2Z44A

Crystal structure of selenomethionine-labeled orf134
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords ORF134
publication title Crystal Structure of ORF134
rcsb
source organism Synechococcus sp.
total genus 41
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2z44A00
3HYBA 4GR2A 2PY8A 2PEOA 2PEIA 3Q20A 2Z46A 4GR6A 2PENA 2Z44A 3RG6C 2PEQA 2PEKA 5BS1A 2PEJA 2Z45A 5BS2A 2PEMA
chains in the Genus database with same CATH superfamily
2AFEA 3H4EA 3GZLA 3G71P 3DPHA 1AF8A 2LIUA 1QRJA 1EOQA 2PEKA 3CCLP 3RG2A 2XZ1C 1YIJP 2LOLA 4NEOA 2MD9A 2JAZA 1QVGO 4XFYA 3Q20A 2K0DX 1YITP 4H2XC 3U43A 2KOPA 3G26A 2N6ZA 4GR6A 2WPTA 3CE7A 2FACA 3G6EP 1ZNVA 2MF4A 1BXIA 2KGCA 4COPA 1K30A 1RO0A 2M8PA 2L4BA 4PH0A 1YJ9P 3DS5A 3CD6P 1AYIA 2L9FA 1IMPA 2AVAA 3G21A 2FADA 2KWLA 1CEIA 3G1IA 2KW2A 2K94A 2Z45A 2FAEA 3GKLC 1VQ6P 2E1MA 1HY8A 4QNBA 1NQ4A 5KP7B 2N5IA 2PEQA 3NY7B 2N50A 2GZJA 2XT1A 4H2WC 3GJNA 3G29A 2CNRA 2OTJP 2OARA 4XFZA 5CZDB 2GDWA 1Z6MA 1M74A 2FVAA 2Z46A 1UNKA 2XZ0D 2VLQA 3H0DA 5F2NA 2N98A 2K0YA 4BPGA 3DS3A 2XV6A 1KC8Q 2QNWA 1EMVA 1N8RQ 1VQNP 2JGPA 3VRLC 1VQKP 4UHPB 2QEXP 2L0QA 1E6JP 2VSQA 2M8LA 2GZEA 2JO0A 2EHTA 1VQ7P 5EW5E 2JQ4A 1W2BO 2KGDA 2LKIA 4MRTC 3CPWO 2CWOA 2DGYA 3WBHA 2GZGA 2ERHA 2LF4A 2PEIA 5JPAA 3OW2O 3CMEP 1M6NA 2JYLA 3CCVP 2LTEA 1L0HA 2GZFA 2PEJA 1K9MQ 1VQMP 5BS2A 2K93A 2MR7A 1E0HA 1YJNP 4PWVB 3CCUP 2BUOA 4WYMA 4M0IA 2KR5A 1VQPP 2Z44A 3EJBA 4PH1A 1YI2P 2EIAA 4QKOA 1DV5A 5F2KA 2LL8A 1M90Q 4BPFA 2PY8A 7CEIA 1GXHA 2EHSA 2FHSC 2QA4P 3GZMA 2PEMA 2KG6A 1VQ4P 1QVFO 2K5XA 2KOSA 5I4TG 2JU1A 5HGLA 3G4SP 5HGMA 2M5RA 1M6EX 1VQLP 3MGEA 1GXGA 2VLPA 3CCSP 2ONTA 2PEOA 4XFXA 4CA3A 2OTLP 4XROA 2KGAA 3DS1A 4GR2A 2EG5A 3CCQP 1X3OA 3DS2A 1T8KA 5HGNA 2EFJA 1F80D 1VQOP 3DS0A 2L6EA 1Q7YQ 2GDXA 3B4QA 4PXHB 1VKUA 5HV8A 4F37A 4H2YC 2LMLA 1IUQA 1A43A 2NO8A 2JB0A 2VLNA 3G1GA 4XRQA 1D1DA 2XXMA 1OR5A 4U0AA 1AUMA 2CG5B 3RG6C 1YHQP 3CCJP 2JBGA 3G28A 1NJIQ 1VHNA 3I56P 2CGQA 3H47A 2MR8A 2N6YA 2K92A 3G0VA 3HZQA 5HVCA 1VQ9P 3EJEA 4R0MA 2M8NA 2FVEA 2KODA 3B5IA 1A8OA 5DCKA 4U0FA 2X2BA 2ROQA 4COCA 4U0BA 1JJ2O 5F2OA 4DG9A 1BAJA 2MVVA 2P9XA 3EJDA 2K2QA 3LRYA 2BHVA 4BPHA 1KQSO 3P05A 3LMOA 2LPKA 5HGOA 1DNYA 2KOQA 3CC4P 5KP8B 5BS1A 1EIAA 2GYKA 2K0XA 3E2DA 1ACPA 3NTEA 2LIWA 4U0CA 1S72P 2AFDA 3M1MA 2JU2A 2KG9A 1UJZA 2CQ8A 1K8AQ 3HYBA 3I55P 2VLOA 1GPJA 2FQ0A 2KOOA 1FR2A 2AF8A 2MVUA 2KG8A 5KP6B 3CMAP 2GZIA 1L0IA 3CXCO 3CCEP 2GDYA 1Q81Q 2DNWA 1RNIA 1Q86Q 1MZ8A 4IPYA 1YJWP 1M1KQ 3CC7P 3DTJA 4U0EA 4U0DA 2FVFA 2PENA 2N5HA 1K73Q 4HKGA 3DS4A 1RO2A 1VQ5P 3CC2P 2MY5A 1Q82Q 2JYGA 4IZ6A 3CCMP 2KGEA 2PNGA 1HQBA 1KLPA 2L22A 1VQ8P 5EJDA 2KORA 1KD1Q 1ZMBA 2FQ2A 1IMQA 3CCRP 2FQ1A
chains in the Genus database with same CATH topology
1BAJA 2P9XA 3H4EA 1M6EX 1VQLP 3MGEA 3LRYA 3G71P 3DPHA 2BHVA 3DS3A 1KQSO 3CCSP 2ONTA 2PEOA 2XV6A 1QRJA 3P05A 4XFXA 1KC8Q 2OTLP 4XROA 1EOQA 2PEKA 3CCLP 1N8RQ 5HGOA 3DS1A 4GR2A 3VRLC 1VQNP 2EG5A 3CCQP 1VQKP 3CC4P 3DS2A 5BS1A 2QEXP 5HGNA 1YIJP 1E6JP 1EIAA 2M8LA 2EFJA 3E2DA 1QVGO 3NTEA 2JO0A 1VQOP 3DS0A 4XFYA 2L6EA 3Q20A 4U0CA 1Q7YQ 1VQ7P 1S72P 1YITP 1W2BO 3G26A 3M1MA 4GR6A 3CPWO 2CWOA 3G6EP 1IUQA 1K8AQ 3HYBA 1A43A 3I55P 2DGYA 3WBHA 3G1GA 4XRQA 1D1DA 2LF4A 2PEIA 5JPAA 3OW2O 2XXMA 4COPA 3CMAP 1K30A 1RO0A 2M8PA 4U0AA 3CMEP 1AUMA 1M6NA 2JYLA 3CXCO 3CCVP 3CCEP 3RG6C 1YHQP 3CCJP 4PH0A 1Q81Q 1RNIA 2PEJA 1YJ9P 1K9MQ 1Q86Q 3DS5A 3CD6P 3G28A 1NJIQ 1VQMP 3I56P 4IPYA 5BS2A 3G21A 3H47A 1YJWP 1M1KQ 1YJNP 3G0VA 3CCUP 2BUOA 4WYMA 3HZQA 4M0IA 3CC7P 1VQPP 3DTJA 1VQ9P 4U0EA 2Z44A 4U0DA 3G1IA 4PH1A 1YI2P 2EIAA 2Z45A 1VQ6P 2M8NA 2E1MA 2PENA 1K73Q 4QNBA 2KODA 3B5IA 3DS4A 5F2KA 1M90Q 1RO2A 1VQ5P 3CC2P 2PY8A 1Q82Q 1A8OA 5DCKA 4U0FA 2PEQA 2JYGA 2QA4P 2PEMA 3CCMP 2XT1A 1VQ4P 1QVFO 3G29A 2OTJP 4COCA 2OARA 4XFZA 4U0BA 1VQ8P 1JJ2O 5F2OA 1KD1Q 1M74A 5I4TG 2Z46A 1ZMBA 3H0DA 5HGLA 3G4SP 3CCRP 5F2NA 5HGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYB A;  4GR2 A;  2PY8 A;  2PEO A;  2PEI A;  3Q20 A;  2Z46 A;  4GR6 A;  2PEN A;  2Z44 A;  3RG6 C;  2PEQ A;  2PEK A;  5BS1 A;  2PEJ A;  2Z45 A;  5BS2 A;  2PEM A; 
#chains in the Genus database with same CATH topology
 2AFE A;  3H4E A;  3GZL A;  3G71 P;  3DPH A;  1AF8 A;  2LIU A;  1QRJ A;  1EOQ A;  2PEK A;  3CCL P;  3RG2 A;  2XZ1 C;  1YIJ P;  2LOL A;  4NEO A;  2MD9 A;  2JAZ A;  1QVG O;  4XFY A;  3Q20 A;  2K0D X;  1YIT P;  4H2X C;  3U43 A;  2KOP A;  3G26 A;  2N6Z A;  4GR6 A;  2WPT A;  3CE7 A;  2FAC A;  3G6E P;  1ZNV A;  2MF4 A;  1BXI A;  2KGC A;  4COP A;  1K30 A;  1RO0 A;  2M8P A;  2L4B A;  4PH0 A;  1YJ9 P;  3DS5 A;  3CD6 P;  1AYI A;  2L9F A;  1IMP A;  2AVA A;  3G21 A;  2FAD A;  2KWL A;  1CEI A;  3G1I A;  2KW2 A;  2K94 A;  2Z45 A;  2FAE A;  3GKL C;  1VQ6 P;  2E1M A;  1HY8 A;  4QNB A;  1NQ4 A;  5KP7 B;  2N5I A;  2PEQ A;  3NY7 B;  2N50 A;  2GZJ A;  2XT1 A;  4H2W C;  3GJN A;  3G29 A;  2CNR A;  2OTJ P;  2OAR A;  4XFZ A;  5CZD B;  2GDW A;  1Z6M A;  1M74 A;  2FVA A;  2Z46 A;  1UNK A;  2XZ0 D;  2VLQ A;  3H0D A;  5F2N A;  2N98 A;  2K0Y A;  4BPG A;  3DS3 A;  2XV6 A;  1KC8 Q;  2QNW A;  1EMV A;  1N8R Q;  1VQN P;  2JGP A;  3VRL C;  1VQK P;  4UHP B;  2QEX P;  2L0Q A;  1E6J P;  2VSQ A;  2M8L A;  2GZE A;  2JO0 A;  2EHT A;  1VQ7 P;  5EW5 E;  2JQ4 A;  1W2B O;  2KGD A;  2LKI A;  4MRT C;  3CPW O;  2CWO A;  2DGY A;  3WBH A;  2GZG A;  2ERH A;  2LF4 A;  2PEI A;  5JPA A;  3OW2 O;  3CME P;  1M6N A;  2JYL A;  3CCV P;  2LTE A;  1L0H A;  2GZF A;  2PEJ A;  1K9M Q;  1VQM P;  5BS2 A;  2K93 A;  2MR7 A;  1E0H A;  1YJN P;  4PWV B;  3CCU P;  2BUO A;  4WYM A;  4M0I A;  2KR5 A;  1VQP P;  2Z44 A;  3EJB A;  4PH1 A;  1YI2 P;  2EIA A;  4QKO A;  1DV5 A;  5F2K A;  2LL8 A;  1M90 Q;  4BPF A;  2PY8 A;  7CEI A;  1GXH A;  2EHS A;  2FHS C;  2QA4 P;  3GZM A;  2PEM A;  2KG6 A;  1VQ4 P;  1QVF O;  2K5X A;  2KOS A;  5I4T G;  2JU1 A;  5HGL A;  3G4S P;  5HGM A;  2M5R A;  1M6E X;  1VQL P;  3MGE A;  1GXG A;  2VLP A;  3CCS P;  2ONT A;  2PEO A;  4XFX A;  4CA3 A;  2OTL P;  4XRO A;  2KGA A;  3DS1 A;  4GR2 A;  2EG5 A;  3CCQ P;  1X3O A;  3DS2 A;  1T8K A;  5HGN A;  2EFJ A;  1F80 D;  1VQO P;  3DS0 A;  2L6E A;  1Q7Y Q;  2GDX A;  3B4Q A;  4PXH B;  1VKU A;  5HV8 A;  4F37 A;  4H2Y C;  2LML A;  1IUQ A;  1A43 A;  2NO8 A;  2JB0 A;  2VLN A;  3G1G A;  4XRQ A;  1D1D A;  2XXM A;  1OR5 A;  4U0A A;  1AUM A;  2CG5 B;  3RG6 C;  1YHQ P;  3CCJ P;  2JBG A;  3G28 A;  1NJI Q;  1VHN A;  3I56 P;  2CGQ A;  3H47 A;  2MR8 A;  2N6Y A;  2K92 A;  3G0V A;  3HZQ A;  5HVC A;  1VQ9 P;  3EJE A;  4R0M A;  2M8N A;  2FVE A;  2KOD A;  3B5I A;  1A8O A;  5DCK A;  4U0F A;  2X2B A;  2ROQ A;  4COC A;  4U0B A;  1JJ2 O;  5F2O A;  4DG9 A;  1BAJ A;  2MVV A;  2P9X A;  3EJD A;  2K2Q A;  3LRY A;  2BHV A;  4BPH A;  1KQS O;  3P05 A;  3LMO A;  2LPK A;  5HGO A;  1DNY A;  2KOQ A;  3CC4 P;  5KP8 B;  5BS1 A;  1EIA A;  2GYK A;  2K0X A;  3E2D A;  1ACP A;  3NTE A;  2LIW A;  4U0C A;  1S72 P;  2AFD A;  3M1M A;  2JU2 A;  2KG9 A;  1UJZ A;  2CQ8 A;  1K8A Q;  3HYB A;  3I55 P;  2VLO A;  1GPJ A;  2FQ0 A;  2KOO A;  1FR2 A;  2AF8 A;  2MVU A;  2KG8 A;  5KP6 B;  3CMA P;  2GZI A;  1L0I A;  3CXC O;  3CCE P;  2GDY A;  1Q81 Q;  2DNW A;  1RNI A;  1Q86 Q;  1MZ8 A;  4IPY A;  1YJW P;  1M1K Q;  3CC7 P;  3DTJ A;  4U0E A;  4U0D A;  2FVF A;  2PEN A;  2N5H A;  1K73 Q;  4HKG A;  3DS4 A;  1RO2 A;  1VQ5 P;  3CC2 P;  2MY5 A;  1Q82 Q;  2JYG A;  4IZ6 A;  3CCM P;  2KGE A;  2PNG A;  1HQB A;  1KLP A;  2L22 A;  1VQ8 P;  5EJD A;  2KOR A;  1KD1 Q;  1ZMB A;  2FQ2 A;  1IMQ A;  3CCR P;  2FQ1 A; 
#chains in the Genus database with same CATH homology
 1BAJ A;  2P9X A;  3H4E A;  1M6E X;  1VQL P;  3MGE A;  3LRY A;  3G71 P;  3DPH A;  2BHV A;  3DS3 A;  1KQS O;  3CCS P;  2ONT A;  2PEO A;  2XV6 A;  1QRJ A;  3P05 A;  4XFX A;  1KC8 Q;  2OTL P;  4XRO A;  1EOQ A;  2PEK A;  3CCL P;  1N8R Q;  5HGO A;  3DS1 A;  4GR2 A;  3VRL C;  1VQN P;  2EG5 A;  3CCQ P;  1VQK P;  3CC4 P;  3DS2 A;  5BS1 A;  2QEX P;  5HGN A;  1YIJ P;  1E6J P;  1EIA A;  2M8L A;  2EFJ A;  3E2D A;  1QVG O;  3NTE A;  2JO0 A;  1VQO P;  3DS0 A;  4XFY A;  2L6E A;  3Q20 A;  4U0C A;  1Q7Y Q;  1VQ7 P;  1S72 P;  1YIT P;  1W2B O;  3G26 A;  3M1M A;  4GR6 A;  3CPW O;  2CWO A;  3G6E P;  1IUQ A;  1K8A Q;  3HYB A;  1A43 A;  3I55 P;  2DGY A;  3WBH A;  3G1G A;  4XRQ A;  1D1D A;  2LF4 A;  2PEI A;  5JPA A;  3OW2 O;  2XXM A;  4COP A;  3CMA P;  1K30 A;  1RO0 A;  2M8P A;  4U0A A;  3CME P;  1AUM A;  1M6N A;  2JYL A;  3CXC O;  3CCV P;  3CCE P;  3RG6 C;  1YHQ P;  3CCJ P;  4PH0 A;  1Q81 Q;  1RNI A;  2PEJ A;  1YJ9 P;  1K9M Q;  1Q86 Q;  3DS5 A;  3CD6 P;  3G28 A;  1NJI Q;  1VQM P;  3I56 P;  4IPY A;  5BS2 A;  3G21 A;  3H47 A;  1YJW P;  1M1K Q;  1YJN P;  3G0V A;  3CCU P;  2BUO A;  4WYM A;  3HZQ A;  4M0I A;  3CC7 P;  1VQP P;  3DTJ A;  1VQ9 P;  4U0E A;  2Z44 A;  4U0D A;  3G1I A;  4PH1 A;  1YI2 P;  2EIA A;  2Z45 A;  1VQ6 P;  2M8N A;  2E1M A;  2PEN A;  1K73 Q;  4QNB A;  2KOD A;  3B5I A;  3DS4 A;  5F2K A;  1M90 Q;  1RO2 A;  1VQ5 P;  3CC2 P;  2PY8 A;  1Q82 Q;  1A8O A;  5DCK A;  4U0F A;  2PEQ A;  2JYG A;  2QA4 P;  2PEM A;  3CCM P;  2XT1 A;  1VQ4 P;  1QVF O;  3G29 A;  2OTJ P;  4COC A;  2OAR A;  4XFZ A;  4U0B A;  1VQ8 P;  1JJ2 O;  5F2O A;  1KD1 Q;  1M74 A;  5I4T G;  2Z46 A;  1ZMB A;  3H0D A;  5HGL A;  3G4S P;  3CCR P;  5F2N A;  5HGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...