3G28A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: mutant d179n, low ph
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSNLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
molecule keywords Gag polyprotein
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g28A00
3DS4A 3G29A 2ONTA 2M8PA 4PH1A 2LF4A 3DS0A 2M8NA 2XT1A 1A8OA 3G28A 4IPYA 1EIAA 4U0CA 4U0DA 3DTJA 3LRYA 5HGOA 5I4TG 1QRJA 5HGMA 3G26A 1BAJA 4U0FA 2JYLA 3H47A 3VRLC 1E6JP 4M0IA 4XFYA 3G1IA 1A43A 4U0AA 5DCKA 3NTEA 2BUOA 4XFZA 2JO0A 3G0VA 1AUMA 4QNBA 3G1GA 4XROA 1D1DA 4PH0A 2EIAA 2XXMA 3H4EA 2KODA 3DS5A 4XFXA 5HGNA 2L6EA 2XV6A 4U0BA 4COCA 3MGEA 3P05A 4XRQA 4COPA 5JPAA 4WYMA 4U0EA 5HGLA 3DPHA 3G21A 2JYGA 3DS3A 3DS1A 3DS2A 1EOQA 2M8LA
chains in the Genus database with same CATH superfamily
3NY7B 2KG8A 4IPYA 4U0CA 5KP8B 1K30A 2K0XA 1Q82Q 3CC7P 3H0DA 2AFDA 2MF4A 3GZLA 2JO0A 4UHPB 2DGYA 3CCQP 2KGCA 3DS5A 2L6EA 2PNGA 5HGMA 1M1KQ 3Q20A 5CZDB 2JYLA 4XFZA 3HYBA 2AVAA 2QEXP 2KOSA 3CCJP 2N6YA 4XFXA 3CCMP 2FADA 1YJWP 3EJEA 2JYGA 3OW2O 2JB0A 1BAJA 1VKUA 2FVFA 5BS1A 1RO2A 3HZQA 3G1GA 1VQ5P 2WPTA 2JBGA 4H2YC 2XZ0D 1VHNA 1AYIA 3EJBA 2FVEA 1VQNP 3CXCO 2KR5A 1YIJP 2KWLA 2CGQA 3G0VA 4H2XC 1ZMBA 2VLOA 3B4QA 2GZJA 1YJ9P 2N6ZA 4U0BA 1Z6MA 2M8LA 3LRYA 5KP6B 4DG9A 3G1IA 1ZNVA 2N98A 2XXMA 2EFJA 1QVGO 1ACPA 4HKGA 4H2WC 2L0QA 2X2BA 2N5HA 2GZIA 1EOQA 2L4BA 3EJDA 4XFYA 1UNKA 5F2KA 1KC8Q 2BUOA 1RO0A 2LKIA 2EG5A 5F2NA 3B5IA 4COCA 5JPAA 2E1MA 2Z44A 3DS3A 1Q81Q 2FQ2A 3CD6P 4GR2A 2ONTA 4PH1A 3GJNA 3G26A 5F2OA 2N5IA 1RNIA 2GDYA 4QNBA 4R0MA 1W2BO 1GPJA 1VQLP 4U0EA 5HGLA 3DS1A 3DS4A 2PEKA 2OTLP 3G28A 1BXIA 2LMLA 2FAEA 1HQBA 3CCSP 1OR5A 2PY8A 3G6EP 2XZ1C 3I55P 1GXGA 2PENA 3P05A 3U43A 1YHQP 1VQ9P 2MR7A 2PEJA 1VQPP 1M6NA 2KG9A 3G29A 4PWVB 2LF4A 5I4TG 4U0DA 1GXHA 5EW5E 1UJZA 2MVUA 5EJDA 4BPGA 3NTEA 1M6EX 4F37A 2KORA 2K94A 2K93A 3H4EA 3CCRP 1CEIA 2FHSC 2K0DX 2QNWA 3DPHA 2MR8A 3DS2A 2KOQA 2GYKA 3DS0A 2OARA 2XT1A 3WBHA 2VLNA 4BPHA 2QA4P 1VQKP 2OTJP 2MD9A 4XROA 4QKOA 4MRTC 2JAZA 3I56P 5HGNA 2Z45A 1VQMP 3MGEA 4PXHB 4WYMA 5KP7B 3G21A 3GZMA 2KG6A 1NJIQ 2K5XA 2M8PA 2P9XA 4CA3A 2KGDA 2CQ8A 1M74A 2FACA 3H47A 3CCEP 2MVVA 1YJNP 1HY8A 1S72P 3RG6C 2K2QA 1X3OA 3CMEP 2XV6A 1K73Q 1JJ2O 2AF8A 1M90Q 4XRQA 2Z46A 1YITP 2JU2A 2M8NA 1AF8A 5BS2A 2DNWA 4U0FA 1YI2P 2EHSA 2VLQA 3CPWO 2LIWA 3CCVP 2BHVA 2CG5B 2LPKA 1IMQA 1EMVA 1K9MQ 1DNYA 2EIAA 2LIUA 2KW2A 2KODA 1K8AQ 4NEOA 4COPA 2JU1A 2ERHA 1Q86Q 1KD1Q 5HVCA 1A8OA 1VQ4P 2PEIA 2GZEA 1VQOP 4M0IA 2K92A 2PEOA 3CC2P 1VQ6P 1T8KA 1Q7YQ 4PH0A 1QVFO 1KQSO 3G4SP 1E0HA 1L0HA 1KLPA 2EHTA 2ROQA 2PEQA 3DTJA 2KGEA 1MZ8A 3G71P 2FVAA 1DV5A 3LMOA 2LTEA 2GZGA 2N50A 3CCLP 1FR2A 2LOLA 1AUMA 4GR6A 2GDWA 2VLPA 3GKLC 2LL8A 4BPFA 1IUQA 2KOPA 1L0IA 1N8RQ 1EIAA 1IMPA 1QRJA 7CEIA 1NQ4A 3VRLC 1E6JP 2MY5A 2NO8A 2FQ1A 1D1DA 2GZFA 2L9FA 2KOOA 2JQ4A 2PEMA 2VSQA 3CMAP 3CCUP 2GDXA 2CNRA 1F80D 5HV8A 2K0YA 5HGOA 1VQ8P 3CC4P 3RG2A 2FQ0A 1A43A 2JGPA 4U0AA 1VQ7P 2AFEA 5DCKA 3CE7A 3E2DA 4IZ6A 2M5RA 2L22A 2CWOA 2KGAA 3M1MA
chains in the Genus database with same CATH topology
1VQPP 1M6NA 3G29A 2LF4A 4IPYA 1A8OA 4U0DA 4U0CA 5I4TG 1K30A 3LRYA 1Q82Q 2PEIA 3H0DA 1VQ4P 3CC7P 1VQOP 4M0IA 3G1IA 3NTEA 2PEOA 3CC2P 1VQ6P 2JO0A 2DGYA 1M6EX 1Q7YQ 4PH0A 1QVFO 2XXMA 3CCQP 3H4EA 2EFJA 3DS5A 1QVGO 2L6EA 1KQSO 3G4SP 3CCRP 3DPHA 3DS2A 2PEQA 1EOQA 5HGMA 3DS0A 2OARA 2XT1A 1M1KQ 3WBHA 3DTJA 3Q20A 3G71P 2JYLA 4XFYA 2QA4P 5F2KA 1KC8Q 2BUOA 3CCLP 1VQKP 2OTJP 4XFZA 1AUMA 3HYBA 1RO0A 4XROA 2EG5A 4GR6A 5F2NA 2QEXP 3CCJP 3I56P 3B5IA 4XFXA 2Z45A 5HGNA 3CCMP 4COCA 1VQMP 3MGEA 1YJWP 5JPAA 4WYMA 2E1MA 3G21A 2JYGA 2Z44A 3DS3A 1Q81Q 3OW2O 1NJIQ 3CD6P 1IUQA 4GR2A 2ONTA 2M8PA 4PH1A 2P9XA 1N8RQ 1EIAA 1QRJA 3G26A 1BAJA 5F2OA 1M74A 3H47A 3VRLC 1E6JP 1RNIA 3CCEP 1YJNP 5BS1A 1RO2A 3HZQA 4QNBA 3G1GA 1D1DA 1S72P 1W2BO 3RG6C 1VQ5P 2PEMA 2XV6A 3CMEP 1K73Q 1VQLP 1JJ2O 3CMAP 4XRQA 3CCUP 1M90Q 2Z46A 4U0EA 5HGLA 3DS1A 1YITP 3DS4A 2PEKA 2OTLP 1Q86Q 1VQNP 2M8NA 3G28A 3CXCO 5HGOA 1VQ8P 5BS2A 3CCSP 4U0FA 3CC4P 1YI2P 1YIJP 1A43A 4U0AA 2PY8A 5DCKA 1VQ7P 3E2DA 3CPWO 3CCVP 2BHVA 3G0VA 3G6EP 1ZMBA 1K9MQ 2EIAA 3I55P 1YJ9P 2KODA 1K8AQ 4U0BA 2PENA 3P05A 4COPA 2CWOA 1YHQP 1VQ9P 3M1MA 1KD1Q 2PEJA 2M8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS4 A;  3G29 A;  2ONT A;  2M8P A;  4PH1 A;  2LF4 A;  3DS0 A;  2M8N A;  2XT1 A;  1A8O A;  3G28 A;  4IPY A;  1EIA A;  4U0C A;  4U0D A;  3DTJ A;  3LRY A;  5HGO A;  5I4T G;  1QRJ A;  5HGM A;  3G26 A;  1BAJ A;  4U0F A;  2JYL A;  3H47 A;  3VRL C;  1E6J P;  4M0I A;  4XFY A;  3G1I A;  1A43 A;  4U0A A;  5DCK A;  3NTE A;  2BUO A;  4XFZ A;  2JO0 A;  3G0V A;  1AUM A;  4QNB A;  3G1G A;  4XRO A;  1D1D A;  4PH0 A;  2EIA A;  2XXM A;  3H4E A;  2KOD A;  3DS5 A;  4XFX A;  5HGN A;  2L6E A;  2XV6 A;  4U0B A;  4COC A;  3MGE A;  3P05 A;  4XRQ A;  4COP A;  5JPA A;  4WYM A;  4U0E A;  5HGL A;  3DPH A;  3G21 A;  2JYG A;  3DS3 A;  3DS1 A;  3DS2 A;  1EOQ A;  2M8L A; 
#chains in the Genus database with same CATH topology
 3NY7 B;  2KG8 A;  4IPY A;  4U0C A;  5KP8 B;  1K30 A;  2K0X A;  1Q82 Q;  3CC7 P;  3H0D A;  2AFD A;  2MF4 A;  3GZL A;  2JO0 A;  4UHP B;  2DGY A;  3CCQ P;  2KGC A;  3DS5 A;  2L6E A;  2PNG A;  5HGM A;  1M1K Q;  3Q20 A;  5CZD B;  2JYL A;  4XFZ A;  3HYB A;  2AVA A;  2QEX P;  2KOS A;  3CCJ P;  2N6Y A;  4XFX A;  3CCM P;  2FAD A;  1YJW P;  3EJE A;  2JYG A;  3OW2 O;  2JB0 A;  1BAJ A;  1VKU A;  2FVF A;  5BS1 A;  1RO2 A;  3HZQ A;  3G1G A;  1VQ5 P;  2WPT A;  2JBG A;  4H2Y C;  2XZ0 D;  1VHN A;  1AYI A;  3EJB A;  2FVE A;  1VQN P;  3CXC O;  2KR5 A;  1YIJ P;  2KWL A;  2CGQ A;  3G0V A;  4H2X C;  1ZMB A;  2VLO A;  3B4Q A;  2GZJ A;  1YJ9 P;  2N6Z A;  4U0B A;  1Z6M A;  2M8L A;  3LRY A;  5KP6 B;  4DG9 A;  3G1I A;  1ZNV A;  2N98 A;  2XXM A;  2EFJ A;  1QVG O;  1ACP A;  4HKG A;  4H2W C;  2L0Q A;  2X2B A;  2N5H A;  2GZI A;  1EOQ A;  2L4B A;  3EJD A;  4XFY A;  1UNK A;  5F2K A;  1KC8 Q;  2BUO A;  1RO0 A;  2LKI A;  2EG5 A;  5F2N A;  3B5I A;  4COC A;  5JPA A;  2E1M A;  2Z44 A;  3DS3 A;  1Q81 Q;  2FQ2 A;  3CD6 P;  4GR2 A;  2ONT A;  4PH1 A;  3GJN A;  3G26 A;  5F2O A;  2N5I A;  1RNI A;  2GDY A;  4QNB A;  4R0M A;  1W2B O;  1GPJ A;  1VQL P;  4U0E A;  5HGL A;  3DS1 A;  3DS4 A;  2PEK A;  2OTL P;  3G28 A;  1BXI A;  2LML A;  2FAE A;  1HQB A;  3CCS P;  1OR5 A;  2PY8 A;  3G6E P;  2XZ1 C;  3I55 P;  1GXG A;  2PEN A;  3P05 A;  3U43 A;  1YHQ P;  1VQ9 P;  2MR7 A;  2PEJ A;  1VQP P;  1M6N A;  2KG9 A;  3G29 A;  4PWV B;  2LF4 A;  5I4T G;  4U0D A;  1GXH A;  5EW5 E;  1UJZ A;  2MVU A;  5EJD A;  4BPG A;  3NTE A;  1M6E X;  4F37 A;  2KOR A;  2K94 A;  2K93 A;  3H4E A;  3CCR P;  1CEI A;  2FHS C;  2K0D X;  2QNW A;  3DPH A;  2MR8 A;  3DS2 A;  2KOQ A;  2GYK A;  3DS0 A;  2OAR A;  2XT1 A;  3WBH A;  2VLN A;  4BPH A;  2QA4 P;  1VQK P;  2OTJ P;  2MD9 A;  4XRO A;  4QKO A;  4MRT C;  2JAZ A;  3I56 P;  5HGN A;  2Z45 A;  1VQM P;  3MGE A;  4PXH B;  4WYM A;  5KP7 B;  3G21 A;  3GZM A;  2KG6 A;  1NJI Q;  2K5X A;  2M8P A;  2P9X A;  4CA3 A;  2KGD A;  2CQ8 A;  1M74 A;  2FAC A;  3H47 A;  3CCE P;  2MVV A;  1YJN P;  1HY8 A;  1S72 P;  3RG6 C;  2K2Q A;  1X3O A;  3CME P;  2XV6 A;  1K73 Q;  1JJ2 O;  2AF8 A;  1M90 Q;  4XRQ A;  2Z46 A;  1YIT P;  2JU2 A;  2M8N A;  1AF8 A;  5BS2 A;  2DNW A;  4U0F A;  1YI2 P;  2EHS A;  2VLQ A;  3CPW O;  2LIW A;  3CCV P;  2BHV A;  2CG5 B;  2LPK A;  1IMQ A;  1EMV A;  1K9M Q;  1DNY A;  2EIA A;  2LIU A;  2KW2 A;  2KOD A;  1K8A Q;  4NEO A;  4COP A;  2JU1 A;  2ERH A;  1Q86 Q;  1KD1 Q;  5HVC A;  1A8O A;  1VQ4 P;  2PEI A;  2GZE A;  1VQO P;  4M0I A;  2K92 A;  2PEO A;  3CC2 P;  1VQ6 P;  1T8K A;  1Q7Y Q;  4PH0 A;  1QVF O;  1KQS O;  3G4S P;  1E0H A;  1L0H A;  1KLP A;  2EHT A;  2ROQ A;  2PEQ A;  3DTJ A;  2KGE A;  1MZ8 A;  3G71 P;  2FVA A;  1DV5 A;  3LMO A;  2LTE A;  2GZG A;  2N50 A;  3CCL P;  1FR2 A;  2LOL A;  1AUM A;  4GR6 A;  2GDW A;  2VLP A;  3GKL C;  2LL8 A;  4BPF A;  1IUQ A;  2KOP A;  1L0I A;  1N8R Q;  1EIA A;  1IMP A;  1QRJ A;  7CEI A;  1NQ4 A;  3VRL C;  1E6J P;  2MY5 A;  2NO8 A;  2FQ1 A;  1D1D A;  2GZF A;  2L9F A;  2KOO A;  2JQ4 A;  2PEM A;  2VSQ A;  3CMA P;  3CCU P;  2GDX A;  2CNR A;  1F80 D;  5HV8 A;  2K0Y A;  5HGO A;  1VQ8 P;  3CC4 P;  3RG2 A;  2FQ0 A;  1A43 A;  2JGP A;  4U0A A;  1VQ7 P;  2AFE A;  5DCK A;  3CE7 A;  3E2D A;  4IZ6 A;  2M5R A;  2L22 A;  2CWO A;  2KGA A;  3M1M A; 
#chains in the Genus database with same CATH homology
 1VQP P;  1M6N A;  3G29 A;  2LF4 A;  4IPY A;  1A8O A;  4U0D A;  4U0C A;  5I4T G;  1K30 A;  3LRY A;  1Q82 Q;  2PEI A;  3H0D A;  1VQ4 P;  3CC7 P;  1VQO P;  4M0I A;  3G1I A;  3NTE A;  2PEO A;  3CC2 P;  1VQ6 P;  2JO0 A;  2DGY A;  1M6E X;  1Q7Y Q;  4PH0 A;  1QVF O;  2XXM A;  3CCQ P;  3H4E A;  2EFJ A;  3DS5 A;  1QVG O;  2L6E A;  1KQS O;  3G4S P;  3CCR P;  3DPH A;  3DS2 A;  2PEQ A;  1EOQ A;  5HGM A;  3DS0 A;  2OAR A;  2XT1 A;  1M1K Q;  3WBH A;  3DTJ A;  3Q20 A;  3G71 P;  2JYL A;  4XFY A;  2QA4 P;  5F2K A;  1KC8 Q;  2BUO A;  3CCL P;  1VQK P;  2OTJ P;  4XFZ A;  1AUM A;  3HYB A;  1RO0 A;  4XRO A;  2EG5 A;  4GR6 A;  5F2N A;  2QEX P;  3CCJ P;  3I56 P;  3B5I A;  4XFX A;  2Z45 A;  5HGN A;  3CCM P;  4COC A;  1VQM P;  3MGE A;  1YJW P;  5JPA A;  4WYM A;  2E1M A;  3G21 A;  2JYG A;  2Z44 A;  3DS3 A;  1Q81 Q;  3OW2 O;  1NJI Q;  3CD6 P;  1IUQ A;  4GR2 A;  2ONT A;  2M8P A;  4PH1 A;  2P9X A;  1N8R Q;  1EIA A;  1QRJ A;  3G26 A;  1BAJ A;  5F2O A;  1M74 A;  3H47 A;  3VRL C;  1E6J P;  1RNI A;  3CCE P;  1YJN P;  5BS1 A;  1RO2 A;  3HZQ A;  4QNB A;  3G1G A;  1D1D A;  1S72 P;  1W2B O;  3RG6 C;  1VQ5 P;  2PEM A;  2XV6 A;  3CME P;  1K73 Q;  1VQL P;  1JJ2 O;  3CMA P;  4XRQ A;  3CCU P;  1M90 Q;  2Z46 A;  4U0E A;  5HGL A;  3DS1 A;  1YIT P;  3DS4 A;  2PEK A;  2OTL P;  1Q86 Q;  1VQN P;  2M8N A;  3G28 A;  3CXC O;  5HGO A;  1VQ8 P;  5BS2 A;  3CCS P;  4U0F A;  3CC4 P;  1YI2 P;  1YIJ P;  1A43 A;  4U0A A;  2PY8 A;  5DCK A;  1VQ7 P;  3E2D A;  3CPW O;  3CCV P;  2BHV A;  3G0V A;  3G6E P;  1ZMB A;  1K9M Q;  2EIA A;  3I55 P;  1YJ9 P;  2KOD A;  1K8A Q;  4U0B A;  2PEN A;  3P05 A;  4COP A;  2CWO A;  1YHQ P;  1VQ9 P;  3M1M A;  1KD1 Q;  2PEJ A;  2M8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...