2XZ0D

The structure of the 2:1 (partially occupied) complex between stearoyl acyl carrier protein desaturase from ricinus communis (castor bean) and acyl carrier protein.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
82
structure length
81
Chain Sequence
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/lipid binding protein
molecule keywords ACYL-[ACYL-CARRIER-PROTEIN] DESATURASE, CHLOROPLASTIC
publication title Remote Control of Regioselectivity in Acyl-Acyl Carrier Protein-Desaturases.
pubmed doi rcsb
source organism Ricinus communis
total genus 7
structure length 81
sequence length 82
ec nomenclature
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2xz0D00
1HQBA 2KGEA 4BPHA 2LIUA 3CE7A 1X3OA 3EJEA 1L0IA 2LKIA 2M5RA 2MR7A 2MY5A 1VKUA 2N6YA 2JU1A 2DNWA 2FAEA 2K92A 4H2XC 2PNGA 2AVAA 2EHTA 2EHSA 4PXHB 2KG6A 5HV8A 2JQ4A 2K0XA 2FQ0A 2N5IA 4MRTC 2KOQA 3GZMA 2FVFA 2GDXA 2L0QA 1F80D 5KP7B 2KORA 2LIWA 2CG5B 4H2YC 1ACPA 1L0HA 2LPKA 2AF8A 2L22A 2N6ZA 5CZDB 3EJDA 1T8KA 2FQ2A 4BPGA 2LOLA 1HY8A 2LTEA 2K0YA 5EJDA 1KLPA 4BPFA 2AFDA 2KOOA 2GDYA 2JU2A 2FADA 2LL8A 5HVCA 2X2BA 2KG8A 4IZ6A 2QNWA 4H2WC 3NY7B 2K93A 2KR5A 3RG2A 1DV5A 2CGQA 2MVVA 2FVAA 2ROQA 2KOPA 2L9FA 2KW2A 2MF4A 2FHSC 4CA3A 3LMOA 2KGDA 1NQ4A 2FVEA 2VSQA 2L4BA 2LMLA 1DNYA 2KG9A 2FQ1A 2MVUA 2XZ1C 5KP6B 2XZ0D 2K94A 4PWVB 2CNRA 4NEOA 2KOSA 2KWLA 2KGAA 2JGPA 2K2QA 4DG9A 5KP8B 2CQ8A 2MD9A 2FACA 2KGCA 2MR8A 2GDWA 2N5HA 2N98A 2AFEA 3EJBA 4HKGA 2N50A 1AF8A 4R0MA 1OR5A 3GZLA
chains in the Genus database with same CATH superfamily
2K5XA 4BPHA 1K8AQ 1VQMP 1VKUA 2N6YA 1RNIA 2PNGA 1VQLP 2FQ0A 2N5IA 1N8RQ 3CPWO 5F2KA 3GZMA 1ACPA 2L22A 4IPYA 1KC8Q 1VQ4P 2OTJP 2ERHA 2NO8A 4COCA 1FR2A 2K0YA 5DCKA 3H4EA 2KOOA 2PEKA 1KD1Q 3P05A 5JPAA 1M90Q 2JYGA 2X2BA 5BS2A 2LF4A 2GZJA 5HGLA 1RO2A 1Q7YQ 2E1MA 2GZFA 3G4SP 4CA3A 1VQNP 3LMOA 2LMLA 1JJ2O 2XZ1C 3NTEA 1ZMBA 2XT1A 4NEOA 2VLOA 2KGAA 4GR2A 4DG9A 5KP8B 1ZNVA 1S72P 2XV6A 2XXMA 2KGCA 1EIAA 2N98A 2AFEA 1YJ9P 3B5IA 3G26A 1E6JP 3DS4A 1IMPA 3H47A 3CMAP 1YHQP 4U0CA 3G29A 1X3OA 1AUMA 1L0IA 2LKIA 2MY5A 2EHTA 4PXHB 2KG6A 5HV8A 2K0XA 4QNBA 2QEXP 2FVFA 3Q20A 3WBHA 2L0QA 1VQKP 2EFJA 2PEJA 1GPJA 1YJWP 1EMVA 2LPKA 2AF8A 5CZDB 1D1DA 3G71P 3EJDA 4BPGA 2LTEA 1Q81Q 3G21A 4XROA 1M6EX 5EJDA 3CCMP 4U0FA 2GDYA 4PH0A 3CCVP 2LL8A 5HVCA 2QNWA 3NY7B 7CEIA 2EG5A 2GZEA 1GXGA 2CGQA 4XFXA 2CWOA 4XFYA 1QVFO 3LRYA 1IUQA 1BAJA 1Z6MA 2KOPA 2WPTA 3CC2P 2L9FA 2KW2A 2PY8A 4GR6A 1IMQA 1K73Q 3GKLC 2VSQA 2PEQA 4PH1A 4U0BA 5HGMA 2VLNA 2PEMA 2CNRA 3MGEA 3E2DA 2KWLA 2K2QA 2OARA 1VQ5P 2BUOA 2MR8A 2N5HA 1UNKA 3CCJP 2P9XA 1CEIA 3CC4P 3DPHA 1DV5A 3CD6P 1YJNP 3CE7A 5BS1A 3EJEA 2M8LA 2GZIA 2L6EA 2JU1A 5I4TG 4H2XC 2AVAA 2EHSA 3B4QA 4MRTC 3CCEP 1F80D 5KP7B 5F2NA 2JO0A 2KODA 1L0HA 1E0HA 4F37A 1A8OA 1HY8A 1VQ9P 2BHVA 3G1GA 2JBGA 1KLPA 3CCRP 4BPFA 3CCQP 3DS0A 2M8NA 3CXCO 2KG8A 1VQ8P 4IZ6A 3G6EP 1RO0A 3RG2A 2M8PA 3DS2A 5EW5E 3CMEP 2FVAA 1MZ8A 1Q86Q 2ROQA 1GXHA 3CCUP 3DS1A 2FHSC 1QVGO 2PENA 5HGNA 1AYIA 4UHPB 2KG9A 4WYMA 4COPA 2XZ0D 3H0DA 2GZGA 4PWVB 1UJZA 2KOSA 3HZQA 1KQSO 5F2OA 1M6NA 2OTLP 2MD9A 2FACA 3OW2O 1W2BO 1QRJA 2N50A 3RG6C 1AF8A 4R0MA 2QA4P 2EIAA 4XRQA 2VLQA 1OR5A 1HQBA 2KGEA 4QKOA 1VHNA 2LIUA 3DTJA 1YI2P 2M5RA 1VQPP 2MR7A 2Z45A 4XFZA 2DNWA 2FAEA 3I56P 2K92A 3CCLP 1M1KQ 2JQ4A 1VQ7P 2PEIA 1VQ6P 2KOQA 2GDXA 3DS5A 1YITP 2PEOA 1EOQA 2KORA 2CG5B 2LIWA 4H2YC 2N6ZA 1T8KA 2FQ2A 2JAZA 2LOLA 3DS3A 1VQOP 3G28A 1YIJP 4U0DA 1K30A 2AFDA 2JU2A 1M74A 2FADA 3VRLC 4H2WC 2JB0A 4U0EA 3CC7P 2K93A 2KR5A 2ONTA 2MVVA 2K0DX 4U0AA 2GYKA 3I55P 1A43A 2Z44A 2Z46A 2MF4A 1K9MQ 2KGDA 4M0IA 2JYLA 1NQ4A 2FVEA 2L4BA 3HYBA 1DNYA 2FQ1A 2MVUA 1BXIA 5KP6B 2VLPA 2K94A 5HGOA 1Q82Q 2JGPA 3G1IA 2DGYA 2CQ8A 2GDWA 1NJIQ 3EJBA 4HKGA 3GJNA 3M1MA 3U43A 3G0VA 3CCSP 3GZLA
chains in the Genus database with same CATH topology
1HQBA 2KGEA 4BPHA 2LIUA 3CE7A 1X3OA 3EJEA 1L0IA 2LKIA 2M5RA 2MR7A 2MY5A 1VKUA 2N6YA 2JU1A 2DNWA 2FAEA 2K92A 4H2XC 2PNGA 2AVAA 2EHTA 2EHSA 4PXHB 2KG6A 5HV8A 2JQ4A 2K0XA 2FQ0A 2N5IA 4MRTC 2KOQA 3GZMA 2FVFA 2GDXA 2L0QA 1F80D 5KP7B 2KORA 2LIWA 2CG5B 4H2YC 1ACPA 1L0HA 2LPKA 2AF8A 2L22A 2N6ZA 5CZDB 3EJDA 1T8KA 2FQ2A 4BPGA 2LOLA 1HY8A 2LTEA 2K0YA 5EJDA 1KLPA 4BPFA 2AFDA 2KOOA 2GDYA 2JU2A 2FADA 2LL8A 5HVCA 2X2BA 2KG8A 4IZ6A 2QNWA 4H2WC 3NY7B 2K93A 2KR5A 3RG2A 1DV5A 2CGQA 2MVVA 2FVAA 2ROQA 2KOPA 2L9FA 2KW2A 2MF4A 2FHSC 4CA3A 3LMOA 2KGDA 1NQ4A 2FVEA 2VSQA 2L4BA 2LMLA 1DNYA 2KG9A 2FQ1A 2MVUA 2XZ1C 5KP6B 2XZ0D 2K94A 4PWVB 2CNRA 4NEOA 2KOSA 2KWLA 2KGAA 2JGPA 2K2QA 4DG9A 5KP8B 2CQ8A 2MD9A 2FACA 2KGCA 2MR8A 2GDWA 2N5HA 2N98A 2AFEA 3EJBA 4HKGA 2N50A 1AF8A 4R0MA 1OR5A 3GZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQB A;  2KGE A;  4BPH A;  2LIU A;  3CE7 A;  1X3O A;  3EJE A;  1L0I A;  2LKI A;  2M5R A;  2MR7 A;  2MY5 A;  1VKU A;  2N6Y A;  2JU1 A;  2DNW A;  2FAE A;  2K92 A;  4H2X C;  2PNG A;  2AVA A;  2EHT A;  2EHS A;  4PXH B;  2KG6 A;  5HV8 A;  2JQ4 A;  2K0X A;  2FQ0 A;  2N5I A;  4MRT C;  2KOQ A;  3GZM A;  2FVF A;  2GDX A;  2L0Q A;  1F80 D;  5KP7 B;  2KOR A;  2LIW A;  2CG5 B;  4H2Y C;  1ACP A;  1L0H A;  2LPK A;  2AF8 A;  2L22 A;  2N6Z A;  5CZD B;  3EJD A;  1T8K A;  2FQ2 A;  4BPG A;  2LOL A;  1HY8 A;  2LTE A;  2K0Y A;  5EJD A;  1KLP A;  4BPF A;  2AFD A;  2KOO A;  2GDY A;  2JU2 A;  2FAD A;  2LL8 A;  5HVC A;  2X2B A;  2KG8 A;  4IZ6 A;  2QNW A;  4H2W C;  3NY7 B;  2K93 A;  2KR5 A;  3RG2 A;  1DV5 A;  2CGQ A;  2MVV A;  2FVA A;  2ROQ A;  2KOP A;  2L9F A;  2KW2 A;  2MF4 A;  2FHS C;  4CA3 A;  3LMO A;  2KGD A;  1NQ4 A;  2FVE A;  2VSQ A;  2L4B A;  2LML A;  1DNY A;  2KG9 A;  2FQ1 A;  2MVU A;  2XZ1 C;  5KP6 B;  2XZ0 D;  2K94 A;  4PWV B;  2CNR A;  4NEO A;  2KOS A;  2KWL A;  2KGA A;  2JGP A;  2K2Q A;  4DG9 A;  5KP8 B;  2CQ8 A;  2MD9 A;  2FAC A;  2KGC A;  2MR8 A;  2GDW A;  2N5H A;  2N98 A;  2AFE A;  3EJB A;  4HKG A;  2N50 A;  1AF8 A;  4R0M A;  1OR5 A;  3GZL A; 
#chains in the Genus database with same CATH topology
 2K5X A;  4BPH A;  1K8A Q;  1VQM P;  1VKU A;  2N6Y A;  1RNI A;  2PNG A;  1VQL P;  2FQ0 A;  2N5I A;  1N8R Q;  3CPW O;  5F2K A;  3GZM A;  1ACP A;  2L22 A;  4IPY A;  1KC8 Q;  1VQ4 P;  2OTJ P;  2ERH A;  2NO8 A;  4COC A;  1FR2 A;  2K0Y A;  5DCK A;  3H4E A;  2KOO A;  2PEK A;  1KD1 Q;  3P05 A;  5JPA A;  1M90 Q;  2JYG A;  2X2B A;  5BS2 A;  2LF4 A;  2GZJ A;  5HGL A;  1RO2 A;  1Q7Y Q;  2E1M A;  2GZF A;  3G4S P;  4CA3 A;  1VQN P;  3LMO A;  2LML A;  1JJ2 O;  2XZ1 C;  3NTE A;  1ZMB A;  2XT1 A;  4NEO A;  2VLO A;  2KGA A;  4GR2 A;  4DG9 A;  5KP8 B;  1ZNV A;  1S72 P;  2XV6 A;  2XXM A;  2KGC A;  1EIA A;  2N98 A;  2AFE A;  1YJ9 P;  3B5I A;  3G26 A;  1E6J P;  3DS4 A;  1IMP A;  3H47 A;  3CMA P;  1YHQ P;  4U0C A;  3G29 A;  1X3O A;  1AUM A;  1L0I A;  2LKI A;  2MY5 A;  2EHT A;  4PXH B;  2KG6 A;  5HV8 A;  2K0X A;  4QNB A;  2QEX P;  2FVF A;  3Q20 A;  3WBH A;  2L0Q A;  1VQK P;  2EFJ A;  2PEJ A;  1GPJ A;  1YJW P;  1EMV A;  2LPK A;  2AF8 A;  5CZD B;  1D1D A;  3G71 P;  3EJD A;  4BPG A;  2LTE A;  1Q81 Q;  3G21 A;  4XRO A;  1M6E X;  5EJD A;  3CCM P;  4U0F A;  2GDY A;  4PH0 A;  3CCV P;  2LL8 A;  5HVC A;  2QNW A;  3NY7 B;  7CEI A;  2EG5 A;  2GZE A;  1GXG A;  2CGQ A;  4XFX A;  2CWO A;  4XFY A;  1QVF O;  3LRY A;  1IUQ A;  1BAJ A;  1Z6M A;  2KOP A;  2WPT A;  3CC2 P;  2L9F A;  2KW2 A;  2PY8 A;  4GR6 A;  1IMQ A;  1K73 Q;  3GKL C;  2VSQ A;  2PEQ A;  4PH1 A;  4U0B A;  5HGM A;  2VLN A;  2PEM A;  2CNR A;  3MGE A;  3E2D A;  2KWL A;  2K2Q A;  2OAR A;  1VQ5 P;  2BUO A;  2MR8 A;  2N5H A;  1UNK A;  3CCJ P;  2P9X A;  1CEI A;  3CC4 P;  3DPH A;  1DV5 A;  3CD6 P;  1YJN P;  3CE7 A;  5BS1 A;  3EJE A;  2M8L A;  2GZI A;  2L6E A;  2JU1 A;  5I4T G;  4H2X C;  2AVA A;  2EHS A;  3B4Q A;  4MRT C;  3CCE P;  1F80 D;  5KP7 B;  5F2N A;  2JO0 A;  2KOD A;  1L0H A;  1E0H A;  4F37 A;  1A8O A;  1HY8 A;  1VQ9 P;  2BHV A;  3G1G A;  2JBG A;  1KLP A;  3CCR P;  4BPF A;  3CCQ P;  3DS0 A;  2M8N A;  3CXC O;  2KG8 A;  1VQ8 P;  4IZ6 A;  3G6E P;  1RO0 A;  3RG2 A;  2M8P A;  3DS2 A;  5EW5 E;  3CME P;  2FVA A;  1MZ8 A;  1Q86 Q;  2ROQ A;  1GXH A;  3CCU P;  3DS1 A;  2FHS C;  1QVG O;  2PEN A;  5HGN A;  1AYI A;  4UHP B;  2KG9 A;  4WYM A;  4COP A;  2XZ0 D;  3H0D A;  2GZG A;  4PWV B;  1UJZ A;  2KOS A;  3HZQ A;  1KQS O;  5F2O A;  1M6N A;  2OTL P;  2MD9 A;  2FAC A;  3OW2 O;  1W2B O;  1QRJ A;  2N50 A;  3RG6 C;  1AF8 A;  4R0M A;  2QA4 P;  2EIA A;  4XRQ A;  2VLQ A;  1OR5 A;  1HQB A;  2KGE A;  4QKO A;  1VHN A;  2LIU A;  3DTJ A;  1YI2 P;  2M5R A;  1VQP P;  2MR7 A;  2Z45 A;  4XFZ A;  2DNW A;  2FAE A;  3I56 P;  2K92 A;  3CCL P;  1M1K Q;  2JQ4 A;  1VQ7 P;  2PEI A;  1VQ6 P;  2KOQ A;  2GDX A;  3DS5 A;  1YIT P;  2PEO A;  1EOQ A;  2KOR A;  2CG5 B;  2LIW A;  4H2Y C;  2N6Z A;  1T8K A;  2FQ2 A;  2JAZ A;  2LOL A;  3DS3 A;  1VQO P;  3G28 A;  1YIJ P;  4U0D A;  1K30 A;  2AFD A;  2JU2 A;  1M74 A;  2FAD A;  3VRL C;  4H2W C;  2JB0 A;  4U0E A;  3CC7 P;  2K93 A;  2KR5 A;  2ONT A;  2MVV A;  2K0D X;  4U0A A;  2GYK A;  3I55 P;  1A43 A;  2Z44 A;  2Z46 A;  2MF4 A;  1K9M Q;  2KGD A;  4M0I A;  2JYL A;  1NQ4 A;  2FVE A;  2L4B A;  3HYB A;  1DNY A;  2FQ1 A;  2MVU A;  1BXI A;  5KP6 B;  2VLP A;  2K94 A;  5HGO A;  1Q82 Q;  2JGP A;  3G1I A;  2DGY A;  2CQ8 A;  2GDW A;  1NJI Q;  3EJB A;  4HKG A;  3GJN A;  3M1M A;  3U43 A;  3G0V A;  3CCS P;  3GZL A; 
#chains in the Genus database with same CATH homology
 1HQB A;  2KGE A;  4BPH A;  2LIU A;  3CE7 A;  1X3O A;  3EJE A;  1L0I A;  2LKI A;  2M5R A;  2MR7 A;  2MY5 A;  1VKU A;  2N6Y A;  2JU1 A;  2DNW A;  2FAE A;  2K92 A;  4H2X C;  2PNG A;  2AVA A;  2EHT A;  2EHS A;  4PXH B;  2KG6 A;  5HV8 A;  2JQ4 A;  2K0X A;  2FQ0 A;  2N5I A;  4MRT C;  2KOQ A;  3GZM A;  2FVF A;  2GDX A;  2L0Q A;  1F80 D;  5KP7 B;  2KOR A;  2LIW A;  2CG5 B;  4H2Y C;  1ACP A;  1L0H A;  2LPK A;  2AF8 A;  2L22 A;  2N6Z A;  5CZD B;  3EJD A;  1T8K A;  2FQ2 A;  4BPG A;  2LOL A;  1HY8 A;  2LTE A;  2K0Y A;  5EJD A;  1KLP A;  4BPF A;  2AFD A;  2KOO A;  2GDY A;  2JU2 A;  2FAD A;  2LL8 A;  5HVC A;  2X2B A;  2KG8 A;  4IZ6 A;  2QNW A;  4H2W C;  3NY7 B;  2K93 A;  2KR5 A;  3RG2 A;  1DV5 A;  2CGQ A;  2MVV A;  2FVA A;  2ROQ A;  2KOP A;  2L9F A;  2KW2 A;  2MF4 A;  2FHS C;  4CA3 A;  3LMO A;  2KGD A;  1NQ4 A;  2FVE A;  2VSQ A;  2L4B A;  2LML A;  1DNY A;  2KG9 A;  2FQ1 A;  2MVU A;  2XZ1 C;  5KP6 B;  2XZ0 D;  2K94 A;  4PWV B;  2CNR A;  4NEO A;  2KOS A;  2KWL A;  2KGA A;  2JGP A;  2K2Q A;  4DG9 A;  5KP8 B;  2CQ8 A;  2MD9 A;  2FAC A;  2KGC A;  2MR8 A;  2GDW A;  2N5H A;  2N98 A;  2AFE A;  3EJB A;  4HKG A;  2N50 A;  1AF8 A;  4R0M A;  1OR5 A;  3GZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...