2Z44A

Crystal structure of selenomethionine-labeled orf134
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
110
structure length
110
Chain Sequence
EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of ORF134
rcsb
source organism Synechococcus sp.
molecule tags Chaperone
molecule keywords ORF134
total genus 41
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2z44A00
4GR2A 2PY8A 3HYBA 5BS1A 2Z45A 5BS2A 2PEOA 2PEMA 2Z46A 2PEIA 2Z44A 2PEJA 2PENA 2PEKA 2PEQA 4GR6A 3RG6C 3Q20A
chains in the Genus database with same CATH superfamily
3G71P 2MR8A 2JQ4A 2KOQA 1N8RQ 4BPGA 3GKLC 3B4QA 3H0DA 2KOSA 2JYLA 3CCLP 2KGDA 5HGLA 2MY5A 3CCMP 1IMPA 4H2WC 3RG6C 2PEIA 2LPKA 1YIJP 1OR5A 1VQ6P 4U0BA 5CZDB 2LIWA 2PEJA 3CC7P 1AYIA 1EOQA 3HYBA 3CCEP 5I4TG 1RO0A 4PH0A 1MZ8A 3G0VA 1AF8A 5F2OA 3M1MA 2K93A 2CG5B 2KGEA 2KORA 4IZ6A 2K2QA 2K0YA 1ZNVA 4XFXA 2FAEA 1QVGO 2KW2A 2VSQA 2NO8A 2JO0A 3CCRP 3GJNA 2GZJA 3EJEA 1DV5A 2FQ2A 3DS0A 1M6EX 1RNIA 1K30A 4DG9A 3G4SP 1L0HA 4H2YC 3DS4A 2FVFA 1HQBA 2CNRA 2Z45A 2GDWA 2GZEA 3H47A 1YJWP 4IPYA 4PXHB 1L0IA 1NJIQ 1F80D 2KG6A 2AVAA 2LIUA 2AF8A 2X2BA 2KR5A 3GZMA 2KOPA 4HKGA 3CC2P 2PENA 2Z46A 1GXHA 3VRLC 5HVCA 1YHQP 3G28A 2GDYA 2XXMA 4U0AA 3CCVP 2BHVA 4H2XC 2LF4A 5KP7B 2BUOA 1A8OA 3GZLA 3DS2A 1VQOP 2FHSC 4COCA 3G29A 3DS1A 3G26A 4GR2A 2QA4P 2PEMA 2Z44A 1YJNP 2L4BA 2OARA 2XT1A 1VHNA 2PEOA 2P9XA 1K8AQ 1KC8Q 4NEOA 2ERHA 2FACA 2EHTA 4XFYA 2MVVA 2ONTA 2KOOA 2GZGA 5KP6B 1UNKA 2L9FA 4BPHA 4WYMA 1VQNP 5EJDA 1QVFO 4PH1A 4U0EA 3U43A 3CCUP 3CPWO 2WPTA 5HV8A 1VQ7P 1FR2A 1K9MQ 2CWOA 3HZQA 2OTLP 5HGOA 2KG9A 1T8KA 2N6YA 1RO2A 1GXGA 2JAZA 1S72P 1VQ8P 3NY7B 2KWLA 1Q86Q 2N50A 3I55P 1M74A 3E2DA 2L6EA 3DPHA 1NQ4A 3P05A 2VLOA 2K0XA 1Q81Q 2N5HA 1VQ9P 2AFEA 2CQ8A 2FQ0A 4GR6A 3CCSP 1YJ9P 3DS3A 3G21A 2PNGA 1VQMP 2MD9A 2EFJA 3MGEA 2OTJP 1X3OA 2ROQA 2K5XA 2PY8A 2K0DX 1KQSO 3G6EP 2M8PA 2XV6A 1VQPP 2GYKA 4UHPB 1HY8A 2XZ0D 2GDXA 2LOLA 2N6ZA 7CEIA 1Q82Q 2LMLA 1Q7YQ 1D1DA 2PEKA 2GZFA 3Q20A 2M5RA 2MR7A 4QKOA 1CEIA 2L22A 2MF4A 5HGMA 1KD1Q 1E0HA 2EHSA 2AFDA 1Z6MA 4XFZA 2LTEA 2M8NA 3CMAP 2E1MA 4U0DA 4R0MA 3B5IA 3CC4P 4U0FA 1YI2P 4XROA 2L0QA 2KODA 5EW5E 2FVEA 2KGCA 2QNWA 4BPFA 1KLPA 2VLNA 1JJ2O 4QNBA 1K73Q 2VLPA 1M6NA 5KP8B 2JYGA 2DGYA 1ZMBA 2N98A 2M8LA 3I56P 1BXIA 4M0IA 4XRQA 4F37A 3RG2A 3DS5A 3LRYA 1DNYA 2GZIA 1W2BO 2K92A 2FQ1A 2JU2A 2JGPA 5F2KA 2LL8A 3CE7A 2EG5A 3DTJA 2QEXP 5BS1A 4MRTC 2XZ1C 5HGNA 3LMOA 2LKIA 1GPJA 1EIAA 2EIAA 2FVAA 1VKUA 2FADA 1YITP 3H4EA 2DNWA 1IUQA 3CCJP 3G1IA 2VLQA 3CMEP 4U0CA 1M1KQ 1A43A 5JPAA 2JBGA 3CD6P 4COPA 2K94A 1VQ4P 1VQLP 2CGQA 4CA3A 2MVUA 2JU1A 1EMVA 1AUMA 3CCQP 2KGAA 1QRJA 2JB0A 1E6JP 1VQ5P 5DCKA 5BS2A 1ACPA 1IMQA 1VQKP 2PEQA 3CXCO 4PWVB 1M90Q 3EJDA 3WBHA 5F2NA 3OW2O 2N5IA 1BAJA 3EJBA 2KG8A 1UJZA 3NTEA 3G1GA
chains in the Genus database with same CATH topology
3DPHA 3P05A 3G71P 2JYGA 1Q81Q 3CC2P 2DGYA 2PENA 1VQ9P 2Z46A 1N8RQ 3VRLC 1ZMBA 2M8LA 1YHQP 3G28A 3I56P 3H0DA 4M0IA 4GR6A 2JYLA 2XXMA 4XRQA 3CCLP 5HGLA 3CCSP 3CCMP 1YJ9P 4U0AA 3DS5A 3CCVP 3DS3A 3LRYA 3RG6C 2BHVA 2LF4A 3G21A 2BUOA 1VQMP 1A8OA 2EFJA 2PEIA 1W2BO 3MGEA 2OTJP 5F2KA 1YIJP 3DS2A 1VQOP 4COCA 2EG5A 3DTJA 3G29A 1VQ6P 2QEXP 3DS1A 2PY8A 3G26A 4GR2A 1KQSO 5BS1A 4U0BA 3G6EP 2QA4P 2PEMA 5HGNA 2Z44A 1YJNP 2PEJA 2M8PA 2OARA 2XT1A 2XV6A 1VQPP 3CC7P 1EIAA 3HYBA 1EOQA 2EIAA 3CCEP 2PEOA 2P9XA 5I4TG 1RO0A 1K8AQ 4PH0A 1YITP 1Q82Q 3H4EA 1IUQA 3G0VA 1KC8Q 3CCJP 1Q7YQ 5F2OA 1D1DA 3G1IA 3M1MA 2PEKA 3CMEP 3Q20A 4U0CA 1M1KQ 1A43A 5JPAA 4XFYA 3CD6P 2ONTA 4COPA 4XFXA 1VQ4P 1VQLP 1QVGO 4WYMA 1VQNP 5HGMA 1KD1Q 2JO0A 3CCRP 1QVFO 4PH1A 1AUMA 3CCQP 4U0EA 1QRJA 3CCUP 4XFZA 2M8NA 3CMAP 3CPWO 2E1MA 4U0DA 1E6JP 1VQ7P 1K9MQ 2CWOA 1M6EX 3DS0A 3HZQA 3B5IA 1RNIA 1K30A 5DCKA 5BS2A 1VQ5P 3CC4P 2OTLP 3G4SP 5HGOA 1VQKP 3DS4A 2PEQA 3CXCO 1M90Q 4U0FA 1YI2P 1RO2A 2Z45A 4XROA 2KODA 3H47A 3WBHA 1YJWP 5F2NA 1S72P 1VQ8P 3OW2O 4IPYA 1BAJA 1JJ2O 1NJIQ 4QNBA 1Q86Q 3I55P 1K73Q 1M74A 3E2DA 1M6NA 2L6EA 3NTEA 3G1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR2 A;  2PY8 A;  3HYB A;  5BS1 A;  2Z45 A;  5BS2 A;  2PEO A;  2PEM A;  2Z46 A;  2PEI A;  2Z44 A;  2PEJ A;  2PEN A;  2PEK A;  2PEQ A;  4GR6 A;  3RG6 C;  3Q20 A; 
#chains in the Genus database with same CATH topology
 3G71 P;  2MR8 A;  2JQ4 A;  2KOQ A;  1N8R Q;  4BPG A;  3GKL C;  3B4Q A;  3H0D A;  2KOS A;  2JYL A;  3CCL P;  2KGD A;  5HGL A;  2MY5 A;  3CCM P;  1IMP A;  4H2W C;  3RG6 C;  2PEI A;  2LPK A;  1YIJ P;  1OR5 A;  1VQ6 P;  4U0B A;  5CZD B;  2LIW A;  2PEJ A;  3CC7 P;  1AYI A;  1EOQ A;  3HYB A;  3CCE P;  5I4T G;  1RO0 A;  4PH0 A;  1MZ8 A;  3G0V A;  1AF8 A;  5F2O A;  3M1M A;  2K93 A;  2CG5 B;  2KGE A;  2KOR A;  4IZ6 A;  2K2Q A;  2K0Y A;  1ZNV A;  4XFX A;  2FAE A;  1QVG O;  2KW2 A;  2VSQ A;  2NO8 A;  2JO0 A;  3CCR P;  3GJN A;  2GZJ A;  3EJE A;  1DV5 A;  2FQ2 A;  3DS0 A;  1M6E X;  1RNI A;  1K30 A;  4DG9 A;  3G4S P;  1L0H A;  4H2Y C;  3DS4 A;  2FVF A;  1HQB A;  2CNR A;  2Z45 A;  2GDW A;  2GZE A;  3H47 A;  1YJW P;  4IPY A;  4PXH B;  1L0I A;  1NJI Q;  1F80 D;  2KG6 A;  2AVA A;  2LIU A;  2AF8 A;  2X2B A;  2KR5 A;  3GZM A;  2KOP A;  4HKG A;  3CC2 P;  2PEN A;  2Z46 A;  1GXH A;  3VRL C;  5HVC A;  1YHQ P;  3G28 A;  2GDY A;  2XXM A;  4U0A A;  3CCV P;  2BHV A;  4H2X C;  2LF4 A;  5KP7 B;  2BUO A;  1A8O A;  3GZL A;  3DS2 A;  1VQO P;  2FHS C;  4COC A;  3G29 A;  3DS1 A;  3G26 A;  4GR2 A;  2QA4 P;  2PEM A;  2Z44 A;  1YJN P;  2L4B A;  2OAR A;  2XT1 A;  1VHN A;  2PEO A;  2P9X A;  1K8A Q;  1KC8 Q;  4NEO A;  2ERH A;  2FAC A;  2EHT A;  4XFY A;  2MVV A;  2ONT A;  2KOO A;  2GZG A;  5KP6 B;  1UNK A;  2L9F A;  4BPH A;  4WYM A;  1VQN P;  5EJD A;  1QVF O;  4PH1 A;  4U0E A;  3U43 A;  3CCU P;  3CPW O;  2WPT A;  5HV8 A;  1VQ7 P;  1FR2 A;  1K9M Q;  2CWO A;  3HZQ A;  2OTL P;  5HGO A;  2KG9 A;  1T8K A;  2N6Y A;  1RO2 A;  1GXG A;  2JAZ A;  1S72 P;  1VQ8 P;  3NY7 B;  2KWL A;  1Q86 Q;  2N50 A;  3I55 P;  1M74 A;  3E2D A;  2L6E A;  3DPH A;  1NQ4 A;  3P05 A;  2VLO A;  2K0X A;  1Q81 Q;  2N5H A;  1VQ9 P;  2AFE A;  2CQ8 A;  2FQ0 A;  4GR6 A;  3CCS P;  1YJ9 P;  3DS3 A;  3G21 A;  2PNG A;  1VQM P;  2MD9 A;  2EFJ A;  3MGE A;  2OTJ P;  1X3O A;  2ROQ A;  2K5X A;  2PY8 A;  2K0D X;  1KQS O;  3G6E P;  2M8P A;  2XV6 A;  1VQP P;  2GYK A;  4UHP B;  1HY8 A;  2XZ0 D;  2GDX A;  2LOL A;  2N6Z A;  7CEI A;  1Q82 Q;  2LML A;  1Q7Y Q;  1D1D A;  2PEK A;  2GZF A;  3Q20 A;  2M5R A;  2MR7 A;  4QKO A;  1CEI A;  2L22 A;  2MF4 A;  5HGM A;  1KD1 Q;  1E0H A;  2EHS A;  2AFD A;  1Z6M A;  4XFZ A;  2LTE A;  2M8N A;  3CMA P;  2E1M A;  4U0D A;  4R0M A;  3B5I A;  3CC4 P;  4U0F A;  1YI2 P;  4XRO A;  2L0Q A;  2KOD A;  5EW5 E;  2FVE A;  2KGC A;  2QNW A;  4BPF A;  1KLP A;  2VLN A;  1JJ2 O;  4QNB A;  1K73 Q;  2VLP A;  1M6N A;  5KP8 B;  2JYG A;  2DGY A;  1ZMB A;  2N98 A;  2M8L A;  3I56 P;  1BXI A;  4M0I A;  4XRQ A;  4F37 A;  3RG2 A;  3DS5 A;  3LRY A;  1DNY A;  2GZI A;  1W2B O;  2K92 A;  2FQ1 A;  2JU2 A;  2JGP A;  5F2K A;  2LL8 A;  3CE7 A;  2EG5 A;  3DTJ A;  2QEX P;  5BS1 A;  4MRT C;  2XZ1 C;  5HGN A;  3LMO A;  2LKI A;  1GPJ A;  1EIA A;  2EIA A;  2FVA A;  1VKU A;  2FAD A;  1YIT P;  3H4E A;  2DNW A;  1IUQ A;  3CCJ P;  3G1I A;  2VLQ A;  3CME P;  4U0C A;  1M1K Q;  1A43 A;  5JPA A;  2JBG A;  3CD6 P;  4COP A;  2K94 A;  1VQ4 P;  1VQL P;  2CGQ A;  4CA3 A;  2MVU A;  2JU1 A;  1EMV A;  1AUM A;  3CCQ P;  2KGA A;  1QRJ A;  2JB0 A;  1E6J P;  1VQ5 P;  5DCK A;  5BS2 A;  1ACP A;  1IMQ A;  1VQK P;  2PEQ A;  3CXC O;  4PWV B;  1M90 Q;  3EJD A;  3WBH A;  5F2N A;  3OW2 O;  2N5I A;  1BAJ A;  3EJB A;  2KG8 A;  1UJZ A;  3NTE A;  3G1G A; 
#chains in the Genus database with same CATH homology
 3DPH A;  3P05 A;  3G71 P;  2JYG A;  1Q81 Q;  3CC2 P;  2DGY A;  2PEN A;  1VQ9 P;  2Z46 A;  1N8R Q;  3VRL C;  1ZMB A;  2M8L A;  1YHQ P;  3G28 A;  3I56 P;  3H0D A;  4M0I A;  4GR6 A;  2JYL A;  2XXM A;  4XRQ A;  3CCL P;  5HGL A;  3CCS P;  3CCM P;  1YJ9 P;  4U0A A;  3DS5 A;  3CCV P;  3DS3 A;  3LRY A;  3RG6 C;  2BHV A;  2LF4 A;  3G21 A;  2BUO A;  1VQM P;  1A8O A;  2EFJ A;  2PEI A;  1W2B O;  3MGE A;  2OTJ P;  5F2K A;  1YIJ P;  3DS2 A;  1VQO P;  4COC A;  2EG5 A;  3DTJ A;  3G29 A;  1VQ6 P;  2QEX P;  3DS1 A;  2PY8 A;  3G26 A;  4GR2 A;  1KQS O;  5BS1 A;  4U0B A;  3G6E P;  2QA4 P;  2PEM A;  5HGN A;  2Z44 A;  1YJN P;  2PEJ A;  2M8P A;  2OAR A;  2XT1 A;  2XV6 A;  1VQP P;  3CC7 P;  1EIA A;  3HYB A;  1EOQ A;  2EIA A;  3CCE P;  2PEO A;  2P9X A;  5I4T G;  1RO0 A;  1K8A Q;  4PH0 A;  1YIT P;  1Q82 Q;  3H4E A;  1IUQ A;  3G0V A;  1KC8 Q;  3CCJ P;  1Q7Y Q;  5F2O A;  1D1D A;  3G1I A;  3M1M A;  2PEK A;  3CME P;  3Q20 A;  4U0C A;  1M1K Q;  1A43 A;  5JPA A;  4XFY A;  3CD6 P;  2ONT A;  4COP A;  4XFX A;  1VQ4 P;  1VQL P;  1QVG O;  4WYM A;  1VQN P;  5HGM A;  1KD1 Q;  2JO0 A;  3CCR P;  1QVF O;  4PH1 A;  1AUM A;  3CCQ P;  4U0E A;  1QRJ A;  3CCU P;  4XFZ A;  2M8N A;  3CMA P;  3CPW O;  2E1M A;  4U0D A;  1E6J P;  1VQ7 P;  1K9M Q;  2CWO A;  1M6E X;  3DS0 A;  3HZQ A;  3B5I A;  1RNI A;  1K30 A;  5DCK A;  5BS2 A;  1VQ5 P;  3CC4 P;  2OTL P;  3G4S P;  5HGO A;  1VQK P;  3DS4 A;  2PEQ A;  3CXC O;  1M90 Q;  4U0F A;  1YI2 P;  1RO2 A;  2Z45 A;  4XRO A;  2KOD A;  3H47 A;  3WBH A;  1YJW P;  5F2N A;  1S72 P;  1VQ8 P;  3OW2 O;  4IPY A;  1BAJ A;  1JJ2 O;  1NJI Q;  4QNB A;  1Q86 Q;  3I55 P;  1K73 Q;  1M74 A;  3E2D A;  1M6N A;  2L6E A;  3NTE A;  3G1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...