3G28A

Crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: mutant d179n, low ph
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
AGPWADIMQGPSESFVDFANRLIKAVEGSNLPPSARAPVIIDCFRQKSQPDIQQLIRTAPSTLTTPGEIIKYVLDRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gag polyprotein
publication title Proton-linked dimerization of a retroviral capsid protein initiates capsid assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 25
structure length 77
sequence length 77
ec nomenclature ec 3.4.23.-:
pdb deposition date 2009-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3g28A00
2M8NA 5DCKA 3DS2A 4WYMA 2M8PA 4XFZA 2XV6A 3G28A 4PH1A 4M0IA 1QRJA 3DS1A 3G1GA 4U0AA 4U0BA 5HGMA 3DPHA 3H47A 4PH0A 4XFYA 2JYLA 4COPA 2KODA 2JYGA 3MGEA 2JO0A 1AUMA 4U0DA 2XT1A 1D1DA 3NTEA 1BAJA 3G0VA 1E6JP 3H4EA 4COCA 4U0EA 2XXMA 4QNBA 4XROA 5HGLA 3VRLC 3G21A 4U0CA 4XRQA 4IPYA 3G26A 2M8LA 2LF4A 5I4TG 1EIAA 3P05A 2ONTA 1A43A 3G1IA 4XFXA 3DTJA 3DS3A 2L6EA 3DS5A 3LRYA 5HGNA 1EOQA 3G29A 5JPAA 3DS0A 3DS4A 4U0FA 2BUOA 2EIAA 5HGOA 1A8OA
chains in the Genus database with same CATH superfamily
2EHSA 3CCLP 1K30A 2MF4A 1VQOP 1AUMA 2XT1A 3NTEA 2KW2A 1VQ7P 2MR7A 2LIUA 2PY8A 2FQ2A 1AF8A 5I4TG 2K0YA 2FVFA 3CCQP 3LRYA 2Z46A 3M1MA 2K0XA 1YITP 2BUOA 2ROQA 5F2OA 3DS2A 2PEQA 1VQPP 1ZMBA 2LL8A 3DPHA 1M74A 3CCUP 2CWOA 5BS1A 1OR5A 4H2WC 1N8RQ 2KOQA 1K9MQ 1Q82Q 2FHSC 2NO8A 2N6YA 4F37A 1UNKA 3G29A 2MVVA 2GDWA 1GPJA 5EJDA 5HV8A 1NJIQ 1ACPA 2OTLP 2FVEA 2ERHA 2BHVA 1IMQA 3CC2P 3G71P 5HVCA 3DS3A 4BPFA 1EOQA 2FADA 2M8NA 2OTJP 2QNWA 3G4SP 2AF8A 2CG5B 3G28A 2VSQA 3GZLA 3HYBA 4PH0A 1Q86Q 2KORA 3E2DA 4NEOA 3U43A 1HY8A 2KOPA 1K73Q 1M6EX 1VQ4P 2JB0A 5JPAA 4IPYA 4GR2A 2XV6A 1KC8Q 2AFEA 2K5XA 3H4EA 2VLOA 5KP8B 2L0QA 3CCSP 2L4BA 2VLNA 2KG6A 1RO0A 5F2NA 1VQ8P 2PENA 1Q7YQ 2KG8A 2JQ4A 3CXCO 2MR8A 1DNYA 3G6EP 3LMOA 4BPHA 4XROA 2KOOA 3CCRP 2GZIA 2Z44A 3DS0A 2GYKA 3Q20A 4WYMA 2KGDA 1QRJA 3CMEP 2MVUA 2K2QA 4GR6A 3G0VA 1QVGO 2XXMA 1RNIA 2QEXP 2PEOA 1YIJP 1HQBA 2PEMA 7CEIA 3H0DA 4PH1A 4M0IA 2PEIA 2GZEA 3I56P 3G1GA 3MGEA 2JYGA 2EG5A 2KR5A 4UHPB 1MZ8A 3VRLC 2VLPA 2KOSA 3B4QA 1T8KA 1VQ5P 1KQSO 2KWLA 5HGLA 1IUQA 2N6ZA 2M8PA 4U0AA 1NQ4A 2XZ0D 2KG9A 1E6JP 2CQ8A 4U0CA 2K94A 2N5HA 2M8LA 1M6NA 2LIWA 4DG9A 1A43A 1VQKP 1S72P 3DS4A 4U0FA 1VQ6P 2M5RA 4XFXA 3I55P 3HZQA 2JAZA 2PEKA 2FQ1A 3CD6P 1YJNP 1E0HA 3H47A 4XFYA 1L0IA 1CEIA 2WPTA 5CZDB 3CPWO 4PXHB 1KLPA 2LMLA 1F80D 4HKGA 3CMAP 2GDYA 1AYIA 1A8OA 1UJZA 1RO2A 1GXGA 2N98A 3EJBA 1BXIA 2VLQA 1GXHA 1QVFO 2CGQA 3OW2O 4U0EA 2L22A 2JGPA 2GZFA 1VQLP 3CCJP 1EIAA 2LOLA 3CE7A 1JJ2O 5HGNA 2JU2A 1YJ9P 2EIAA 3NY7B 2XZ1C 1M90Q 1FR2A 3RG2A 2KGAA 2JYLA 2PNGA 1W2BO 4U0DA 3CCVP 5KP6B 1BAJA 4PWVB 4MRTC 2DNWA 3WBHA 1ZNVA 2QA4P 2AFDA 3DTJA 2GZJA 2MY5A 1Q81Q 2GZGA 5F2KA 2GDXA 1DV5A 2KGEA 5HGMA 2JBGA 4QNBA 1EMVA 1VQ9P 1X3OA 3G26A 3CC7P 2LTEA 3G1IA 5BS2A 3DS5A 2CNRA 5HGOA 1KD1Q 5DCKA 4R0MA 2K92A 1K8AQ 2K93A 2KODA 2JO0A 1D1DA 2N5IA 2LPKA 1VHNA 4XRQA 2AVAA 2K0DX 2PEJA 4BPGA 1VQMP 2LF4A 2DGYA 1YHQP 2N50A 4IZ6A 1M1KQ 3RG6C 4CA3A 4H2YC 2EHTA 4H2XC 4U0BA 2JU1A 2EFJA 1Z6MA 4COPA 2OARA 3CC4P 3GZMA 2MD9A 3CCMP 2LKIA 1L0HA 2FACA 3EJDA 4QKOA 2FVAA 3GJNA 5KP7B 1IMPA 4XFZA 3DS1A 2E1MA 2P9XA 2Z45A 2FQ0A 1VKUA 4COCA 1YJWP 3G21A 5EW5E 3EJEA 3P05A 2ONTA 1VQNP 3GKLC 2KGCA 1YI2P 2L6EA 2X2BA 3B5IA 3CCEP 2L9FA 2FAEA
chains in the Genus database with same CATH topology
5F2KA 4GR2A 2M8PA 2XV6A 3CCLP 1K30A 1KC8Q 4U0AA 5HGMA 1VQOP 1AUMA 2XT1A 3NTEA 1E6JP 3H4EA 1VQ7P 4QNBA 2PY8A 4U0CA 1VQ9P 4IPYA 3G26A 2M8LA 5I4TG 3CCSP 1M6NA 3CC7P 3CCQP 1A43A 3G1IA 5BS2A 1VQKP 3LRYA 3DS5A 2Z46A 1S72P 1RO0A 3M1MA 5F2NA 3DS4A 4U0FA 1VQ8P 1VQ6P 1YITP 2BUOA 5HGOA 5F2OA 4XFXA 1KD1Q 5DCKA 2PENA 3DS2A 2PEQA 3HZQA 3I55P 1Q7YQ 2PEKA 1VQPP 3CD6P 1ZMBA 1YJNP 1K8AQ 3DPHA 3H47A 1M74A 4XFYA 3CXCO 2KODA 2JO0A 1D1DA 3CCUP 2CWOA 5BS1A 3G6EP 1N8RQ 4XROA 3CPWO 4XRQA 1K9MQ 2PEJA 1Q82Q 3CCRP 1VQMP 2LF4A 2DGYA 1YHQP 2Z44A 3CMAP 3G29A 3DS0A 1M1KQ 3RG6C 1RO2A 3Q20A 1A8OA 4WYMA 1QRJA 3CMEP 4U0BA 2EFJA 1NJIQ 1QVFO 4COPA 2OTLP 2OARA 4GR6A 3CC4P 3G0VA 3OW2O 1QVGO 4U0EA 2XXMA 2BHVA 3CCMP 1VQLP 3CC2P 3G71P 3CCJP 1EIAA 1RNIA 2QEXP 2PEOA 1JJ2O 3DS3A 5HGNA 1EOQA 1YJ9P 1YIJP 2EIAA 2M8NA 2PEMA 1M90Q 2OTJP 3G4SP 4XFZA 3G28A 3H0DA 4PH1A 4M0IA 2PEIA 3I56P 3DS1A 2E1MA 3G1GA 3HYBA 4PH0A 2JYLA 3MGEA 2JYGA 2P9XA 1W2BO 2Z45A 4U0DA 1Q86Q 3CCVP 2EG5A 1BAJA 3E2DA 4COCA 1YJWP 3VRLC 3G21A 3WBHA 2QA4P 1K73Q 3P05A 2ONTA 1M6EX 1VQNP 1VQ4P 1VQ5P 1KQSO 3DTJA 1YI2P 2L6EA 3B5IA 5JPAA 3CCEP 5HGLA 1Q81Q 1IUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8N A;  5DCK A;  3DS2 A;  4WYM A;  2M8P A;  4XFZ A;  2XV6 A;  3G28 A;  4PH1 A;  4M0I A;  1QRJ A;  3DS1 A;  3G1G A;  4U0A A;  4U0B A;  5HGM A;  3DPH A;  3H47 A;  4PH0 A;  4XFY A;  2JYL A;  4COP A;  2KOD A;  2JYG A;  3MGE A;  2JO0 A;  1AUM A;  4U0D A;  2XT1 A;  1D1D A;  3NTE A;  1BAJ A;  3G0V A;  1E6J P;  3H4E A;  4COC A;  4U0E A;  2XXM A;  4QNB A;  4XRO A;  5HGL A;  3VRL C;  3G21 A;  4U0C A;  4XRQ A;  4IPY A;  3G26 A;  2M8L A;  2LF4 A;  5I4T G;  1EIA A;  3P05 A;  2ONT A;  1A43 A;  3G1I A;  4XFX A;  3DTJ A;  3DS3 A;  2L6E A;  3DS5 A;  3LRY A;  5HGN A;  1EOQ A;  3G29 A;  5JPA A;  3DS0 A;  3DS4 A;  4U0F A;  2BUO A;  2EIA A;  5HGO A;  1A8O A; 
#chains in the Genus database with same CATH topology
 2EHS A;  3CCL P;  1K30 A;  2MF4 A;  1VQO P;  1AUM A;  2XT1 A;  3NTE A;  2KW2 A;  1VQ7 P;  2MR7 A;  2LIU A;  2PY8 A;  2FQ2 A;  1AF8 A;  5I4T G;  2K0Y A;  2FVF A;  3CCQ P;  3LRY A;  2Z46 A;  3M1M A;  2K0X A;  1YIT P;  2BUO A;  2ROQ A;  5F2O A;  3DS2 A;  2PEQ A;  1VQP P;  1ZMB A;  2LL8 A;  3DPH A;  1M74 A;  3CCU P;  2CWO A;  5BS1 A;  1OR5 A;  4H2W C;  1N8R Q;  2KOQ A;  1K9M Q;  1Q82 Q;  2FHS C;  2NO8 A;  2N6Y A;  4F37 A;  1UNK A;  3G29 A;  2MVV A;  2GDW A;  1GPJ A;  5EJD A;  5HV8 A;  1NJI Q;  1ACP A;  2OTL P;  2FVE A;  2ERH A;  2BHV A;  1IMQ A;  3CC2 P;  3G71 P;  5HVC A;  3DS3 A;  4BPF A;  1EOQ A;  2FAD A;  2M8N A;  2OTJ P;  2QNW A;  3G4S P;  2AF8 A;  2CG5 B;  3G28 A;  2VSQ A;  3GZL A;  3HYB A;  4PH0 A;  1Q86 Q;  2KOR A;  3E2D A;  4NEO A;  3U43 A;  1HY8 A;  2KOP A;  1K73 Q;  1M6E X;  1VQ4 P;  2JB0 A;  5JPA A;  4IPY A;  4GR2 A;  2XV6 A;  1KC8 Q;  2AFE A;  2K5X A;  3H4E A;  2VLO A;  5KP8 B;  2L0Q A;  3CCS P;  2L4B A;  2VLN A;  2KG6 A;  1RO0 A;  5F2N A;  1VQ8 P;  2PEN A;  1Q7Y Q;  2KG8 A;  2JQ4 A;  3CXC O;  2MR8 A;  1DNY A;  3G6E P;  3LMO A;  4BPH A;  4XRO A;  2KOO A;  3CCR P;  2GZI A;  2Z44 A;  3DS0 A;  2GYK A;  3Q20 A;  4WYM A;  2KGD A;  1QRJ A;  3CME P;  2MVU A;  2K2Q A;  4GR6 A;  3G0V A;  1QVG O;  2XXM A;  1RNI A;  2QEX P;  2PEO A;  1YIJ P;  1HQB A;  2PEM A;  7CEI A;  3H0D A;  4PH1 A;  4M0I A;  2PEI A;  2GZE A;  3I56 P;  3G1G A;  3MGE A;  2JYG A;  2EG5 A;  2KR5 A;  4UHP B;  1MZ8 A;  3VRL C;  2VLP A;  2KOS A;  3B4Q A;  1T8K A;  1VQ5 P;  1KQS O;  2KWL A;  5HGL A;  1IUQ A;  2N6Z A;  2M8P A;  4U0A A;  1NQ4 A;  2XZ0 D;  2KG9 A;  1E6J P;  2CQ8 A;  4U0C A;  2K94 A;  2N5H A;  2M8L A;  1M6N A;  2LIW A;  4DG9 A;  1A43 A;  1VQK P;  1S72 P;  3DS4 A;  4U0F A;  1VQ6 P;  2M5R A;  4XFX A;  3I55 P;  3HZQ A;  2JAZ A;  2PEK A;  2FQ1 A;  3CD6 P;  1YJN P;  1E0H A;  3H47 A;  4XFY A;  1L0I A;  1CEI A;  2WPT A;  5CZD B;  3CPW O;  4PXH B;  1KLP A;  2LML A;  1F80 D;  4HKG A;  3CMA P;  2GDY A;  1AYI A;  1A8O A;  1UJZ A;  1RO2 A;  1GXG A;  2N98 A;  3EJB A;  1BXI A;  2VLQ A;  1GXH A;  1QVF O;  2CGQ A;  3OW2 O;  4U0E A;  2L22 A;  2JGP A;  2GZF A;  1VQL P;  3CCJ P;  1EIA A;  2LOL A;  3CE7 A;  1JJ2 O;  5HGN A;  2JU2 A;  1YJ9 P;  2EIA A;  3NY7 B;  2XZ1 C;  1M90 Q;  1FR2 A;  3RG2 A;  2KGA A;  2JYL A;  2PNG A;  1W2B O;  4U0D A;  3CCV P;  5KP6 B;  1BAJ A;  4PWV B;  4MRT C;  2DNW A;  3WBH A;  1ZNV A;  2QA4 P;  2AFD A;  3DTJ A;  2GZJ A;  2MY5 A;  1Q81 Q;  2GZG A;  5F2K A;  2GDX A;  1DV5 A;  2KGE A;  5HGM A;  2JBG A;  4QNB A;  1EMV A;  1VQ9 P;  1X3O A;  3G26 A;  3CC7 P;  2LTE A;  3G1I A;  5BS2 A;  3DS5 A;  2CNR A;  5HGO A;  1KD1 Q;  5DCK A;  4R0M A;  2K92 A;  1K8A Q;  2K93 A;  2KOD A;  2JO0 A;  1D1D A;  2N5I A;  2LPK A;  1VHN A;  4XRQ A;  2AVA A;  2K0D X;  2PEJ A;  4BPG A;  1VQM P;  2LF4 A;  2DGY A;  1YHQ P;  2N50 A;  4IZ6 A;  1M1K Q;  3RG6 C;  4CA3 A;  4H2Y C;  2EHT A;  4H2X C;  4U0B A;  2JU1 A;  2EFJ A;  1Z6M A;  4COP A;  2OAR A;  3CC4 P;  3GZM A;  2MD9 A;  3CCM P;  2LKI A;  1L0H A;  2FAC A;  3EJD A;  4QKO A;  2FVA A;  3GJN A;  5KP7 B;  1IMP A;  4XFZ A;  3DS1 A;  2E1M A;  2P9X A;  2Z45 A;  2FQ0 A;  1VKU A;  4COC A;  1YJW P;  3G21 A;  5EW5 E;  3EJE A;  3P05 A;  2ONT A;  1VQN P;  3GKL C;  2KGC A;  1YI2 P;  2L6E A;  2X2B A;  3B5I A;  3CCE P;  2L9F A;  2FAE A; 
#chains in the Genus database with same CATH homology
 5F2K A;  4GR2 A;  2M8P A;  2XV6 A;  3CCL P;  1K30 A;  1KC8 Q;  4U0A A;  5HGM A;  1VQO P;  1AUM A;  2XT1 A;  3NTE A;  1E6J P;  3H4E A;  1VQ7 P;  4QNB A;  2PY8 A;  4U0C A;  1VQ9 P;  4IPY A;  3G26 A;  2M8L A;  5I4T G;  3CCS P;  1M6N A;  3CC7 P;  3CCQ P;  1A43 A;  3G1I A;  5BS2 A;  1VQK P;  3LRY A;  3DS5 A;  2Z46 A;  1S72 P;  1RO0 A;  3M1M A;  5F2N A;  3DS4 A;  4U0F A;  1VQ8 P;  1VQ6 P;  1YIT P;  2BUO A;  5HGO A;  5F2O A;  4XFX A;  1KD1 Q;  5DCK A;  2PEN A;  3DS2 A;  2PEQ A;  3HZQ A;  3I55 P;  1Q7Y Q;  2PEK A;  1VQP P;  3CD6 P;  1ZMB A;  1YJN P;  1K8A Q;  3DPH A;  3H47 A;  1M74 A;  4XFY A;  3CXC O;  2KOD A;  2JO0 A;  1D1D A;  3CCU P;  2CWO A;  5BS1 A;  3G6E P;  1N8R Q;  4XRO A;  3CPW O;  4XRQ A;  1K9M Q;  2PEJ A;  1Q82 Q;  3CCR P;  1VQM P;  2LF4 A;  2DGY A;  1YHQ P;  2Z44 A;  3CMA P;  3G29 A;  3DS0 A;  1M1K Q;  3RG6 C;  1RO2 A;  3Q20 A;  1A8O A;  4WYM A;  1QRJ A;  3CME P;  4U0B A;  2EFJ A;  1NJI Q;  1QVF O;  4COP A;  2OTL P;  2OAR A;  4GR6 A;  3CC4 P;  3G0V A;  3OW2 O;  1QVG O;  4U0E A;  2XXM A;  2BHV A;  3CCM P;  1VQL P;  3CC2 P;  3G71 P;  3CCJ P;  1EIA A;  1RNI A;  2QEX P;  2PEO A;  1JJ2 O;  3DS3 A;  5HGN A;  1EOQ A;  1YJ9 P;  1YIJ P;  2EIA A;  2M8N A;  2PEM A;  1M90 Q;  2OTJ P;  3G4S P;  4XFZ A;  3G28 A;  3H0D A;  4PH1 A;  4M0I A;  2PEI A;  3I56 P;  3DS1 A;  2E1M A;  3G1G A;  3HYB A;  4PH0 A;  2JYL A;  3MGE A;  2JYG A;  2P9X A;  1W2B O;  2Z45 A;  4U0D A;  1Q86 Q;  3CCV P;  2EG5 A;  1BAJ A;  3E2D A;  4COC A;  1YJW P;  3VRL C;  3G21 A;  3WBH A;  2QA4 P;  1K73 Q;  3P05 A;  2ONT A;  1M6E X;  1VQN P;  1VQ4 P;  1VQ5 P;  1KQS O;  3DTJ A;  1YI2 P;  2L6E A;  3B5I A;  5JPA A;  3CCE P;  5HGL A;  1Q81 Q;  1IUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...