3G28A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: mutant d179n, low ph
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSNLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g28A00
2KODA 1D1DA 5HGLA 1EIAA 3DS4A 3G1IA 2JO0A 3P05A 3H47A 3DS1A 4U0EA 4QNBA 2L6EA 1A8OA 4M0IA 2M8NA 4COCA 1A43A 2XT1A 3DPHA 4U0AA 4XROA 1QRJA 5HGNA 5HGOA 4U0CA 2EIAA 2JYGA 5JPAA 5I4TG 5HGMA 4WYMA 3VRLC 3DS3A 2BUOA 2XV6A 3H4EA 3G21A 3G0VA 2XXMA 3LRYA 4U0FA 3G29A 4COPA 4PH1A 1BAJA 2JYLA 1E6JP 2LF4A 4XRQA 1EOQA 4IPYA 1AUMA 3NTEA 4PH0A 2M8PA 2ONTA 5DCKA 3MGEA 3DS2A 3DTJA 4U0BA 3G1GA 2M8LA 3G28A 3G26A 4XFZA 4XFYA 3DS5A 3DS0A 4XFXA 4U0DA
chains in the Genus database with same CATH superfamily
2VSQA 3U43A 1D1DA 1ACPA 2OTJP 2E1MA 4PWVB 2JAZA 3RG6C 4H2YC 5F2OA 3G71P 4WYMA 3CCEP 1L0IA 3OW2O 2EG5A 3NTEA 2GZEA 2XZ1C 3G1GA 3Q20A 3EJEA 2LL8A 2WPTA 2N98A 4M0IA 2LPKA 2K2QA 2XT1A 1VQ4P 2GZFA 4R0MA 3H4EA 3G21A 5EW5E 2KG6A 4COPA 1BAJA 5DCKA 3DTJA 1UNKA 4F37A 2X2BA 3CCVP 2L6EA 2FVAA 3RG2A 1KC8Q 4MRTC 3VRLC 2PEKA 5KP6B 3CCJP 2FHSC 2KR5A 2MR8A 3CMAP 1VQ8P 2EHTA 2AFDA 3CE7A 4IZ6A 3H47A 2N5IA 1QVFO 2FQ0A 5F2NA 1YJNP 2KWLA 1YITP 2EHSA 1VQNP 3I56P 2KOOA 5BS2A 2M8PA 2Z45A 1Z6MA 2M8LA 3B4QA 2MR7A 2JO0A 4DG9A 1KD1Q 1GXHA 3CC2P 2GDXA 5HGOA 5JPAA 1K73Q 2PEOA 2LIUA 2XXMA 4U0FA 2KW2A 2L22A 1YHQP 2K94A 1ZNVA 2XZ0D 2KOSA 1S72P 3I55P 2FVEA 1IUQA 2NO8A 3G4SP 4GR6A 2EIAA 2JYGA 2KORA 1M6EX 4PH1A 4IPYA 3B5IA 1AUMA 2PEQA 4NEOA 4QKOA 3H0DA 2FVFA 1HY8A 3G1IA 1QVGO 1A43A 3DS3A 2VLOA 1VKUA 3CC7P 3EJDA 2MD9A 2GZJA 2FQ1A 2KGAA 3CC4P 2KG9A 1F80D 2CNRA 3M1MA 4XFZA 1VQKP 2K93A 1AF8A 1Q82Q 5EJDA 2QEXP 3DS4A 2K0YA 4U0EA 2L4BA 3CCSP 1X3OA 2CG5B 5I4TG 2BUOA 1EMVA 2GDWA 2GZGA 1K9MQ 2K5XA 3HYBA 1DNYA 2DGYA 2KG8A 2FAEA 4XFXA 1VQ7P 1Q7YQ 1IMQA 1GPJA 1DV5A 2JU1A 4U0AA 4GR2A 5HV8A 1KLPA 2Z46A 2FACA 2JU2A 2CGQA 1RO2A 2K92A 2ONTA 3DS2A 4H2XC 2Z44A 2KGEA 2N50A 4UHPB 1VQ6P 2AFEA 4COCA 4HKGA 4U0CA 3CCLP 2L9FA 1VHNA 3CD6P 2LF4A 2MVUA 4BPHA 1VQOP 2AVAA 2KOQA 1ZMBA 2M5RA 5KP8B 3DS5A 2KODA 3G6EP 3P05A 5F2KA 3DS1A 2EFJA 2VLNA 2QA4P 3WBHA 4BPGA 1YJ9P 2GZIA 1OR5A 5CZDB 3G29A 2KOPA 4PH0A 1Q86Q 2LIWA 2GDYA 3DS0A 2PY8A 2OARA 4QNBA 3CCRP 3DPHA 2LOLA 2MVVA 1M6NA 2PENA 2N6ZA 1UJZA 4XRQA 2KGDA 2LKIA 2CQ8A 2JB0A 1NJIQ 2K0XA 2KGCA 3CMEP 4XFYA 1RNIA 1EIAA 1W2BO 2FADA 1CEIA 2JBGA 3CXCO 2M8NA 1VQ9P 1IMPA 3NY7B 4XROA 1M90Q 1MZ8A 1M74A 3CCUP 1K30A 2LMLA 2GYKA 2JYLA 1EOQA 1BXIA 1T8KA 3G28A 2PEMA 4U0DA 5HGLA 4PXHB 1VQ5P 3CCQP 1AYIA 2PEJA 1YJWP 2OTLP 5HGNA 2BHVA 5HGMA 7CEIA 3LRYA 3G0VA 2PNGA 4H2WC 2MY5A 3HZQA 2ROQA 3G26A 2JGPA 2JQ4A 4CA3A 2LTEA 1M1KQ 1N8RQ 1VQMP 1VQLP 2AF8A 1A8OA 3CPWO 2MF4A 5KP7B 1K8AQ 1Q81Q 2N5HA 3CCMP 1NQ4A 4BPFA 2VLPA 2ERHA 1E6JP 1YI2P 3GJNA 5BS1A 2FQ2A 3LMOA 3MGEA 1L0HA 4U0BA 1VQPP 1HQBA 3E2DA 2VLQA 1JJ2O 2CWOA 2QNWA 2N6YA 5HVCA 3GKLC 1QRJA 1KQSO 2XV6A 3GZLA 2K0DX 2DNWA 3GZMA 1GXGA 1RO0A 1E0HA 3EJBA 2L0QA 2PEIA 1FR2A 1YIJP 2P9XA
chains in the Genus database with same CATH topology
1D1DA 1RNIA 1EIAA 1VQ7P 1W2BO 1Q7YQ 2JO0A 2OTJP 1KD1Q 2E1MA 3CXCO 2M8NA 1VQ9P 3CC2P 4U0AA 3RG6C 4XROA 5HGOA 5F2OA 5JPAA 1K73Q 1M90Q 3G71P 4WYMA 1M74A 2PEOA 4GR2A 3CCUP 1K30A 2XXMA 4U0FA 2Z46A 3CCEP 2JYLA 3OW2O 1YHQP 1EOQA 2EG5A 3NTEA 1RO2A 2ONTA 3DS2A 3G1GA 3G28A 2Z44A 3Q20A 2PEMA 4U0DA 5HGLA 1S72P 1VQ6P 4M0IA 3I55P 3CCQP 1VQ5P 2PEJA 4COCA 1YJWP 2OTLP 2XT1A 1IUQA 5HGNA 3G4SP 1VQ4P 2BHVA 2EIAA 2JYGA 4GR6A 4U0CA 5HGMA 1M6EX 3H4EA 3G21A 3G0VA 3LRYA 3CCLP 4COPA 4PH1A 1BAJA 3CD6P 2LF4A 4IPYA 3B5IA 1AUMA 2PEQA 1VQOP 3HZQA 5DCKA 3DTJA 3G26A 1ZMBA 3H0DA 3DS5A 2KODA 3G6EP 1M1KQ 1N8RQ 1VQMP 3G1IA 4XFXA 3P05A 5F2KA 3DS1A 3CCVP 2EFJA 1VQLP 2L6EA 1A8OA 3CPWO 1QVGO 1K8AQ 1Q81Q 2QA4P 1A43A 3WBHA 1YJ9P 1KC8Q 3VRLC 3DS3A 3CCMP 2PEKA 3CC7P 3CCJP 3G29A 1E6JP 1YI2P 5BS1A 4PH0A 1Q86Q 3CMAP 3MGEA 4U0BA 1VQPP 1VQ8P 3CC4P 3M1MA 4XFZA 1VQKP 3E2DA 3DS0A 1Q82Q 2PY8A 2QEXP 2OARA 3DS4A 4U0EA 1JJ2O 3H47A 2CWOA 1QVFO 4QNBA 3CCSP 3CCRP 3DPHA 5F2NA 1QRJA 1KQSO 5I4TG 1YJNP 1YITP 2BUOA 2XV6A 1M6NA 1VQNP 2PENA 3I56P 4XRQA 1K9MQ 5BS2A 1RO0A 2M8PA 2Z45A 2M8LA 3HYBA 1NJIQ 3CMEP 2DGYA 2PEIA 4XFYA 1YIJP 2P9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOD A;  1D1D A;  5HGL A;  1EIA A;  3DS4 A;  3G1I A;  2JO0 A;  3P05 A;  3H47 A;  3DS1 A;  4U0E A;  4QNB A;  2L6E A;  1A8O A;  4M0I A;  2M8N A;  4COC A;  1A43 A;  2XT1 A;  3DPH A;  4U0A A;  4XRO A;  1QRJ A;  5HGN A;  5HGO A;  4U0C A;  2EIA A;  2JYG A;  5JPA A;  5I4T G;  5HGM A;  4WYM A;  3VRL C;  3DS3 A;  2BUO A;  2XV6 A;  3H4E A;  3G21 A;  3G0V A;  2XXM A;  3LRY A;  4U0F A;  3G29 A;  4COP A;  4PH1 A;  1BAJ A;  2JYL A;  1E6J P;  2LF4 A;  4XRQ A;  1EOQ A;  4IPY A;  1AUM A;  3NTE A;  4PH0 A;  2M8P A;  2ONT A;  5DCK A;  3MGE A;  3DS2 A;  3DTJ A;  4U0B A;  3G1G A;  2M8L A;  3G28 A;  3G26 A;  4XFZ A;  4XFY A;  3DS5 A;  3DS0 A;  4XFX A;  4U0D A; 
#chains in the Genus database with same CATH topology
 2VSQ A;  3U43 A;  1D1D A;  1ACP A;  2OTJ P;  2E1M A;  4PWV B;  2JAZ A;  3RG6 C;  4H2Y C;  5F2O A;  3G71 P;  4WYM A;  3CCE P;  1L0I A;  3OW2 O;  2EG5 A;  3NTE A;  2GZE A;  2XZ1 C;  3G1G A;  3Q20 A;  3EJE A;  2LL8 A;  2WPT A;  2N98 A;  4M0I A;  2LPK A;  2K2Q A;  2XT1 A;  1VQ4 P;  2GZF A;  4R0M A;  3H4E A;  3G21 A;  5EW5 E;  2KG6 A;  4COP A;  1BAJ A;  5DCK A;  3DTJ A;  1UNK A;  4F37 A;  2X2B A;  3CCV P;  2L6E A;  2FVA A;  3RG2 A;  1KC8 Q;  4MRT C;  3VRL C;  2PEK A;  5KP6 B;  3CCJ P;  2FHS C;  2KR5 A;  2MR8 A;  3CMA P;  1VQ8 P;  2EHT A;  2AFD A;  3CE7 A;  4IZ6 A;  3H47 A;  2N5I A;  1QVF O;  2FQ0 A;  5F2N A;  1YJN P;  2KWL A;  1YIT P;  2EHS A;  1VQN P;  3I56 P;  2KOO A;  5BS2 A;  2M8P A;  2Z45 A;  1Z6M A;  2M8L A;  3B4Q A;  2MR7 A;  2JO0 A;  4DG9 A;  1KD1 Q;  1GXH A;  3CC2 P;  2GDX A;  5HGO A;  5JPA A;  1K73 Q;  2PEO A;  2LIU A;  2XXM A;  4U0F A;  2KW2 A;  2L22 A;  1YHQ P;  2K94 A;  1ZNV A;  2XZ0 D;  2KOS A;  1S72 P;  3I55 P;  2FVE A;  1IUQ A;  2NO8 A;  3G4S P;  4GR6 A;  2EIA A;  2JYG A;  2KOR A;  1M6E X;  4PH1 A;  4IPY A;  3B5I A;  1AUM A;  2PEQ A;  4NEO A;  4QKO A;  3H0D A;  2FVF A;  1HY8 A;  3G1I A;  1QVG O;  1A43 A;  3DS3 A;  2VLO A;  1VKU A;  3CC7 P;  3EJD A;  2MD9 A;  2GZJ A;  2FQ1 A;  2KGA A;  3CC4 P;  2KG9 A;  1F80 D;  2CNR A;  3M1M A;  4XFZ A;  1VQK P;  2K93 A;  1AF8 A;  1Q82 Q;  5EJD A;  2QEX P;  3DS4 A;  2K0Y A;  4U0E A;  2L4B A;  3CCS P;  1X3O A;  2CG5 B;  5I4T G;  2BUO A;  1EMV A;  2GDW A;  2GZG A;  1K9M Q;  2K5X A;  3HYB A;  1DNY A;  2DGY A;  2KG8 A;  2FAE A;  4XFX A;  1VQ7 P;  1Q7Y Q;  1IMQ A;  1GPJ A;  1DV5 A;  2JU1 A;  4U0A A;  4GR2 A;  5HV8 A;  1KLP A;  2Z46 A;  2FAC A;  2JU2 A;  2CGQ A;  1RO2 A;  2K92 A;  2ONT A;  3DS2 A;  4H2X C;  2Z44 A;  2KGE A;  2N50 A;  4UHP B;  1VQ6 P;  2AFE A;  4COC A;  4HKG A;  4U0C A;  3CCL P;  2L9F A;  1VHN A;  3CD6 P;  2LF4 A;  2MVU A;  4BPH A;  1VQO P;  2AVA A;  2KOQ A;  1ZMB A;  2M5R A;  5KP8 B;  3DS5 A;  2KOD A;  3G6E P;  3P05 A;  5F2K A;  3DS1 A;  2EFJ A;  2VLN A;  2QA4 P;  3WBH A;  4BPG A;  1YJ9 P;  2GZI A;  1OR5 A;  5CZD B;  3G29 A;  2KOP A;  4PH0 A;  1Q86 Q;  2LIW A;  2GDY A;  3DS0 A;  2PY8 A;  2OAR A;  4QNB A;  3CCR P;  3DPH A;  2LOL A;  2MVV A;  1M6N A;  2PEN A;  2N6Z A;  1UJZ A;  4XRQ A;  2KGD A;  2LKI A;  2CQ8 A;  2JB0 A;  1NJI Q;  2K0X A;  2KGC A;  3CME P;  4XFY A;  1RNI A;  1EIA A;  1W2B O;  2FAD A;  1CEI A;  2JBG A;  3CXC O;  2M8N A;  1VQ9 P;  1IMP A;  3NY7 B;  4XRO A;  1M90 Q;  1MZ8 A;  1M74 A;  3CCU P;  1K30 A;  2LML A;  2GYK A;  2JYL A;  1EOQ A;  1BXI A;  1T8K A;  3G28 A;  2PEM A;  4U0D A;  5HGL A;  4PXH B;  1VQ5 P;  3CCQ P;  1AYI A;  2PEJ A;  1YJW P;  2OTL P;  5HGN A;  2BHV A;  5HGM A;  7CEI A;  3LRY A;  3G0V A;  2PNG A;  4H2W C;  2MY5 A;  3HZQ A;  2ROQ A;  3G26 A;  2JGP A;  2JQ4 A;  4CA3 A;  2LTE A;  1M1K Q;  1N8R Q;  1VQM P;  1VQL P;  2AF8 A;  1A8O A;  3CPW O;  2MF4 A;  5KP7 B;  1K8A Q;  1Q81 Q;  2N5H A;  3CCM P;  1NQ4 A;  4BPF A;  2VLP A;  2ERH A;  1E6J P;  1YI2 P;  3GJN A;  5BS1 A;  2FQ2 A;  3LMO A;  3MGE A;  1L0H A;  4U0B A;  1VQP P;  1HQB A;  3E2D A;  2VLQ A;  1JJ2 O;  2CWO A;  2QNW A;  2N6Y A;  5HVC A;  3GKL C;  1QRJ A;  1KQS O;  2XV6 A;  3GZL A;  2K0D X;  2DNW A;  3GZM A;  1GXG A;  1RO0 A;  1E0H A;  3EJB A;  2L0Q A;  2PEI A;  1FR2 A;  1YIJ P;  2P9X A; 
#chains in the Genus database with same CATH homology
 1D1D A;  1RNI A;  1EIA A;  1VQ7 P;  1W2B O;  1Q7Y Q;  2JO0 A;  2OTJ P;  1KD1 Q;  2E1M A;  3CXC O;  2M8N A;  1VQ9 P;  3CC2 P;  4U0A A;  3RG6 C;  4XRO A;  5HGO A;  5F2O A;  5JPA A;  1K73 Q;  1M90 Q;  3G71 P;  4WYM A;  1M74 A;  2PEO A;  4GR2 A;  3CCU P;  1K30 A;  2XXM A;  4U0F A;  2Z46 A;  3CCE P;  2JYL A;  3OW2 O;  1YHQ P;  1EOQ A;  2EG5 A;  3NTE A;  1RO2 A;  2ONT A;  3DS2 A;  3G1G A;  3G28 A;  2Z44 A;  3Q20 A;  2PEM A;  4U0D A;  5HGL A;  1S72 P;  1VQ6 P;  4M0I A;  3I55 P;  3CCQ P;  1VQ5 P;  2PEJ A;  4COC A;  1YJW P;  2OTL P;  2XT1 A;  1IUQ A;  5HGN A;  3G4S P;  1VQ4 P;  2BHV A;  2EIA A;  2JYG A;  4GR6 A;  4U0C A;  5HGM A;  1M6E X;  3H4E A;  3G21 A;  3G0V A;  3LRY A;  3CCL P;  4COP A;  4PH1 A;  1BAJ A;  3CD6 P;  2LF4 A;  4IPY A;  3B5I A;  1AUM A;  2PEQ A;  1VQO P;  3HZQ A;  5DCK A;  3DTJ A;  3G26 A;  1ZMB A;  3H0D A;  3DS5 A;  2KOD A;  3G6E P;  1M1K Q;  1N8R Q;  1VQM P;  3G1I A;  4XFX A;  3P05 A;  5F2K A;  3DS1 A;  3CCV P;  2EFJ A;  1VQL P;  2L6E A;  1A8O A;  3CPW O;  1QVG O;  1K8A Q;  1Q81 Q;  2QA4 P;  1A43 A;  3WBH A;  1YJ9 P;  1KC8 Q;  3VRL C;  3DS3 A;  3CCM P;  2PEK A;  3CC7 P;  3CCJ P;  3G29 A;  1E6J P;  1YI2 P;  5BS1 A;  4PH0 A;  1Q86 Q;  3CMA P;  3MGE A;  4U0B A;  1VQP P;  1VQ8 P;  3CC4 P;  3M1M A;  4XFZ A;  1VQK P;  3E2D A;  3DS0 A;  1Q82 Q;  2PY8 A;  2QEX P;  2OAR A;  3DS4 A;  4U0E A;  1JJ2 O;  3H47 A;  2CWO A;  1QVF O;  4QNB A;  3CCS P;  3CCR P;  3DPH A;  5F2N A;  1QRJ A;  1KQS O;  5I4T G;  1YJN P;  1YIT P;  2BUO A;  2XV6 A;  1M6N A;  1VQN P;  2PEN A;  3I56 P;  4XRQ A;  1K9M Q;  5BS2 A;  1RO0 A;  2M8P A;  2Z45 A;  2M8L A;  3HYB A;  1NJI Q;  3CME P;  2DGY A;  2PEI A;  4XFY A;  1YIJ P;  2P9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...