5HV8A

Solution structure of an octanoyl- loaded acyl carrier protein domain from module mlsa2 of the mycolactone polyketide synthase.
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
95
structure length
95
Chain Sequence
GSHMRLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLDLPPTLIFDHPTPHALTQHLHTRLTQSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Type I modular polyketide synthase
publication title Sticky swinging arm dynamics: studies of an acyl carrier protein domain from the mycolactone polyketide synthase.
pubmed doi rcsb
source organism Mycobacterium ulcerans
molecule tags Transferase
total genus 26
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5hv8A00
1T8KA 2CG5B 2K94A 2L9FA 2XZ0D 2JU2A 2N6ZA 1DV5A 2X2BA 1DNYA 5EJDA 5KP7B 2JGPA 2MD9A 2FHSC 2FVFA 4BPGA 4PXHB 2CGQA 4NEOA 3EJEA 5CZDB 1KLPA 2LIUA 5KP8B 2KW2A 2GDXA 2FVAA 2M5RA 2MF4A 4R0MA 2AFDA 1OR5A 2KG6A 2MR8A 2KR5A 4BPFA 2EHSA 2FVEA 5KP6B 2K0XA 2MVUA 2PNGA 2FADA 2CNRA 2L4BA 2FQ2A 2N5HA 2KORA 2LL8A 3RG2A 2FACA 2KGEA 2LTEA 2KGCA 1ACPA 2LOLA 2ROQA 4H2XC 3GZMA 2KOPA 4DG9A 4IZ6A 4PWVB 2L0QA 1AF8A 3EJDA 2MY5A 4HKGA 2KG8A 2K93A 2FQ1A 1HY8A 2AFEA 2KOQA 2KWLA 1X3OA 2LIWA 2JQ4A 2LKIA 3EJBA 4CA3A 2GDWA 5HVCA 4H2WC 1VKUA 2LMLA 2L22A 4MRTC 2FAEA 3GZLA 2KGDA 4BPHA 1L0HA 2MR7A 3LMOA 2MVVA 1L0IA 2DNWA 2QNWA 2N98A 1NQ4A 2LPKA 3NY7B 2N50A 2FQ0A 2AVAA 2KOOA 4H2YC 2EHTA 3CE7A 2KG9A 2AF8A 2K0YA 2XZ1C 2K92A 5HV8A 2GDYA 1HQBA 2KGAA 2N6YA 2VSQA 2N5IA 2KOSA 2JU1A 2CQ8A 1F80D 2K2QA
chains in the Genus database with same CATH superfamily
1ZMBA 1RNIA 3G1GA 2XZ0D 1DV5A 5F2NA 4BPGA 4NEOA 2VLOA 2JB0A 1KLPA 2LIUA 4IPYA 4F37A 5I4TG 3CMEP 1K8AQ 4COPA 3G71P 1A43A 2MR8A 2EHSA 2Z46A 5BS2A 1YJWP 2CWOA 1YITP 2FADA 1RO0A 2FQ2A 3DS5A 4XROA 1YJ9P 1K9MQ 3CXCO 7CEIA 2KORA 4H2XC 1Q82Q 1N8RQ 2KOPA 4PWVB 1EMVA 2K93A 1HY8A 1VQMP 2BHVA 2JQ4A 1VQ8P 3DS2A 5HGNA 2OTJP 2M8NA 2GZFA 4H2WC 1ZNVA 2K0DX 1KQSO 2L22A 1IUQA 1NJIQ 3CMAP 3CCJP 2MR7A 4XFZA 2DNWA 3DS4A 1MZ8A 3G29A 5DCKA 2LPKA 3GKLC 1GPJA 2PEOA 2N50A 1VQLP 2KOOA 2JBGA 3CE7A 1YIJP 5HV8A 3G0VA 2KOSA 3G26A 1D1DA 2PEQA 2JU1A 1F80D 2L6EA 2K2QA 2K94A 2N6ZA 2X2BA 5EJDA 2GYKA 1M6NA 2FHSC 2PEKA 4PXHB 1EIAA 1RO2A 3EJEA 2GZGA 5CZDB 2E1MA 3CD6P 2K5XA 5HGMA 2KW2A 2MF4A 4U0DA 2Z44A 5KP6B 2MVUA 1BAJA 3H47A 3CCUP 2L4BA 3CCSP 2LL8A 3RG2A 2FACA 1VQOP 3B5IA 2GZIA 1W2BO 4QKOA 2LOLA 1KD1Q 1IMPA 2MY5A 2KG8A 1YJNP 4GR2A 5HGLA 2FQ1A 2AFEA 3I56P 2KOQA 2KWLA 1X3OA 2LIWA 2OARA 3LRYA 3EJBA 2QEXP 2GDWA 3H4EA 1M90Q 3VRLC 4BPHA 3GJNA 2VLPA 3LMOA 1L0IA 3DS0A 3HZQA 2VLQA 3OW2O 3NY7B 2EIAA 4U0EA 1Q81Q 3CCQP 1KC8Q 2XZ1C 1K30A 2GDYA 2NO8A 2N6YA 1BXIA 4WYMA 2CQ8A 2L9FA 3CC4P 1QVGO 1DNYA 2MD9A 2FVFA 2CGQA 1K73Q 4PH1A 3CCMP 3CCEP 5HGOA 3Q20A 1M1KQ 2GDXA 2FVAA 1CEIA 4R0MA 4XFXA 2KG6A 2JYLA 1AUMA 2KR5A 1VQKP 3G6EP 2XXMA 2PNGA 3U43A 1VQ7P 2N5HA 4PH0A 1EOQA 4COCA 2KGEA 1VQ5P 2PENA 1IMQA 3G21A 4U0AA 2XV6A 1VQPP 3G4SP 1QRJA 4U0BA 1S72P 2OTLP 3DS1A 5EW5E 1VQ4P 1VKUA 2LMLA 2Z45A 2EFJA 2FAEA 1FR2A 3G28A 2PY8A 1L0HA 1VHNA 4U0CA 2P9XA 5F2KA 2ONTA 1NQ4A 2DGYA 2FQ0A 2AVAA 5JPAA 4H2YC 2EHTA 2K0YA 2K92A 4XRQA 1HQBA 3H0DA 2KGAA 2VSQA 2N5IA 1VQNP 1T8KA 2CG5B 1E6JP 3WBHA 2JU2A 1E0HA 3NTEA 5KP7B 2JGPA 2PEIA 1VQ9P 4M0IA 1M74A 2XT1A 1M6EX 3DPHA 4XFYA 3B4QA 5F2OA 1QVFO 5KP8B 2ERHA 2KODA 2M5RA 2M8LA 1GXHA 2AFDA 5BS1A 1OR5A 3CCRP 3G1IA 4QNBA 4BPFA 2BUOA 3HYBA 2FVEA 2K0XA 2GZEA 2PEJA 1A8OA 1UJZA 2CNRA 2GZJA 3E2DA 1Q86Q 3P05A 2QA4P 3RG6C 2LTEA 1ACPA 2KGCA 2ROQA 3CPWO 3GZMA 4DG9A 4IZ6A 2PEMA 2L0QA 1AF8A 3EJDA 1JJ2O 3MGEA 4HKGA 2JYGA 3I55P 4GR6A 1YHQP 3CC2P 3CCLP 1VQ6P 2LKIA 4U0FA 4CA3A 3M1MA 2JAZA 5HVCA 2VLNA 4UHPB 2M8PA 4MRTC 3GZLA 2KGDA 3DS3A 2MVVA 1Q7YQ 2EG5A 2QNWA 2N98A 1GXGA 1YI2P 1AYIA 2WPTA 2KG9A 2LF4A 2AF8A 2JO0A 3CC7P 3DTJA 1Z6MA 1UNKA 3CCVP
chains in the Genus database with same CATH topology
1T8KA 2CG5B 2K94A 2L9FA 2XZ0D 2JU2A 2N6ZA 1DV5A 2X2BA 1DNYA 5EJDA 5KP7B 2JGPA 2MD9A 2FHSC 2FVFA 4BPGA 4PXHB 2CGQA 4NEOA 3EJEA 5CZDB 1KLPA 2LIUA 5KP8B 2KW2A 2GDXA 2FVAA 2M5RA 2MF4A 4R0MA 2AFDA 1OR5A 2KG6A 2MR8A 2KR5A 4BPFA 2EHSA 2FVEA 5KP6B 2K0XA 2MVUA 2PNGA 2FADA 2CNRA 2L4BA 2FQ2A 2N5HA 2KORA 2LL8A 3RG2A 2FACA 2KGEA 2LTEA 2KGCA 1ACPA 2LOLA 2ROQA 4H2XC 3GZMA 2KOPA 4DG9A 4IZ6A 4PWVB 2L0QA 1AF8A 3EJDA 2MY5A 4HKGA 2KG8A 2K93A 2FQ1A 1HY8A 2AFEA 2KOQA 2KWLA 1X3OA 2LIWA 2JQ4A 2LKIA 3EJBA 4CA3A 2GDWA 5HVCA 4H2WC 1VKUA 2LMLA 2L22A 4MRTC 2FAEA 3GZLA 2KGDA 4BPHA 1L0HA 2MR7A 3LMOA 2MVVA 1L0IA 2DNWA 2QNWA 2N98A 1NQ4A 2LPKA 3NY7B 2N50A 2FQ0A 2AVAA 2KOOA 4H2YC 2EHTA 3CE7A 2KG9A 2AF8A 2K0YA 2XZ1C 2K92A 5HV8A 2GDYA 1HQBA 2KGAA 2N6YA 2VSQA 2N5IA 2KOSA 2JU1A 2CQ8A 1F80D 2K2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T8K A;  2CG5 B;  2K94 A;  2L9F A;  2XZ0 D;  2JU2 A;  2N6Z A;  1DV5 A;  2X2B A;  1DNY A;  5EJD A;  5KP7 B;  2JGP A;  2MD9 A;  2FHS C;  2FVF A;  4BPG A;  4PXH B;  2CGQ A;  4NEO A;  3EJE A;  5CZD B;  1KLP A;  2LIU A;  5KP8 B;  2KW2 A;  2GDX A;  2FVA A;  2M5R A;  2MF4 A;  4R0M A;  2AFD A;  1OR5 A;  2KG6 A;  2MR8 A;  2KR5 A;  4BPF A;  2EHS A;  2FVE A;  5KP6 B;  2K0X A;  2MVU A;  2PNG A;  2FAD A;  2CNR A;  2L4B A;  2FQ2 A;  2N5H A;  2KOR A;  2LL8 A;  3RG2 A;  2FAC A;  2KGE A;  2LTE A;  2KGC A;  1ACP A;  2LOL A;  2ROQ A;  4H2X C;  3GZM A;  2KOP A;  4DG9 A;  4IZ6 A;  4PWV B;  2L0Q A;  1AF8 A;  3EJD A;  2MY5 A;  4HKG A;  2KG8 A;  2K93 A;  2FQ1 A;  1HY8 A;  2AFE A;  2KOQ A;  2KWL A;  1X3O A;  2LIW A;  2JQ4 A;  2LKI A;  3EJB A;  4CA3 A;  2GDW A;  5HVC A;  4H2W C;  1VKU A;  2LML A;  2L22 A;  4MRT C;  2FAE A;  3GZL A;  2KGD A;  4BPH A;  1L0H A;  2MR7 A;  3LMO A;  2MVV A;  1L0I A;  2DNW A;  2QNW A;  2N98 A;  1NQ4 A;  2LPK A;  3NY7 B;  2N50 A;  2FQ0 A;  2AVA A;  2KOO A;  4H2Y C;  2EHT A;  3CE7 A;  2KG9 A;  2AF8 A;  2K0Y A;  2XZ1 C;  2K92 A;  5HV8 A;  2GDY A;  1HQB A;  2KGA A;  2N6Y A;  2VSQ A;  2N5I A;  2KOS A;  2JU1 A;  2CQ8 A;  1F80 D;  2K2Q A; 
#chains in the Genus database with same CATH topology
 1ZMB A;  1RNI A;  3G1G A;  2XZ0 D;  1DV5 A;  5F2N A;  4BPG A;  4NEO A;  2VLO A;  2JB0 A;  1KLP A;  2LIU A;  4IPY A;  4F37 A;  5I4T G;  3CME P;  1K8A Q;  4COP A;  3G71 P;  1A43 A;  2MR8 A;  2EHS A;  2Z46 A;  5BS2 A;  1YJW P;  2CWO A;  1YIT P;  2FAD A;  1RO0 A;  2FQ2 A;  3DS5 A;  4XRO A;  1YJ9 P;  1K9M Q;  3CXC O;  7CEI A;  2KOR A;  4H2X C;  1Q82 Q;  1N8R Q;  2KOP A;  4PWV B;  1EMV A;  2K93 A;  1HY8 A;  1VQM P;  2BHV A;  2JQ4 A;  1VQ8 P;  3DS2 A;  5HGN A;  2OTJ P;  2M8N A;  2GZF A;  4H2W C;  1ZNV A;  2K0D X;  1KQS O;  2L22 A;  1IUQ A;  1NJI Q;  3CMA P;  3CCJ P;  2MR7 A;  4XFZ A;  2DNW A;  3DS4 A;  1MZ8 A;  3G29 A;  5DCK A;  2LPK A;  3GKL C;  1GPJ A;  2PEO A;  2N50 A;  1VQL P;  2KOO A;  2JBG A;  3CE7 A;  1YIJ P;  5HV8 A;  3G0V A;  2KOS A;  3G26 A;  1D1D A;  2PEQ A;  2JU1 A;  1F80 D;  2L6E A;  2K2Q A;  2K94 A;  2N6Z A;  2X2B A;  5EJD A;  2GYK A;  1M6N A;  2FHS C;  2PEK A;  4PXH B;  1EIA A;  1RO2 A;  3EJE A;  2GZG A;  5CZD B;  2E1M A;  3CD6 P;  2K5X A;  5HGM A;  2KW2 A;  2MF4 A;  4U0D A;  2Z44 A;  5KP6 B;  2MVU A;  1BAJ A;  3H47 A;  3CCU P;  2L4B A;  3CCS P;  2LL8 A;  3RG2 A;  2FAC A;  1VQO P;  3B5I A;  2GZI A;  1W2B O;  4QKO A;  2LOL A;  1KD1 Q;  1IMP A;  2MY5 A;  2KG8 A;  1YJN P;  4GR2 A;  5HGL A;  2FQ1 A;  2AFE A;  3I56 P;  2KOQ A;  2KWL A;  1X3O A;  2LIW A;  2OAR A;  3LRY A;  3EJB A;  2QEX P;  2GDW A;  3H4E A;  1M90 Q;  3VRL C;  4BPH A;  3GJN A;  2VLP A;  3LMO A;  1L0I A;  3DS0 A;  3HZQ A;  2VLQ A;  3OW2 O;  3NY7 B;  2EIA A;  4U0E A;  1Q81 Q;  3CCQ P;  1KC8 Q;  2XZ1 C;  1K30 A;  2GDY A;  2NO8 A;  2N6Y A;  1BXI A;  4WYM A;  2CQ8 A;  2L9F A;  3CC4 P;  1QVG O;  1DNY A;  2MD9 A;  2FVF A;  2CGQ A;  1K73 Q;  4PH1 A;  3CCM P;  3CCE P;  5HGO A;  3Q20 A;  1M1K Q;  2GDX A;  2FVA A;  1CEI A;  4R0M A;  4XFX A;  2KG6 A;  2JYL A;  1AUM A;  2KR5 A;  1VQK P;  3G6E P;  2XXM A;  2PNG A;  3U43 A;  1VQ7 P;  2N5H A;  4PH0 A;  1EOQ A;  4COC A;  2KGE A;  1VQ5 P;  2PEN A;  1IMQ A;  3G21 A;  4U0A A;  2XV6 A;  1VQP P;  3G4S P;  1QRJ A;  4U0B A;  1S72 P;  2OTL P;  3DS1 A;  5EW5 E;  1VQ4 P;  1VKU A;  2LML A;  2Z45 A;  2EFJ A;  2FAE A;  1FR2 A;  3G28 A;  2PY8 A;  1L0H A;  1VHN A;  4U0C A;  2P9X A;  5F2K A;  2ONT A;  1NQ4 A;  2DGY A;  2FQ0 A;  2AVA A;  5JPA A;  4H2Y C;  2EHT A;  2K0Y A;  2K92 A;  4XRQ A;  1HQB A;  3H0D A;  2KGA A;  2VSQ A;  2N5I A;  1VQN P;  1T8K A;  2CG5 B;  1E6J P;  3WBH A;  2JU2 A;  1E0H A;  3NTE A;  5KP7 B;  2JGP A;  2PEI A;  1VQ9 P;  4M0I A;  1M74 A;  2XT1 A;  1M6E X;  3DPH A;  4XFY A;  3B4Q A;  5F2O A;  1QVF O;  5KP8 B;  2ERH A;  2KOD A;  2M5R A;  2M8L A;  1GXH A;  2AFD A;  5BS1 A;  1OR5 A;  3CCR P;  3G1I A;  4QNB A;  4BPF A;  2BUO A;  3HYB A;  2FVE A;  2K0X A;  2GZE A;  2PEJ A;  1A8O A;  1UJZ A;  2CNR A;  2GZJ A;  3E2D A;  1Q86 Q;  3P05 A;  2QA4 P;  3RG6 C;  2LTE A;  1ACP A;  2KGC A;  2ROQ A;  3CPW O;  3GZM A;  4DG9 A;  4IZ6 A;  2PEM A;  2L0Q A;  1AF8 A;  3EJD A;  1JJ2 O;  3MGE A;  4HKG A;  2JYG A;  3I55 P;  4GR6 A;  1YHQ P;  3CC2 P;  3CCL P;  1VQ6 P;  2LKI A;  4U0F A;  4CA3 A;  3M1M A;  2JAZ A;  5HVC A;  2VLN A;  4UHP B;  2M8P A;  4MRT C;  3GZL A;  2KGD A;  3DS3 A;  2MVV A;  1Q7Y Q;  2EG5 A;  2QNW A;  2N98 A;  1GXG A;  1YI2 P;  1AYI A;  2WPT A;  2KG9 A;  2LF4 A;  2AF8 A;  2JO0 A;  3CC7 P;  3DTJ A;  1Z6M A;  1UNK A;  3CCV P; 
#chains in the Genus database with same CATH homology
 1T8K A;  2CG5 B;  2K94 A;  2L9F A;  2XZ0 D;  2JU2 A;  2N6Z A;  1DV5 A;  2X2B A;  1DNY A;  5EJD A;  5KP7 B;  2JGP A;  2MD9 A;  2FHS C;  2FVF A;  4BPG A;  4PXH B;  2CGQ A;  4NEO A;  3EJE A;  5CZD B;  1KLP A;  2LIU A;  5KP8 B;  2KW2 A;  2GDX A;  2FVA A;  2M5R A;  2MF4 A;  4R0M A;  2AFD A;  1OR5 A;  2KG6 A;  2MR8 A;  2KR5 A;  4BPF A;  2EHS A;  2FVE A;  5KP6 B;  2K0X A;  2MVU A;  2PNG A;  2FAD A;  2CNR A;  2L4B A;  2FQ2 A;  2N5H A;  2KOR A;  2LL8 A;  3RG2 A;  2FAC A;  2KGE A;  2LTE A;  2KGC A;  1ACP A;  2LOL A;  2ROQ A;  4H2X C;  3GZM A;  2KOP A;  4DG9 A;  4IZ6 A;  4PWV B;  2L0Q A;  1AF8 A;  3EJD A;  2MY5 A;  4HKG A;  2KG8 A;  2K93 A;  2FQ1 A;  1HY8 A;  2AFE A;  2KOQ A;  2KWL A;  1X3O A;  2LIW A;  2JQ4 A;  2LKI A;  3EJB A;  4CA3 A;  2GDW A;  5HVC A;  4H2W C;  1VKU A;  2LML A;  2L22 A;  4MRT C;  2FAE A;  3GZL A;  2KGD A;  4BPH A;  1L0H A;  2MR7 A;  3LMO A;  2MVV A;  1L0I A;  2DNW A;  2QNW A;  2N98 A;  1NQ4 A;  2LPK A;  3NY7 B;  2N50 A;  2FQ0 A;  2AVA A;  2KOO A;  4H2Y C;  2EHT A;  3CE7 A;  2KG9 A;  2AF8 A;  2K0Y A;  2XZ1 C;  2K92 A;  5HV8 A;  2GDY A;  1HQB A;  2KGA A;  2N6Y A;  2VSQ A;  2N5I A;  2KOS A;  2JU1 A;  2CQ8 A;  1F80 D;  2K2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...