2XZ0D

The structure of the 2:1 (partially occupied) complex between stearoyl acyl carrier protein desaturase from ricinus communis (castor bean) and acyl carrier protein.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
82
structure length
81
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-[ACYL-CARRIER-PROTEIN] DESATURASE, CHLOROPLASTIC
publication title Remote Control of Regioselectivity in Acyl-Acyl Carrier Protein-Desaturases.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Oxidoreductase/lipid binding protein
total genus 7
structure length 81
sequence length 82
ec nomenclature
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2xz0D00
2ROQA 2K93A 2KR5A 2CG5B 1T8KA 5KP6B 2KOSA 2KOQA 4HKGA 2FVAA 3CE7A 2JQ4A 3NY7B 1AF8A 2MR7A 2FQ0A 2KGCA 2MY5A 2N98A 4PWVB 2KGAA 5CZDB 2L4BA 2KGEA 2FACA 2LIWA 2FVFA 3EJBA 2MF4A 4BPGA 4R0MA 2K94A 4MRTC 1DV5A 2FHSC 2MVVA 2PNGA 4NEOA 2K0YA 2N50A 2FVEA 2FAEA 2GDYA 2CNRA 2KGDA 2N5IA 2KG8A 2CQ8A 2LPKA 2GDXA 3LMOA 2XZ1C 2VSQA 1F80D 1L0IA 2JU2A 2N6YA 2KOOA 5KP7B 2AF8A 2L0QA 2LIUA 5HVCA 2LTEA 2LMLA 2JGPA 3GZMA 1ACPA 2AFDA 2AFEA 2KG9A 3GZLA 2FQ1A 2KOPA 1VKUA 4H2YC 4DG9A 2L9FA 5KP8B 2K2QA 1HQBA 2AVAA 2N6ZA 2FQ2A 4IZ6A 3RG2A 2MVUA 2EHTA 2KW2A 2QNWA 2JU1A 1HY8A 4CA3A 4PXHB 2N5HA 2MD9A 4H2XC 4BPFA 2KORA 3EJDA 1X3OA 2GDWA 2LOLA 2LKIA 2EHSA 4BPHA 1KLPA 2L22A 2M5RA 2XZ0D 1DNYA 3EJEA 2MR8A 2KG6A 2FADA 2KWLA 5EJDA 1OR5A 4H2WC 2CGQA 2LL8A 5HV8A 1NQ4A 2K0XA 2X2BA 1L0HA 2K92A 2DNWA
chains in the Genus database with same CATH superfamily
2ROQA 2BUOA 2KR5A 1Q81Q 1T8KA 3I55P 4U0BA 2JQ4A 3CCRP 2FQ0A 3CCMP 2VLNA 2PEIA 1M6NA 2KGEA 2FACA 2LIWA 3B5IA 3DTJA 1QVGO 3I56P 2M8PA 1VQ7P 2FVFA 1VQ8P 1KQSO 1K73Q 3CCJP 2FHSC 2PEJA 4QKOA 2LF4A 2KGDA 2LPKA 2GDXA 3LMOA 5HGLA 4PH0A 3OW2O 4PH1A 1VQ4P 2ONTA 2LMLA 3CMAP 3HYBA 3GZMA 2QA4P 2GZEA 2CWOA 3GZLA 1K8AQ 1BXIA 2L9FA 3LRYA 1M90Q 1KD1Q 2PY8A 1A8OA 2EHTA 2JU1A 4CA3A 1Q86Q 4U0FA 1YJWP 1FR2A 2M8LA 2N5HA 2MD9A 2KORA 2LOLA 2L22A 5DCKA 5EW5E 4XFZA 3G26A 5F2NA 5BS1A 1VQ5P 1OR5A 5HV8A 1NQ4A 2K0XA 2PEMA 1RO0A 2P9XA 1YHQP 2XXMA 2PEQA 1S72P 2KOSA 2Z46A 3DS1A 2FVAA 5HGOA 3CE7A 3CMEP 4XFXA 2EIAA 3CC4P 4PWVB 1M6EX 5CZDB 2PEOA 2GYKA 1IMQA 3CCEP 2E1MA 4COCA 3DS5A 2K94A 4MRTC 1EIAA 1YI2P 2FAEA 1Z6MA 3CCQP 4XROA 5HGMA 2N5IA 1K30A 2ERHA 1L0IA 2JU2A 2K0DX 2N6YA 4XRQA 4GR6A 2JAZA 1QVFO 2VLQA 2PEKA 2JGPA 1A43A 1IUQA 3Q20A 4U0EA 1ACPA 4DG9A 2FQ1A 5F2KA 1MZ8A 1GXHA 4F37A 3NTEA 3DPHA 2GZFA 2KW2A 2JBGA 3CC7P 1HY8A 2Z44A 2LKIA 2EHSA 2NO8A 2XZ0D 1Q82Q 2GZJA 4U0CA 3E2DA 1EOQA 2X2BA 4HKGA 2DNWA 1QRJA 3G1IA 2CG5B 5KP6B 2KOQA 5I4TG 2MR7A 2MY5A 4XFYA 1GXGA 2KGAA 2L4BA 3CCUP 4UHPB 3G29A 4QNBA 2XT1A 3EJBA 2OTJP 2PENA 3G6EP 3WBHA 1M1KQ 3HZQA 2N50A 2GZGA 1UNKA 2Z45A 2GDYA 2DGYA 2QEXP 1BAJA 1VQNP 2XZ1C 2VSQA 1F80D 4WYMA 5KP7B 1YITP 2LIUA 1CEIA 4COPA 1VQ9P 2L6EA 2KODA 2K5XA 1RO2A 2AFDA 2AFEA 2KG9A 4H2YC 3DS2A 2K2QA 2N6ZA 3G1GA 2FQ2A 1K9MQ 3CCLP 3CCVP 3DS4A 1VQOP 1VQMP 3H47A 2OTLP 4H2XC 4U0AA 2EG5A 3EJDA 2GDWA 2JO0A 2M5RA 1DNYA 3EJEA 2MR8A 2KG6A 2KWLA 3DS3A 2CGQA 2LL8A 2K92A 4U0DA 3G0VA 2K93A 3P05A 3G28A 2JYGA 3NY7B 1AF8A 2JB0A 5BS2A 1ZNVA 2KGCA 2N98A 3H4EA 1VQPP 3GJNA 2VLPA 2VLOA 4M0IA 3CC2P 3MGEA 1VQ6P 1GPJA 2EFJA 4R0MA 4BPGA 2MF4A 5JPAA 3G4SP 1N8RQ 1DV5A 1JJ2O 4IPYA 2MVVA 2BHVA 2PNGA 4NEOA 1EMVA 2K0YA 3M1MA 2FVEA 3U43A 2CNRA 1AUMA 1W2BO 2KG8A 3CXCO 2XV6A 2CQ8A 3CPWO 1NJIQ 1E0HA 1ZMBA 2KOOA 2AF8A 1YJ9P 2L0QA 7CEIA 5HVCA 2LTEA 2M8NA 3G21A 3VRLC 3H0DA 2JYLA 1VQKP 1M74A 3RG6C 1YJNP 2KOPA 1VKUA 1E6JP 5KP8B 1HQBA 1VHNA 2AVAA 4IZ6A 3RG2A 1Q7YQ 1YIJP 2MVUA 4GR2A 2QNWA 2OARA 4PXHB 1RNIA 1KC8Q 3G71P 4BPFA 3B4QA 1X3OA 3GKLC 3DS0A 1IMPA 4BPHA 1KLPA 1D1DA 1VQLP 2FADA 1AYIA 1UJZA 5EJDA 5F2OA 4H2WC 2GZIA 3CD6P 2WPTA 1L0HA 3CCSP 5HGNA
chains in the Genus database with same CATH topology
2ROQA 2K93A 2KR5A 2CG5B 1T8KA 5KP6B 2KOSA 2KOQA 4HKGA 2FVAA 3CE7A 2JQ4A 3NY7B 1AF8A 2MR7A 2FQ0A 2KGCA 2MY5A 2N98A 4PWVB 2KGAA 5CZDB 2L4BA 2KGEA 2FACA 2LIWA 2FVFA 3EJBA 2MF4A 4BPGA 4R0MA 2K94A 4MRTC 1DV5A 2FHSC 2MVVA 2PNGA 4NEOA 2K0YA 2N50A 2FVEA 2FAEA 2GDYA 2CNRA 2KGDA 2N5IA 2KG8A 2CQ8A 2LPKA 2GDXA 3LMOA 2XZ1C 2VSQA 1F80D 1L0IA 2JU2A 2N6YA 2KOOA 5KP7B 2AF8A 2L0QA 2LIUA 5HVCA 2LTEA 2LMLA 2JGPA 3GZMA 1ACPA 2AFDA 2AFEA 2KG9A 3GZLA 2FQ1A 2KOPA 1VKUA 4H2YC 4DG9A 2L9FA 5KP8B 2K2QA 1HQBA 2AVAA 2N6ZA 2FQ2A 4IZ6A 3RG2A 2MVUA 2EHTA 2KW2A 2QNWA 2JU1A 1HY8A 4CA3A 4PXHB 2N5HA 2MD9A 4H2XC 4BPFA 2KORA 3EJDA 1X3OA 2GDWA 2LOLA 2LKIA 2EHSA 4BPHA 1KLPA 2L22A 2M5RA 2XZ0D 1DNYA 3EJEA 2MR8A 2KG6A 2FADA 2KWLA 5EJDA 1OR5A 4H2WC 2CGQA 2LL8A 5HV8A 1NQ4A 2K0XA 2X2BA 1L0HA 2K92A 2DNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROQ A;  2K93 A;  2KR5 A;  2CG5 B;  1T8K A;  5KP6 B;  2KOS A;  2KOQ A;  4HKG A;  2FVA A;  3CE7 A;  2JQ4 A;  3NY7 B;  1AF8 A;  2MR7 A;  2FQ0 A;  2KGC A;  2MY5 A;  2N98 A;  4PWV B;  2KGA A;  5CZD B;  2L4B A;  2KGE A;  2FAC A;  2LIW A;  2FVF A;  3EJB A;  2MF4 A;  4BPG A;  4R0M A;  2K94 A;  4MRT C;  1DV5 A;  2FHS C;  2MVV A;  2PNG A;  4NEO A;  2K0Y A;  2N50 A;  2FVE A;  2FAE A;  2GDY A;  2CNR A;  2KGD A;  2N5I A;  2KG8 A;  2CQ8 A;  2LPK A;  2GDX A;  3LMO A;  2XZ1 C;  2VSQ A;  1F80 D;  1L0I A;  2JU2 A;  2N6Y A;  2KOO A;  5KP7 B;  2AF8 A;  2L0Q A;  2LIU A;  5HVC A;  2LTE A;  2LML A;  2JGP A;  3GZM A;  1ACP A;  2AFD A;  2AFE A;  2KG9 A;  3GZL A;  2FQ1 A;  2KOP A;  1VKU A;  4H2Y C;  4DG9 A;  2L9F A;  5KP8 B;  2K2Q A;  1HQB A;  2AVA A;  2N6Z A;  2FQ2 A;  4IZ6 A;  3RG2 A;  2MVU A;  2EHT A;  2KW2 A;  2QNW A;  2JU1 A;  1HY8 A;  4CA3 A;  4PXH B;  2N5H A;  2MD9 A;  4H2X C;  4BPF A;  2KOR A;  3EJD A;  1X3O A;  2GDW A;  2LOL A;  2LKI A;  2EHS A;  4BPH A;  1KLP A;  2L22 A;  2M5R A;  2XZ0 D;  1DNY A;  3EJE A;  2MR8 A;  2KG6 A;  2FAD A;  2KWL A;  5EJD A;  1OR5 A;  4H2W C;  2CGQ A;  2LL8 A;  5HV8 A;  1NQ4 A;  2K0X A;  2X2B A;  1L0H A;  2K92 A;  2DNW A; 
#chains in the Genus database with same CATH topology
 2ROQ A;  2BUO A;  2KR5 A;  1Q81 Q;  1T8K A;  3I55 P;  4U0B A;  2JQ4 A;  3CCR P;  2FQ0 A;  3CCM P;  2VLN A;  2PEI A;  1M6N A;  2KGE A;  2FAC A;  2LIW A;  3B5I A;  3DTJ A;  1QVG O;  3I56 P;  2M8P A;  1VQ7 P;  2FVF A;  1VQ8 P;  1KQS O;  1K73 Q;  3CCJ P;  2FHS C;  2PEJ A;  4QKO A;  2LF4 A;  2KGD A;  2LPK A;  2GDX A;  3LMO A;  5HGL A;  4PH0 A;  3OW2 O;  4PH1 A;  1VQ4 P;  2ONT A;  2LML A;  3CMA P;  3HYB A;  3GZM A;  2QA4 P;  2GZE A;  2CWO A;  3GZL A;  1K8A Q;  1BXI A;  2L9F A;  3LRY A;  1M90 Q;  1KD1 Q;  2PY8 A;  1A8O A;  2EHT A;  2JU1 A;  4CA3 A;  1Q86 Q;  4U0F A;  1YJW P;  1FR2 A;  2M8L A;  2N5H A;  2MD9 A;  2KOR A;  2LOL A;  2L22 A;  5DCK A;  5EW5 E;  4XFZ A;  3G26 A;  5F2N A;  5BS1 A;  1VQ5 P;  1OR5 A;  5HV8 A;  1NQ4 A;  2K0X A;  2PEM A;  1RO0 A;  2P9X A;  1YHQ P;  2XXM A;  2PEQ A;  1S72 P;  2KOS A;  2Z46 A;  3DS1 A;  2FVA A;  5HGO A;  3CE7 A;  3CME P;  4XFX A;  2EIA A;  3CC4 P;  4PWV B;  1M6E X;  5CZD B;  2PEO A;  2GYK A;  1IMQ A;  3CCE P;  2E1M A;  4COC A;  3DS5 A;  2K94 A;  4MRT C;  1EIA A;  1YI2 P;  2FAE A;  1Z6M A;  3CCQ P;  4XRO A;  5HGM A;  2N5I A;  1K30 A;  2ERH A;  1L0I A;  2JU2 A;  2K0D X;  2N6Y A;  4XRQ A;  4GR6 A;  2JAZ A;  1QVF O;  2VLQ A;  2PEK A;  2JGP A;  1A43 A;  1IUQ A;  3Q20 A;  4U0E A;  1ACP A;  4DG9 A;  2FQ1 A;  5F2K A;  1MZ8 A;  1GXH A;  4F37 A;  3NTE A;  3DPH A;  2GZF A;  2KW2 A;  2JBG A;  3CC7 P;  1HY8 A;  2Z44 A;  2LKI A;  2EHS A;  2NO8 A;  2XZ0 D;  1Q82 Q;  2GZJ A;  4U0C A;  3E2D A;  1EOQ A;  2X2B A;  4HKG A;  2DNW A;  1QRJ A;  3G1I A;  2CG5 B;  5KP6 B;  2KOQ A;  5I4T G;  2MR7 A;  2MY5 A;  4XFY A;  1GXG A;  2KGA A;  2L4B A;  3CCU P;  4UHP B;  3G29 A;  4QNB A;  2XT1 A;  3EJB A;  2OTJ P;  2PEN A;  3G6E P;  3WBH A;  1M1K Q;  3HZQ A;  2N50 A;  2GZG A;  1UNK A;  2Z45 A;  2GDY A;  2DGY A;  2QEX P;  1BAJ A;  1VQN P;  2XZ1 C;  2VSQ A;  1F80 D;  4WYM A;  5KP7 B;  1YIT P;  2LIU A;  1CEI A;  4COP A;  1VQ9 P;  2L6E A;  2KOD A;  2K5X A;  1RO2 A;  2AFD A;  2AFE A;  2KG9 A;  4H2Y C;  3DS2 A;  2K2Q A;  2N6Z A;  3G1G A;  2FQ2 A;  1K9M Q;  3CCL P;  3CCV P;  3DS4 A;  1VQO P;  1VQM P;  3H47 A;  2OTL P;  4H2X C;  4U0A A;  2EG5 A;  3EJD A;  2GDW A;  2JO0 A;  2M5R A;  1DNY A;  3EJE A;  2MR8 A;  2KG6 A;  2KWL A;  3DS3 A;  2CGQ A;  2LL8 A;  2K92 A;  4U0D A;  3G0V A;  2K93 A;  3P05 A;  3G28 A;  2JYG A;  3NY7 B;  1AF8 A;  2JB0 A;  5BS2 A;  1ZNV A;  2KGC A;  2N98 A;  3H4E A;  1VQP P;  3GJN A;  2VLP A;  2VLO A;  4M0I A;  3CC2 P;  3MGE A;  1VQ6 P;  1GPJ A;  2EFJ A;  4R0M A;  4BPG A;  2MF4 A;  5JPA A;  3G4S P;  1N8R Q;  1DV5 A;  1JJ2 O;  4IPY A;  2MVV A;  2BHV A;  2PNG A;  4NEO A;  1EMV A;  2K0Y A;  3M1M A;  2FVE A;  3U43 A;  2CNR A;  1AUM A;  1W2B O;  2KG8 A;  3CXC O;  2XV6 A;  2CQ8 A;  3CPW O;  1NJI Q;  1E0H A;  1ZMB A;  2KOO A;  2AF8 A;  1YJ9 P;  2L0Q A;  7CEI A;  5HVC A;  2LTE A;  2M8N A;  3G21 A;  3VRL C;  3H0D A;  2JYL A;  1VQK P;  1M74 A;  3RG6 C;  1YJN P;  2KOP A;  1VKU A;  1E6J P;  5KP8 B;  1HQB A;  1VHN A;  2AVA A;  4IZ6 A;  3RG2 A;  1Q7Y Q;  1YIJ P;  2MVU A;  4GR2 A;  2QNW A;  2OAR A;  4PXH B;  1RNI A;  1KC8 Q;  3G71 P;  4BPF A;  3B4Q A;  1X3O A;  3GKL C;  3DS0 A;  1IMP A;  4BPH A;  1KLP A;  1D1D A;  1VQL P;  2FAD A;  1AYI A;  1UJZ A;  5EJD A;  5F2O A;  4H2W C;  2GZI A;  3CD6 P;  2WPT A;  1L0H A;  3CCS P;  5HGN A; 
#chains in the Genus database with same CATH homology
 2ROQ A;  2K93 A;  2KR5 A;  2CG5 B;  1T8K A;  5KP6 B;  2KOS A;  2KOQ A;  4HKG A;  2FVA A;  3CE7 A;  2JQ4 A;  3NY7 B;  1AF8 A;  2MR7 A;  2FQ0 A;  2KGC A;  2MY5 A;  2N98 A;  4PWV B;  2KGA A;  5CZD B;  2L4B A;  2KGE A;  2FAC A;  2LIW A;  2FVF A;  3EJB A;  2MF4 A;  4BPG A;  4R0M A;  2K94 A;  4MRT C;  1DV5 A;  2FHS C;  2MVV A;  2PNG A;  4NEO A;  2K0Y A;  2N50 A;  2FVE A;  2FAE A;  2GDY A;  2CNR A;  2KGD A;  2N5I A;  2KG8 A;  2CQ8 A;  2LPK A;  2GDX A;  3LMO A;  2XZ1 C;  2VSQ A;  1F80 D;  1L0I A;  2JU2 A;  2N6Y A;  2KOO A;  5KP7 B;  2AF8 A;  2L0Q A;  2LIU A;  5HVC A;  2LTE A;  2LML A;  2JGP A;  3GZM A;  1ACP A;  2AFD A;  2AFE A;  2KG9 A;  3GZL A;  2FQ1 A;  2KOP A;  1VKU A;  4H2Y C;  4DG9 A;  2L9F A;  5KP8 B;  2K2Q A;  1HQB A;  2AVA A;  2N6Z A;  2FQ2 A;  4IZ6 A;  3RG2 A;  2MVU A;  2EHT A;  2KW2 A;  2QNW A;  2JU1 A;  1HY8 A;  4CA3 A;  4PXH B;  2N5H A;  2MD9 A;  4H2X C;  4BPF A;  2KOR A;  3EJD A;  1X3O A;  2GDW A;  2LOL A;  2LKI A;  2EHS A;  4BPH A;  1KLP A;  2L22 A;  2M5R A;  2XZ0 D;  1DNY A;  3EJE A;  2MR8 A;  2KG6 A;  2FAD A;  2KWL A;  5EJD A;  1OR5 A;  4H2W C;  2CGQ A;  2LL8 A;  5HV8 A;  1NQ4 A;  2K0X A;  2X2B A;  1L0H A;  2K92 A;  2DNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...