2XZ0D

The structure of the 2:1 (partially occupied) complex between stearoyl acyl carrier protein desaturase from ricinus communis (castor bean) and acyl carrier protein.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
82
structure length
81
Chain Sequence
b'AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEKKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-[ACYL-CARRIER-PROTEIN] DESATURASE, CHLOROPLASTIC
publication title Remote Control of Regioselectivity in Acyl-Acyl Carrier Protein-Desaturases.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Oxidoreductase/lipid binding protein
total genus 7
structure length 81
sequence length 82
ec nomenclature
pdb deposition date 2010-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2xz0D00
2FVEA 2QNWA 2DNWA 3NY7B 1VKUA 2MR7A 2CNRA 2LL8A 2JGPA 2VSQA 2L0QA 2KOOA 2FQ2A 1KLPA 1X3OA 2LIWA 2LMLA 2CGQA 5CZDB 2AFDA 2K92A 2L22A 2X2BA 2LOLA 4H2WC 2N6ZA 2XZ0D 4PWVB 2FVFA 2N5HA 2GDXA 2N5IA 2N50A 5KP7B 1L0HA 4H2YC 2KR5A 2EHTA 2FQ1A 2K94A 2EHSA 3CE7A 1L0IA 3RG2A 2N98A 4IZ6A 2FHSC 2FAEA 2AFEA 2XZ1C 2CQ8A 1T8KA 2K0YA 4BPFA 1F80D 2KG9A 2KOPA 3GZMA 2L4BA 2M5RA 1NQ4A 5HV8A 2KORA 2FVAA 2MR8A 2LKIA 4DG9A 2N6YA 4R0MA 3LMOA 1HQBA 2MY5A 2AF8A 4MRTC 2FACA 4H2XC 4HKGA 1OR5A 2K93A 2KOSA 2GDYA 2FQ0A 2LPKA 5HVCA 2MF4A 2AVAA 4BPGA 1AF8A 3EJBA 2MVUA 2LTEA 3EJDA 2KGCA 5KP8B 4BPHA 3EJEA 4CA3A 1DNYA 2KG6A 4NEOA 2KGAA 2K0XA 2LIUA 4PXHB 2FADA 1ACPA 2JQ4A 2KOQA 2MVVA 2K2QA 2KG8A 1DV5A 3GZLA 2GDWA 1HY8A 2JU1A 2KW2A 2L9FA 2MD9A 2KGDA 2KWLA 2ROQA 5KP6B 2PNGA 2CG5B 2KGEA 2JU2A 5EJDA
chains in the Genus database with same CATH superfamily
2OARA 1Q82Q 2JB0A 2DNWA 1VQ4P 1YITP 3U43A 2MR7A 2QEXP 2VSQA 2L0QA 3DS3A 4U0EA 2FQ2A 1YIJP 2Z46A 5DCKA 2VLOA 5CZDB 3CCEP 2PY8A 3CCMP 4H2WC 3G6EP 2N6ZA 4PWVB 1FR2A 3G1IA 2N50A 1L0HA 2K5XA 1L0IA 2KODA 3RG2A 3RG6C 2M8NA 2XZ1C 3CC4P 1KQSO 2CQ8A 4GR2A 1T8KA 4XROA 4BPFA 2QA4P 2KG9A 3G0VA 2LF4A 1VQ5P 5HV8A 3Q20A 1AYIA 2N6YA 3VRLC 1OR5A 2PEOA 1VQ7P 2GDYA 1RNIA 2GYKA 1Q81Q 3G26A 3HYBA 1AF8A 3DS4A 3EJBA 2MVUA 2ONTA 4XFXA 4BPHA 2PEKA 1M6NA 4CA3A 3HZQA 2KG6A 1W2BO 2XT1A 2KGAA 2XV6A 2LIUA 2EG5A 2PEJA 2GZFA 3G71P 1VQOP 3CMEP 2KG8A 3CCQP 2GDWA 1HY8A 4XFYA 3CPWO 1YJWP 2EFJA 2KGDA 5HGLA 2ROQA 3I55P 3CC2P 1GXGA 1VQPP 2JU2A 3B4QA 3DS5A 1K8AQ 2E1MA 4M0IA 3DPHA 2FVEA 1QVGO 4XRQA 3GJNA 2Z44A 2LL8A 2KOOA 1M90Q 2LIWA 1IMQA 2CGQA 3G1GA 2L22A 2X2BA 2LOLA 1QRJA 2XZ0D 2N5HA 2GDXA 4H2YC 2KR5A 2EHTA 2OTJP 2CWOA 2VLNA 1VQLP 2N98A 3I56P 5F2NA 2GZEA 3CCLP 2M5RA 4GR6A 2KORA 3H47A 3CD6P 2FVAA 2PEIA 1BXIA 4R0MA 1HQBA 1M74A 2MY5A 1K73Q 2AF8A 1YJNP 4H2XC 3CCRP 4HKGA 3DS1A 4UHPB 1IMPA 2LPKA 5HVCA 3DS0A 5F2KA 4BPGA 3MGEA 4PH1A 5F2OA 2GZJA 1D1DA 3G28A 1JJ2O 1ZNVA 2OTLP 1EOQA 3CCUP 2KOQA 2MVVA 2K2QA 2BUOA 1VHNA 2JU1A 2KW2A 1GPJA 3CXCO 1VQ6P 2KWLA 5KP6B 4QKOA 4U0BA 3OW2O 1QVFO 2QNWA 4COPA 3NY7B 1VKUA 1N8RQ 2M8LA 2JGPA 2JBGA 2JYGA 1X3OA 2BHVA 1AUMA 2AFDA 4U0FA 1EMVA 5I4TG 4IPYA 2VLPA 2PEQA 2JYLA 2EIAA 1RO2A 5KP7B 2FQ1A 2K94A 2EHSA 3CE7A 1VQ9P 3B5IA 3CCVP 2FHSC 2AFEA 3DTJA 3GKLC 1F80D 2KOPA 4PH0A 2K0DX 3GZMA 1NQ4A 1K9MQ 4DG9A 2LKIA 4U0AA 3WBHA 2K93A 1UJZA 2VLQA 5HGOA 2AVAA 1YI2P 1K30A 3DS2A 2LTEA 3EJDA 4QNBA 2KGCA 5KP8B 4XFZA 2JAZA 1NJIQ 2K0XA 2FADA 1BAJA 3CCJP 1DV5A 5BS2A 2M8PA 2MD9A 1RO0A 1ZMBA 2L9FA 1E6JP 2CG5B 1A43A 2P9XA 1Q86Q 3G4SP 1YJ9P 3H0DA 1Z6MA 1A8OA 1IUQA 4F37A 2CNRA 1VQKP 2GZIA 1KLPA 3CMAP 1M6EX 1KD1Q 1Q7YQ 5HGNA 2LMLA 3G21A 1M1KQ 2K92A 1S72P 2FVFA 2N5IA 1GXHA 5EW5E 4WYMA 2NO8A 1E0HA 1KC8Q 1EIAA 2WPTA 4IZ6A 2FAEA 3CCSP 2K0YA 5JPAA 2L4BA 4COCA 2MR8A 5HGMA 3LMOA 2JO0A 4MRTC 2ERHA 2FACA 3G29A 1VQNP 2PENA 2KOSA 2FQ0A 3NTEA 2MF4A 2PEMA 2XXMA 3H4EA 1VQMP 5BS1A 2Z45A 1CEIA 1UNKA 2DGYA 4U0DA 3E2DA 2L6EA 3EJEA 1MZ8A 1DNYA 4NEOA 4PXHB 1ACPA 2JQ4A 3M1MA 2GZGA 1YHQP 3CC7P 3GZLA 3LRYA 7CEIA 2PNGA 3P05A 4U0CA 2KGEA 1VQ8P 5EJDA
chains in the Genus database with same CATH topology
2FVEA 2QNWA 2DNWA 3NY7B 1VKUA 2MR7A 2CNRA 2LL8A 2JGPA 2VSQA 2L0QA 2KOOA 2FQ2A 1KLPA 1X3OA 2LIWA 2LMLA 2CGQA 5CZDB 2AFDA 2K92A 2L22A 2X2BA 2LOLA 4H2WC 2N6ZA 2XZ0D 4PWVB 2FVFA 2N5HA 2GDXA 2N5IA 2N50A 5KP7B 1L0HA 4H2YC 2KR5A 2EHTA 2FQ1A 2K94A 2EHSA 3CE7A 1L0IA 3RG2A 2N98A 4IZ6A 2FHSC 2FAEA 2AFEA 2XZ1C 2CQ8A 1T8KA 2K0YA 4BPFA 1F80D 2KG9A 2KOPA 3GZMA 2L4BA 2M5RA 1NQ4A 5HV8A 2KORA 2FVAA 2MR8A 2LKIA 4DG9A 2N6YA 4R0MA 3LMOA 1HQBA 2MY5A 2AF8A 4MRTC 2FACA 4H2XC 4HKGA 1OR5A 2K93A 2KOSA 2GDYA 2FQ0A 2LPKA 5HVCA 2MF4A 2AVAA 4BPGA 1AF8A 3EJBA 2MVUA 2LTEA 3EJDA 2KGCA 5KP8B 4BPHA 3EJEA 4CA3A 1DNYA 2KG6A 4NEOA 2KGAA 2K0XA 2LIUA 4PXHB 2FADA 1ACPA 2JQ4A 2KOQA 2MVVA 2K2QA 2KG8A 1DV5A 3GZLA 2GDWA 1HY8A 2JU1A 2KW2A 2L9FA 2MD9A 2KGDA 2KWLA 2ROQA 5KP6B 2PNGA 2CG5B 2KGEA 2JU2A 5EJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FVE A;  2QNW A;  2DNW A;  3NY7 B;  1VKU A;  2MR7 A;  2CNR A;  2LL8 A;  2JGP A;  2VSQ A;  2L0Q A;  2KOO A;  2FQ2 A;  1KLP A;  1X3O A;  2LIW A;  2LML A;  2CGQ A;  5CZD B;  2AFD A;  2K92 A;  2L22 A;  2X2B A;  2LOL A;  4H2W C;  2N6Z A;  2XZ0 D;  4PWV B;  2FVF A;  2N5H A;  2GDX A;  2N5I A;  2N50 A;  5KP7 B;  1L0H A;  4H2Y C;  2KR5 A;  2EHT A;  2FQ1 A;  2K94 A;  2EHS A;  3CE7 A;  1L0I A;  3RG2 A;  2N98 A;  4IZ6 A;  2FHS C;  2FAE A;  2AFE A;  2XZ1 C;  2CQ8 A;  1T8K A;  2K0Y A;  4BPF A;  1F80 D;  2KG9 A;  2KOP A;  3GZM A;  2L4B A;  2M5R A;  1NQ4 A;  5HV8 A;  2KOR A;  2FVA A;  2MR8 A;  2LKI A;  4DG9 A;  2N6Y A;  4R0M A;  3LMO A;  1HQB A;  2MY5 A;  2AF8 A;  4MRT C;  2FAC A;  4H2X C;  4HKG A;  1OR5 A;  2K93 A;  2KOS A;  2GDY A;  2FQ0 A;  2LPK A;  5HVC A;  2MF4 A;  2AVA A;  4BPG A;  1AF8 A;  3EJB A;  2MVU A;  2LTE A;  3EJD A;  2KGC A;  5KP8 B;  4BPH A;  3EJE A;  4CA3 A;  1DNY A;  2KG6 A;  4NEO A;  2KGA A;  2K0X A;  2LIU A;  4PXH B;  2FAD A;  1ACP A;  2JQ4 A;  2KOQ A;  2MVV A;  2K2Q A;  2KG8 A;  1DV5 A;  3GZL A;  2GDW A;  1HY8 A;  2JU1 A;  2KW2 A;  2L9F A;  2MD9 A;  2KGD A;  2KWL A;  2ROQ A;  5KP6 B;  2PNG A;  2CG5 B;  2KGE A;  2JU2 A;  5EJD A; 
#chains in the Genus database with same CATH topology
 2OAR A;  1Q82 Q;  2JB0 A;  2DNW A;  1VQ4 P;  1YIT P;  3U43 A;  2MR7 A;  2QEX P;  2VSQ A;  2L0Q A;  3DS3 A;  4U0E A;  2FQ2 A;  1YIJ P;  2Z46 A;  5DCK A;  2VLO A;  5CZD B;  3CCE P;  2PY8 A;  3CCM P;  4H2W C;  3G6E P;  2N6Z A;  4PWV B;  1FR2 A;  3G1I A;  2N50 A;  1L0H A;  2K5X A;  1L0I A;  2KOD A;  3RG2 A;  3RG6 C;  2M8N A;  2XZ1 C;  3CC4 P;  1KQS O;  2CQ8 A;  4GR2 A;  1T8K A;  4XRO A;  4BPF A;  2QA4 P;  2KG9 A;  3G0V A;  2LF4 A;  1VQ5 P;  5HV8 A;  3Q20 A;  1AYI A;  2N6Y A;  3VRL C;  1OR5 A;  2PEO A;  1VQ7 P;  2GDY A;  1RNI A;  2GYK A;  1Q81 Q;  3G26 A;  3HYB A;  1AF8 A;  3DS4 A;  3EJB A;  2MVU A;  2ONT A;  4XFX A;  4BPH A;  2PEK A;  1M6N A;  4CA3 A;  3HZQ A;  2KG6 A;  1W2B O;  2XT1 A;  2KGA A;  2XV6 A;  2LIU A;  2EG5 A;  2PEJ A;  2GZF A;  3G71 P;  1VQO P;  3CME P;  2KG8 A;  3CCQ P;  2GDW A;  1HY8 A;  4XFY A;  3CPW O;  1YJW P;  2EFJ A;  2KGD A;  5HGL A;  2ROQ A;  3I55 P;  3CC2 P;  1GXG A;  1VQP P;  2JU2 A;  3B4Q A;  3DS5 A;  1K8A Q;  2E1M A;  4M0I A;  3DPH A;  2FVE A;  1QVG O;  4XRQ A;  3GJN A;  2Z44 A;  2LL8 A;  2KOO A;  1M90 Q;  2LIW A;  1IMQ A;  2CGQ A;  3G1G A;  2L22 A;  2X2B A;  2LOL A;  1QRJ A;  2XZ0 D;  2N5H A;  2GDX A;  4H2Y C;  2KR5 A;  2EHT A;  2OTJ P;  2CWO A;  2VLN A;  1VQL P;  2N98 A;  3I56 P;  5F2N A;  2GZE A;  3CCL P;  2M5R A;  4GR6 A;  2KOR A;  3H47 A;  3CD6 P;  2FVA A;  2PEI A;  1BXI A;  4R0M A;  1HQB A;  1M74 A;  2MY5 A;  1K73 Q;  2AF8 A;  1YJN P;  4H2X C;  3CCR P;  4HKG A;  3DS1 A;  4UHP B;  1IMP A;  2LPK A;  5HVC A;  3DS0 A;  5F2K A;  4BPG A;  3MGE A;  4PH1 A;  5F2O A;  2GZJ A;  1D1D A;  3G28 A;  1JJ2 O;  1ZNV A;  2OTL P;  1EOQ A;  3CCU P;  2KOQ A;  2MVV A;  2K2Q A;  2BUO A;  1VHN A;  2JU1 A;  2KW2 A;  1GPJ A;  3CXC O;  1VQ6 P;  2KWL A;  5KP6 B;  4QKO A;  4U0B A;  3OW2 O;  1QVF O;  2QNW A;  4COP A;  3NY7 B;  1VKU A;  1N8R Q;  2M8L A;  2JGP A;  2JBG A;  2JYG A;  1X3O A;  2BHV A;  1AUM A;  2AFD A;  4U0F A;  1EMV A;  5I4T G;  4IPY A;  2VLP A;  2PEQ A;  2JYL A;  2EIA A;  1RO2 A;  5KP7 B;  2FQ1 A;  2K94 A;  2EHS A;  3CE7 A;  1VQ9 P;  3B5I A;  3CCV P;  2FHS C;  2AFE A;  3DTJ A;  3GKL C;  1F80 D;  2KOP A;  4PH0 A;  2K0D X;  3GZM A;  1NQ4 A;  1K9M Q;  4DG9 A;  2LKI A;  4U0A A;  3WBH A;  2K93 A;  1UJZ A;  2VLQ A;  5HGO A;  2AVA A;  1YI2 P;  1K30 A;  3DS2 A;  2LTE A;  3EJD A;  4QNB A;  2KGC A;  5KP8 B;  4XFZ A;  2JAZ A;  1NJI Q;  2K0X A;  2FAD A;  1BAJ A;  3CCJ P;  1DV5 A;  5BS2 A;  2M8P A;  2MD9 A;  1RO0 A;  1ZMB A;  2L9F A;  1E6J P;  2CG5 B;  1A43 A;  2P9X A;  1Q86 Q;  3G4S P;  1YJ9 P;  3H0D A;  1Z6M A;  1A8O A;  1IUQ A;  4F37 A;  2CNR A;  1VQK P;  2GZI A;  1KLP A;  3CMA P;  1M6E X;  1KD1 Q;  1Q7Y Q;  5HGN A;  2LML A;  3G21 A;  1M1K Q;  2K92 A;  1S72 P;  2FVF A;  2N5I A;  1GXH A;  5EW5 E;  4WYM A;  2NO8 A;  1E0H A;  1KC8 Q;  1EIA A;  2WPT A;  4IZ6 A;  2FAE A;  3CCS P;  2K0Y A;  5JPA A;  2L4B A;  4COC A;  2MR8 A;  5HGM A;  3LMO A;  2JO0 A;  4MRT C;  2ERH A;  2FAC A;  3G29 A;  1VQN P;  2PEN A;  2KOS A;  2FQ0 A;  3NTE A;  2MF4 A;  2PEM A;  2XXM A;  3H4E A;  1VQM P;  5BS1 A;  2Z45 A;  1CEI A;  1UNK A;  2DGY A;  4U0D A;  3E2D A;  2L6E A;  3EJE A;  1MZ8 A;  1DNY A;  4NEO A;  4PXH B;  1ACP A;  2JQ4 A;  3M1M A;  2GZG A;  1YHQ P;  3CC7 P;  3GZL A;  3LRY A;  7CEI A;  2PNG A;  3P05 A;  4U0C A;  2KGE A;  1VQ8 P;  5EJD A; 
#chains in the Genus database with same CATH homology
 2FVE A;  2QNW A;  2DNW A;  3NY7 B;  1VKU A;  2MR7 A;  2CNR A;  2LL8 A;  2JGP A;  2VSQ A;  2L0Q A;  2KOO A;  2FQ2 A;  1KLP A;  1X3O A;  2LIW A;  2LML A;  2CGQ A;  5CZD B;  2AFD A;  2K92 A;  2L22 A;  2X2B A;  2LOL A;  4H2W C;  2N6Z A;  2XZ0 D;  4PWV B;  2FVF A;  2N5H A;  2GDX A;  2N5I A;  2N50 A;  5KP7 B;  1L0H A;  4H2Y C;  2KR5 A;  2EHT A;  2FQ1 A;  2K94 A;  2EHS A;  3CE7 A;  1L0I A;  3RG2 A;  2N98 A;  4IZ6 A;  2FHS C;  2FAE A;  2AFE A;  2XZ1 C;  2CQ8 A;  1T8K A;  2K0Y A;  4BPF A;  1F80 D;  2KG9 A;  2KOP A;  3GZM A;  2L4B A;  2M5R A;  1NQ4 A;  5HV8 A;  2KOR A;  2FVA A;  2MR8 A;  2LKI A;  4DG9 A;  2N6Y A;  4R0M A;  3LMO A;  1HQB A;  2MY5 A;  2AF8 A;  4MRT C;  2FAC A;  4H2X C;  4HKG A;  1OR5 A;  2K93 A;  2KOS A;  2GDY A;  2FQ0 A;  2LPK A;  5HVC A;  2MF4 A;  2AVA A;  4BPG A;  1AF8 A;  3EJB A;  2MVU A;  2LTE A;  3EJD A;  2KGC A;  5KP8 B;  4BPH A;  3EJE A;  4CA3 A;  1DNY A;  2KG6 A;  4NEO A;  2KGA A;  2K0X A;  2LIU A;  4PXH B;  2FAD A;  1ACP A;  2JQ4 A;  2KOQ A;  2MVV A;  2K2Q A;  2KG8 A;  1DV5 A;  3GZL A;  2GDW A;  1HY8 A;  2JU1 A;  2KW2 A;  2L9F A;  2MD9 A;  2KGD A;  2KWL A;  2ROQ A;  5KP6 B;  2PNG A;  2CG5 B;  2KGE A;  2JU2 A;  5EJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...