A8O A;  2XV6 A;  3EJB A;  1JJ2 O;  3LRY A;  2LKI A;  5BS2 A;  4MRT C;  1Q86 Q;  1VHN A;  3H0D A;  1HY8 A;  4IPY A;  1YJW P;  1NJI Q;  1M74 A;  1KLP A;  3GJN A;  1QRJ A;  2Z45 A;  3CCQ P;  2LF4 A;  2EG5 A;  1IMQ A;  2GYK A;  2CG5 B;  2JQ4 A;  2KWL A;  3EJD A;  4PH0 A;  4F37 A;  2WPT A;  2KW2 A;  2KGE A; 
#chains in the Genus database with same CATH homology
 2MVU A;  2AVA A;  1OR5 A;  2FVA A;  2KGC A;  4BPF A;  5CZD B;  1X3O A;  5KP6 B;  2L22 A;  5HVC A;  2MY5 A;  2FQ1 A;  3CE7 A;  4H2Y C;  2K92 A;  4BPG A;  5EJD A;  4NEO A;  2GDY A;  2X2B A;  4BPH A;  1L0H A;  1NQ4 A;  1L0I A;  2GDW A;  2AFE A;  2FVE A;  2JU2 A;  2KOQ A;  3EJE A;  2KR5 A;  2M5R A;  2N50 A;  1AF8 A;  2ROQ A;  2AFD A;  2XZ0 D;  4HKG A;  3GZM A;  2K0X A;  2L9F A;  2GDX A;  2QNW A;  2CGQ A;  2FVF A;  2K94 A;  2XZ1 C;  2CQ8 A;  5KP7 B;  2EHT A;  2LIU A;  2KGD A;  4PWV B;  4H2X C;  4DG9 A;  1DNY A;  2KOS A;  2FQ2 A;  2LL8 A;  2LPK A;  1DV5 A;  2MR8 A;  4CA3 A;  2KGA A;  2EHS A;  2KOO A;  2KOR A;  2K2Q A;  2FAE A;  3GZL A;  1F80 D;  2AF8 A;  3LMO A;  3NY7 B;  2N5I A;  4H2W C;  5HV8 A;  5KP8 B;  2JU1 A;  2FHS C;  2K93 A;  2MD9 A;  1T8K A;  2N5H A;  2KG8 A;  2FAD A;  2LOL A;  2KOP A;  3EJB A;  2JGP A;  2LKI A;  2FAC A;  4MRT C;  2LML A;  2LIW A;  2LTE A;  2VSQ A;  1ACP A;  2N6Z A;  1HY8 A;  1VKU A;  2N98 A;  2PNG A;  2KG9 A;  2CNR A;  1KLP A;  2KG6 A;  2MR7 A;  2K0Y A;  4R0M A;  2MF4 A;  2L4B A;  2FQ0 A;  2CG5 B;  4IZ6 A;  1HQB A;  2JQ4 A;  4PXH B;  2KWL A;  3RG2 A;  3EJD A;  2N6Y A;  2DNW A;  2L0Q A;  2KW2 A;  2MVV A;  2KGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...