3G28A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: mutant d179n, low ph
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSNLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g28A00
1BAJA 2ONTA 5HGOA 3DTJA 2LF4A 3DS0A 1A43A 3G1GA 5HGMA 2KODA 2XV6A 1QRJA 3DPHA 1A8OA 4WYMA 3G21A 4U0AA 5HGNA 4U0CA 4QNBA 2JYLA 3G26A 2BUOA 3DS2A 3H4EA 4XRQA 4COPA 3G1IA 2JYGA 2M8NA 4M0IA 4PH1A 1D1DA 3LRYA 3H47A 2M8LA 1EOQA 2JO0A 4IPYA 4COCA 5JPAA 4XFZA 3DS1A 4U0FA 4XFXA 3DS3A 4U0DA 4U0BA 4XROA 2EIAA 2L6EA 3DS5A 4U0EA 3VRLC 5I4TG 2M8PA 3G28A 3P05A 1EIAA 1E6JP 2XT1A 3G0VA 3MGEA 4PH0A 3G29A 4XFYA 3DS4A 5DCKA 3NTEA 2XXMA 5HGLA 1AUMA
chains in the Genus database with same CATH superfamily
4GR6A 4NEOA 1K73Q 2OTJP 5HGMA 1VQLP 2FVEA 2FQ2A 1X3OA 3DS2A 2M8NA 4PXHB 2MR7A 3I56P 2FVAA 2QNWA 1VQKP 2N6ZA 1M1KQ 4XFYA 1ZMBA 2CGQA 3G6EP 1L0IA 4HKGA 2LIWA 3CCEP 1AYIA 3CXCO 2CQ8A 2VSQA 3EJBA 2N6YA 3CC2P 3DS1A 2K5XA 3CCQP 2XT1A 5KP8B 1N8RQ 2KOQA 3G71P 1VHNA 3GKLC 2JQ4A 2K93A 2VLOA 1M90Q 1M6NA 1Q81Q 2KOPA 3U43A 1AF8A 2Z46A 1GPJA 2JBGA 3CCSP 2KOSA 2L22A 3DS4A 2XXMA 1BAJA 2JAZA 5HGOA 3DS0A 2XZ0D 2WPTA 1NJIQ 2PNGA 2LPKA 2K92A 3HYBA 1JJ2O 1HQBA 3CC7P 4UHPB 2PEKA 4GR2A 2AFEA 3G28A 3G29A 2MVVA 2PEJA 3DTJA 1Z6MA 1YJWP 2N98A 1K8AQ 4MRTC 2VLPA 3HZQA 3G1IA 1D1DA 3CMEP 1FR2A 2N5HA 2FQ0A 5HVCA 4U0EA 1VQNP 2GDYA 3I55P 1IMQA 1RO2A 3WBHA 1HY8A 2LMLA 1VQ8P 2CWOA 1OR5A 3DPHA 4WYMA 2K2QA 2KG9A 2GYKA 1T8KA 2JU2A 4XRQA 1RO0A 3B5IA 2EHTA 2EG5A 2PEOA 3CMAP 3VRLC 2L0QA 2M8PA 2EFJA 4H2YC 5CZDB 1K9MQ 2GZFA 2LL8A 1KQSO 2GZEA 1BXIA 3H4EA 2LKIA 2MVUA 1YJ9P 2AF8A 3Q20A 5F2OA 2M5RA 1M6EX 3LMOA 2GZIA 4U0BA 3NY7B 1S72P 1CEIA 1QVGO 3CC4P 4BPHA 3NTEA 5HGLA 4H2WC 2PEQA 2NO8A 2KODA 5EW5E 2FADA 1VQ6P 2Z45A 2P9XA 3GJNA 2MF4A 2FVFA 2PEMA 3LRYA 5BS2A 4R0MA 2X2BA 4XFXA 2GDXA 2AVAA 1RNIA 2KW2A 2EIAA 3DS5A 5KP6B 2PEIA 2JB0A 4QKOA 2KG8A 2MD9A 1GXHA 2EHSA 2BHVA 2KGEA 3G1GA 1KC8Q 5HGNA 2GZJA 3G26A 1KLPA 2GZGA 1NQ4A 2M8LA 2KGDA 2FQ1A 2Z44A 5KP7B 2GDWA 3CCRP 4XROA 2K0YA 1W2BO 1VQOP 4DG9A 4F37A 2ONTA 2KGCA 2DNWA 3OW2O 3CCJP 5F2NA 1UNKA 2KR5A 4M0IA 1EMVA 1L0HA 2AFDA 4IPYA 2VLNA 2KGAA 3CD6P 1VKUA 5F2KA 3CCLP 2CNRA 1AUMA 2LF4A 3RG6C 2KG6A 2CG5B 2ERHA 4PWVB 3H47A 2QA4P 2K0DX 4CA3A 2L4BA 1UJZA 2LIUA 2OARA 3H0DA 3B4QA 1A43A 3RG2A 3CE7A 4U0AA 4QNBA 2FAEA 4BPGA 4XFZA 3E2DA 3DS3A 4U0DA 2VLQA 4IZ6A 2OTLP 4PH0A 1YJNP 1QVFO 4H2XC 1VQMP 1YI2P 1DV5A 3CCMP 2KWLA 3G4SP 2N5IA 3EJDA 2L9FA 3CCVP 4BPFA 3CCUP 1YITP 2QEXP 1KD1Q 4COCA 2PY8A 1Q82Q 2MY5A 4U0FA 2L6EA 5I4TG 2KOOA 1E6JP 3G0VA 1M74A 3GZLA 7CEIA 2N50A 5EJDA 1IUQA 2KORA 2ROQA 4COPA 1Q86Q 2DGYA 2JGPA 1EOQA 2JO0A 1ACPA 2JU1A 1GXGA 1VQ5P 5BS1A 1Q7YQ 2LTEA 3MGEA 1DNYA 1VQ7P 1VQ9P 2FHSC 2LOLA 1ZNVA 2E1MA 1QRJA 1A8OA 3G21A 4U0CA 2BUOA 1YIJP 4PH1A 1K30A 5HV8A 2K0XA 2MR8A 5JPAA 1F80D 1YHQP 3P05A 1MZ8A 1E0HA 2K94A 2XV6A 3M1MA 3EJEA 2FACA 2JYLA 2JYGA 1VQPP 1IMPA 2PENA 3GZMA 2XZ1C 1VQ4P 1EIAA 5DCKA 3CPWO
chains in the Genus database with same CATH topology
2PEJA 1VQMP 3DTJA 1YI2P 4GR6A 3CCMP 2BHVA 3G1GA 1K73Q 2OTJP 5HGMA 3G4SP 1YJWP 1KC8Q 1VQLP 5HGNA 1K8AQ 3G26A 3DS2A 3HZQA 3G1IA 2M8NA 3CCVP 1D1DA 3CCUP 2M8LA 3CMEP 1YITP 3I56P 2QEXP 1KD1Q 4COCA 2Z44A 2PY8A 1Q82Q 4U0FA 3CCRP 1VQKP 4XROA 1W2BO 2L6EA 4U0EA 5I4TG 1VQNP 1M1KQ 1E6JP 3G0VA 1M74A 3I55P 1VQOP 1RO2A 4XFYA 3WBHA 1ZMBA 2ONTA 1VQ8P 1IUQA 3G6EP 2CWOA 3OW2O 3DPHA 4WYMA 3CCEP 3CCJP 5F2NA 3CXCO 4XRQA 4COPA 1Q86Q 2DGYA 4M0IA 1RO0A 3B5IA 1EOQA 2JO0A 2EG5A 4IPYA 3CC2P 2PEOA 3DS1A 3CMAP 1VQ5P 5BS1A 1Q7YQ 3VRLC 3CD6P 2M8PA 2EFJA 3CCQP 1K9MQ 2XT1A 3MGEA 1KQSO 5F2KA 3CCLP 3H4EA 1VQ7P 1VQ9P 1N8RQ 1AUMA 2LF4A 1YJ9P 3RG6C 3G71P 2E1MA 1QRJA 1A8OA 3G21A 4U0CA 3Q20A 1M90Q 2BUOA 5F2OA 1M6NA 1YIJP 1Q81Q 1M6EX 4PH1A 3H47A 2QA4P 1K30A 5JPAA 2Z46A 1YHQP 4U0BA 3CCSP 3P05A 1S72P 1QVGO 3CC4P 3DS4A 3NTEA 2XXMA 5HGLA 1BAJA 2OARA 5HGOA 3H0DA 2PEQA 3DS0A 1A43A 2KODA 1NJIQ 2XV6A 3M1MA 4U0AA 1VQ6P 2Z45A 4QNBA 2P9XA 2JYLA 3HYBA 2PEMA 1JJ2O 2JYGA 3LRYA 1VQPP 3CC7P 2PENA 5BS2A 2PEKA 3E2DA 4XFZA 4XFXA 3DS3A 1RNIA 4U0DA 2EIAA 3DS5A 4GR2A 1VQ4P 3G28A 1QVFO 1EIAA 2PEIA 4PH0A 2OTLP 3G29A 1YJNP 5DCKA 3CPWO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAJ A;  2ONT A;  5HGO A;  3DTJ A;  2LF4 A;  3DS0 A;  1A43 A;  3G1G A;  5HGM A;  2KOD A;  2XV6 A;  1QRJ A;  3DPH A;  1A8O A;  4WYM A;  3G21 A;  4U0A A;  5HGN A;  4U0C A;  4QNB A;  2JYL A;  3G26 A;  2BUO A;  3DS2 A;  3H4E A;  4XRQ A;  4COP A;  3G1I A;  2JYG A;  2M8N A;  4M0I A;  4PH1 A;  1D1D A;  3LRY A;  3H47 A;  2M8L A;  1EOQ A;  2JO0 A;  4IPY A;  4COC A;  5JPA A;  4XFZ A;  3DS1 A;  4U0F A;  4XFX A;  3DS3 A;  4U0D A;  4U0B A;  4XRO A;  2EIA A;  2L6E A;  3DS5 A;  4U0E A;  3VRL C;  5I4T G;  2M8P A;  3G28 A;  3P05 A;  1EIA A;  1E6J P;  2XT1 A;  3G0V A;  3MGE A;  4PH0 A;  3G29 A;  4XFY A;  3DS4 A;  5DCK A;  3NTE A;  2XXM A;  5HGL A;  1AUM A; 
#chains in the Genus database with same CATH topology
 4GR6 A;  4NEO A;  1K73 Q;  2OTJ P;  5HGM A;  1VQL P;  2FVE A;  2FQ2 A;  1X3O A;  3DS2 A;  2M8N A;  4PXH B;  2MR7 A;  3I56 P;  2FVA A;  2QNW A;  1VQK P;  2N6Z A;  1M1K Q;  4XFY A;  1ZMB A;  2CGQ A;  3G6E P;  1L0I A;  4HKG A;  2LIW A;  3CCE P;  1AYI A;  3CXC O;  2CQ8 A;  2VSQ A;  3EJB A;  2N6Y A;  3CC2 P;  3DS1 A;  2K5X A;  3CCQ P;  2XT1 A;  5KP8 B;  1N8R Q;  2KOQ A;  3G71 P;  1VHN A;  3GKL C;  2JQ4 A;  2K93 A;  2VLO A;  1M90 Q;  1M6N A;  1Q81 Q;  2KOP A;  3U43 A;  1AF8 A;  2Z46 A;  1GPJ A;  2JBG A;  3CCS P;  2KOS A;  2L22 A;  3DS4 A;  2XXM A;  1BAJ A;  2JAZ A;  5HGO A;  3DS0 A;  2XZ0 D;  2WPT A;  1NJI Q;  2PNG A;  2LPK A;  2K92 A;  3HYB A;  1JJ2 O;  1HQB A;  3CC7 P;  4UHP B;  2PEK A;  4GR2 A;  2AFE A;  3G28 A;  3G29 A;  2MVV A;  2PEJ A;  3DTJ A;  1Z6M A;  1YJW P;  2N98 A;  1K8A Q;  4MRT C;  2VLP A;  3HZQ A;  3G1I A;  1D1D A;  3CME P;  1FR2 A;  2N5H A;  2FQ0 A;  5HVC A;  4U0E A;  1VQN P;  2GDY A;  3I55 P;  1IMQ A;  1RO2 A;  3WBH A;  1HY8 A;  2LML A;  1VQ8 P;  2CWO A;  1OR5 A;  3DPH A;  4WYM A;  2K2Q A;  2KG9 A;  2GYK A;  1T8K A;  2JU2 A;  4XRQ A;  1RO0 A;  3B5I A;  2EHT A;  2EG5 A;  2PEO A;  3CMA P;  3VRL C;  2L0Q A;  2M8P A;  2EFJ A;  4H2Y C;  5CZD B;  1K9M Q;  2GZF A;  2LL8 A;  1KQS O;  2GZE A;  1BXI A;  3H4E A;  2LKI A;  2MVU A;  1YJ9 P;  2AF8 A;  3Q20 A;  5F2O A;  2M5R A;  1M6E X;  3LMO A;  2GZI A;  4U0B A;  3NY7 B;  1S72 P;  1CEI A;  1QVG O;  3CC4 P;  4BPH A;  3NTE A;  5HGL A;  4H2W C;  2PEQ A;  2NO8 A;  2KOD A;  5EW5 E;  2FAD A;  1VQ6 P;  2Z45 A;  2P9X A;  3GJN A;  2MF4 A;  2FVF A;  2PEM A;  3LRY A;  5BS2 A;  4R0M A;  2X2B A;  4XFX A;  2GDX A;  2AVA A;  1RNI A;  2KW2 A;  2EIA A;  3DS5 A;  5KP6 B;  2PEI A;  2JB0 A;  4QKO A;  2KG8 A;  2MD9 A;  1GXH A;  2EHS A;  2BHV A;  2KGE A;  3G1G A;  1KC8 Q;  5HGN A;  2GZJ A;  3G26 A;  1KLP A;  2GZG A;  1NQ4 A;  2M8L A;  2KGD A;  2FQ1 A;  2Z44 A;  5KP7 B;  2GDW A;  3CCR P;  4XRO A;  2K0Y A;  1W2B O;  1VQO P;  4DG9 A;  4F37 A;  2ONT A;  2KGC A;  2DNW A;  3OW2 O;  3CCJ P;  5F2N A;  1UNK A;  2KR5 A;  4M0I A;  1EMV A;  1L0H A;  2AFD A;  4IPY A;  2VLN A;  2KGA A;  3CD6 P;  1VKU A;  5F2K A;  3CCL P;  2CNR A;  1AUM A;  2LF4 A;  3RG6 C;  2KG6 A;  2CG5 B;  2ERH A;  4PWV B;  3H47 A;  2QA4 P;  2K0D X;  4CA3 A;  2L4B A;  1UJZ A;  2LIU A;  2OAR A;  3H0D A;  3B4Q A;  1A43 A;  3RG2 A;  3CE7 A;  4U0A A;  4QNB A;  2FAE A;  4BPG A;  4XFZ A;  3E2D A;  3DS3 A;  4U0D A;  2VLQ A;  4IZ6 A;  2OTL P;  4PH0 A;  1YJN P;  1QVF O;  4H2X C;  1VQM P;  1YI2 P;  1DV5 A;  3CCM P;  2KWL A;  3G4S P;  2N5I A;  3EJD A;  2L9F A;  3CCV P;  4BPF A;  3CCU P;  1YIT P;  2QEX P;  1KD1 Q;  4COC A;  2PY8 A;  1Q82 Q;  2MY5 A;  4U0F A;  2L6E A;  5I4T G;  2KOO A;  1E6J P;  3G0V A;  1M74 A;  3GZL A;  7CEI A;  2N50 A;  5EJD A;  1IUQ A;  2KOR A;  2ROQ A;  4COP A;  1Q86 Q;  2DGY A;  2JGP A;  1EOQ A;  2JO0 A;  1ACP A;  2JU1 A;  1GXG A;  1VQ5 P;  5BS1 A;  1Q7Y Q;  2LTE A;  3MGE A;  1DNY A;  1VQ7 P;  1VQ9 P;  2FHS C;  2LOL A;  1ZNV A;  2E1M A;  1QRJ A;  1A8O A;  3G21 A;  4U0C A;  2BUO A;  1YIJ P;  4PH1 A;  1K30 A;  5HV8 A;  2K0X A;  2MR8 A;  5JPA A;  1F80 D;  1YHQ P;  3P05 A;  1MZ8 A;  1E0H A;  2K94 A;  2XV6 A;  3M1M A;  3EJE A;  2FAC A;  2JYL A;  2JYG A;  1VQP P;  1IMP A;  2PEN A;  3GZM A;  2XZ1 C;  1VQ4 P;  1EIA A;  5DCK A;  3CPW O; 
#chains in the Genus database with same CATH homology
 2PEJ A;  1VQM P;  3DTJ A;  1YI2 P;  4GR6 A;  3CCM P;  2BHV A;  3G1G A;  1K73 Q;  2OTJ P;  5HGM A;  3G4S P;  1YJW P;  1KC8 Q;  1VQL P;  5HGN A;  1K8A Q;  3G26 A;  3DS2 A;  3HZQ A;  3G1I A;  2M8N A;  3CCV P;  1D1D A;  3CCU P;  2M8L A;  3CME P;  1YIT P;  3I56 P;  2QEX P;  1KD1 Q;  4COC A;  2Z44 A;  2PY8 A;  1Q82 Q;  4U0F A;  3CCR P;  1VQK P;  4XRO A;  1W2B O;  2L6E A;  4U0E A;  5I4T G;  1VQN P;  1M1K Q;  1E6J P;  3G0V A;  1M74 A;  3I55 P;  1VQO P;  1RO2 A;  4XFY A;  3WBH A;  1ZMB A;  2ONT A;  1VQ8 P;  1IUQ A;  3G6E P;  2CWO A;  3OW2 O;  3DPH A;  4WYM A;  3CCE P;  3CCJ P;  5F2N A;  3CXC O;  4XRQ A;  4COP A;  1Q86 Q;  2DGY A;  4M0I A;  1RO0 A;  3B5I A;  1EOQ A;  2JO0 A;  2EG5 A;  4IPY A;  3CC2 P;  2PEO A;  3DS1 A;  3CMA P;  1VQ5 P;  5BS1 A;  1Q7Y Q;  3VRL C;  3CD6 P;  2M8P A;  2EFJ A;  3CCQ P;  1K9M Q;  2XT1 A;  3MGE A;  1KQS O;  5F2K A;  3CCL P;  3H4E A;  1VQ7 P;  1VQ9 P;  1N8R Q;  1AUM A;  2LF4 A;  1YJ9 P;  3RG6 C;  3G71 P;  2E1M A;  1QRJ A;  1A8O A;  3G21 A;  4U0C A;  3Q20 A;  1M90 Q;  2BUO A;  5F2O A;  1M6N A;  1YIJ P;  1Q81 Q;  1M6E X;  4PH1 A;  3H47 A;  2QA4 P;  1K30 A;  5JPA A;  2Z46 A;  1YHQ P;  4U0B A;  3CCS P;  3P05 A;  1S72 P;  1QVG O;  3CC4 P;  3DS4 A;  3NTE A;  2XXM A;  5HGL A;  1BAJ A;  2OAR A;  5HGO A;  3H0D A;  2PEQ A;  3DS0 A;  1A43 A;  2KOD A;  1NJI Q;  2XV6 A;  3M1M A;  4U0A A;  1VQ6 P;  2Z45 A;  4QNB A;  2P9X A;  2JYL A;  3HYB A;  2PEM A;  1JJ2 O;  2JYG A;  3LRY A;  1VQP P;  3CC7 P;  2PEN A;  5BS2 A;  2PEK A;  3E2D A;  4XFZ A;  4XFX A;  3DS3 A;  1RNI A;  4U0D A;  2EIA A;  3DS5 A;  4GR2 A;  1VQ4 P;  3G28 A;  1QVF O;  1EIA A;  2PEI A;  4PH0 A;  2OTL P;  3G29 A;  1YJN P;  5DCK A;  3CPW O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...