2Z44A

Crystal structure of selenomethionine-labeled orf134
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
110
structure length
110
Chain Sequence
b'EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAEGVLEFLPEMVLSQIKQSNGNHRRSLLERLTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF134
publication title Crystal Structure of ORF134
rcsb
source organism Synechococcus sp.
molecule tags Chaperone
total genus 41
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2z44A00
4GR2A 2PEQA 3RG6C 5BS2A 2Z44A 2PEMA 2PENA 2Z46A 2Z45A 3Q20A 2PEJA 2PEIA 4GR6A 2PY8A 3HYBA 2PEKA 5BS1A 2PEOA
chains in the Genus database with same CATH superfamily
4PXHB 1VQ9P 2GDXA 1E0HA 1EMVA 3VRLC 4CA3A 2FAEA 2P9XA 2BHVA 2L22A 5HGNA 5HGOA 2KGEA 3H47A 2JAZA 2EHSA 1HY8A 1E6JP 2CG5B 2GZJA 2KORA 3NY7B 3RG6C 2GZEA 3CCLP 2PNGA 1Z6MA 1Q81Q 3CCRP 3M1MA 3G29A 4U0FA 4COCA 2Z46A 2FVAA 2VLPA 1RO2A 2OTLP 1ACPA 2K93A 2JO0A 1W2BO 2QEXP 2EIAA 1AF8A 3DPHA 3CCMP 3DS2A 1M1KQ 2K92A 5CZDB 2M8LA 5KP6B 2N50A 1Q82Q 4M0IA 2K5XA 2CQ8A 2FACA 2PEQA 1VHNA 2N6YA 2VLNA 4PH0A 2LKIA 2CWOA 3CCEP 2LIWA 1VQOP 3G28A 2MF4A 4BPFA 2XV6A 3GZLA 3H4EA 5F2NA 3CMAP 2M5RA 1VQ5P 1K30A 2Z45A 2K2QA 1K9MQ 2M8PA 2QA4P 3G0VA 1KD1Q 5BS2A 3CC4P 3I55P 2AFEA 4XRQA 3DS3A 2K0DX 2FQ2A 2PEJA 2FQ0A 5HGLA 2FVFA 1L0HA 1UJZA 1GXHA 3P05A 2EFJA 3B4QA 3CD6P 2K0XA 2PEMA 3DS4A 1CEIA 1VQ7P 2MVUA 1GXGA 2ONTA 1VQMP 5DCKA 3CCSP 3DS5A 1BXIA 1VQ6P 1BAJA 5F2OA 1UNKA 2XZ0D 1YIJP 3G71P 2XZ1C 5I4TG 3HZQA 2MY5A 4GR6A 3NTEA 1ZMBA 1IMQA 3H0DA 4BPGA 2M8NA 3OW2O 2LF4A 1VKUA 4GR2A 1KQSO 1AUMA 2LTEA 1K8AQ 3RG2A 3G1IA 1VQKP 4H2XC 2OTJP 1RNIA 1DV5A 2KR5A 1QVGO 2JBGA 3LRYA 1T8KA 2L6EA 1Q86Q 4XFXA 2NO8A 2L0QA 3CCJP 1GPJA 3E2DA 1D1DA 3HYBA 3EJDA 2KGCA 1QVFO 4DG9A 5EJDA 1YJNP 3LMOA 1F80D 3GJNA 2KGAA 1KLPA 1HQBA 2MVVA 2XT1A 2JQ4A 4R0MA 5EW5E 2AVAA 1M6EX 4XROA 3G26A 1NJIQ 1M74A 2N5HA 2JB0A 1N8RQ 1EIAA 2JYGA 3CE7A 3CPWO 4XFYA 2E1MA 2PENA 2VLOA 2MD9A 1VQPP 2KWLA 2ERHA 4IPYA 7CEIA 2JU1A 4XFZA 5HVCA 3CCUP 2JU2A 4COPA 3CMEP 1OR5A 2CGQA 1EOQA 5HV8A 2K94A 3GZMA 2MR8A 1M6NA 4PWVB 1YI2P 2Z44A 1NQ4A 2OARA 2LL8A 3WBHA 1IMPA 3U43A 2DGYA 3EJEA 3G6EP 2CNRA 4BPHA 1VQ4P 1A43A 1FR2A 2PEKA 2VLQA 2GZIA 2WPTA 2LPKA 3CC7P 2GDYA 2ROQA 2N98A 2K0YA 1IUQA 4UHPB 4H2YC 1ZNVA 2JYLA 2DNWA 2N5IA 2KW2A 5F2KA 2KG6A 1YJWP 3CC2P 1K73Q 3DS0A 3EJBA 2LIUA 2AFDA 2LOLA 3GKLC 2EHTA 1M90Q 3G4SP 1VQNP 3DTJA 1AYIA 1Q7YQ 2KOPA 1MZ8A 5JPAA 3CXCO 1DNYA 1S72P 2FADA 3G1GA 4QKOA 4MRTC 2PY8A 4U0AA 2GYKA 1KC8Q 2GZFA 1YITP 4U0CA 1QRJA 2EG5A 2LMLA 2KG8A 2GDWA 2L4BA 1A8OA 2QNWA 4PH1A 5BS1A 4HKGA 2FQ1A 3MGEA 1L0IA 2PEIA 2KOQA 4QNBA 1VQ8P 4F37A 2AF8A 4IZ6A 2KOSA 1X3OA 2FHSC 2XXMA 4U0EA 3Q20A 2MR7A 3I56P 1YJ9P 3CCQP 2FVEA 5HGMA 3B5IA 4NEOA 3CCVP 1VQLP 4U0DA 3DS1A 1JJ2O 2BUOA 2GZGA 1YHQP 2PEOA 2N6ZA 4WYMA 2X2BA 2JGPA 4H2WC 2VSQA 5KP7B 1RO0A 2KOOA 2KGDA 5KP8B 3G21A 2L9FA 2KG9A 4U0BA 2KODA
chains in the Genus database with same CATH topology
2L6EA 3H4EA 5F2NA 3CMAP 4XFXA 1Q86Q 1VQ5P 1VQ9P 1K30A 2JYLA 3CCJP 3E2DA 2Z45A 1K9MQ 1YJWP 5F2KA 3CC2P 3VRLC 2M8PA 2QA4P 1K73Q 2P9XA 1D1DA 2BHVA 3HYBA 3G0VA 3DS0A 1KD1Q 1QVFO 5BS2A 5HGNA 3CC4P 3I55P 4XRQA 1YJNP 5HGOA 3DS3A 2XT1A 1M90Q 2PEJA 3H47A 5HGLA 3G4SP 1VQNP 3DTJA 1M6EX 1Q7YQ 4XROA 3G26A 5JPAA 1NJIQ 1M74A 1E6JP 3CXCO 1N8RQ 1S72P 1EIAA 2JYGA 3P05A 2EFJA 3CPWO 4XFYA 3CD6P 3G1GA 3RG6C 2E1MA 2PEMA 2PENA 3DS4A 1VQPP 2PY8A 4U0AA 1VQ7P 1KC8Q 1YITP 4U0CA 4IPYA 1QRJA 3CCLP 2ONTA 2EG5A 1VQMP 4XFZA 5DCKA 3CCSP 3CCUP 1Q81Q 1A8OA 3CCRP 4COPA 3CMEP 3M1MA 3DS5A 3G29A 4PH1A 4U0FA 1VQ6P 4COCA 2Z46A 5BS1A 1EOQA 1BAJA 5F2OA 1RO2A 3MGEA 2OTLP 2PEIA 2JO0A 4QNBA 1W2BO 1VQ8P 1M6NA 2QEXP 2XXMA 4U0EA 2Z44A 1YI2P 3Q20A 2EIAA 1YIJP 3G71P 2OARA 3I56P 3DPHA 3CCMP 1YJ9P 3DS2A 5I4TG 1M1KQ 3CCQP 3HZQA 3WBHA 2M8LA 5HGMA 3B5IA 4GR6A 2DGYA 3CCVP 3NTEA 1VQLP 3G6EP 4U0DA 1ZMBA 3DS1A 1Q82Q 4M0IA 1JJ2O 2BUOA 3H0DA 1VQ4P 1A43A 1YHQP 2PEKA 2PEOA 2PEQA 2M8NA 3OW2O 2LF4A 4WYMA 4PH0A 4GR2A 1KQSO 1RO0A 1AUMA 1K8AQ 3CC7P 2CWOA 3G1IA 1VQKP 3CCEP 1VQOP 3G28A 2OTJP 3G21A 1RNIA 4U0BA 1QVGO 1IUQA 2XV6A 2KODA 3LRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR2 A;  2PEQ A;  3RG6 C;  5BS2 A;  2Z44 A;  2PEM A;  2PEN A;  2Z46 A;  2Z45 A;  3Q20 A;  2PEJ A;  2PEI A;  4GR6 A;  2PY8 A;  3HYB A;  2PEK A;  5BS1 A;  2PEO A; 
#chains in the Genus database with same CATH topology
 4PXH B;  1VQ9 P;  2GDX A;  1E0H A;  1EMV A;  3VRL C;  4CA3 A;  2FAE A;  2P9X A;  2BHV A;  2L22 A;  5HGN A;  5HGO A;  2KGE A;  3H47 A;  2JAZ A;  2EHS A;  1HY8 A;  1E6J P;  2CG5 B;  2GZJ A;  2KOR A;  3NY7 B;  3RG6 C;  2GZE A;  3CCL P;  2PNG A;  1Z6M A;  1Q81 Q;  3CCR P;  3M1M A;  3G29 A;  4U0F A;  4COC A;  2Z46 A;  2FVA A;  2VLP A;  1RO2 A;  2OTL P;  1ACP A;  2K93 A;  2JO0 A;  1W2B O;  2QEX P;  2EIA A;  1AF8 A;  3DPH A;  3CCM P;  3DS2 A;  1M1K Q;  2K92 A;  5CZD B;  2M8L A;  5KP6 B;  2N50 A;  1Q82 Q;  4M0I A;  2K5X A;  2CQ8 A;  2FAC A;  2PEQ A;  1VHN A;  2N6Y A;  2VLN A;  4PH0 A;  2LKI A;  2CWO A;  3CCE P;  2LIW A;  1VQO P;  3G28 A;  2MF4 A;  4BPF A;  2XV6 A;  3GZL A;  3H4E A;  5F2N A;  3CMA P;  2M5R A;  1VQ5 P;  1K30 A;  2Z45 A;  2K2Q A;  1K9M Q;  2M8P A;  2QA4 P;  3G0V A;  1KD1 Q;  5BS2 A;  3CC4 P;  3I55 P;  2AFE A;  4XRQ A;  3DS3 A;  2K0D X;  2FQ2 A;  2PEJ A;  2FQ0 A;  5HGL A;  2FVF A;  1L0H A;  1UJZ A;  1GXH A;  3P05 A;  2EFJ A;  3B4Q A;  3CD6 P;  2K0X A;  2PEM A;  3DS4 A;  1CEI A;  1VQ7 P;  2MVU A;  1GXG A;  2ONT A;  1VQM P;  5DCK A;  3CCS P;  3DS5 A;  1BXI A;  1VQ6 P;  1BAJ A;  5F2O A;  1UNK A;  2XZ0 D;  1YIJ P;  3G71 P;  2XZ1 C;  5I4T G;  3HZQ A;  2MY5 A;  4GR6 A;  3NTE A;  1ZMB A;  1IMQ A;  3H0D A;  4BPG A;  2M8N A;  3OW2 O;  2LF4 A;  1VKU A;  4GR2 A;  1KQS O;  1AUM A;  2LTE A;  1K8A Q;  3RG2 A;  3G1I A;  1VQK P;  4H2X C;  2OTJ P;  1RNI A;  1DV5 A;  2KR5 A;  1QVG O;  2JBG A;  3LRY A;  1T8K A;  2L6E A;  1Q86 Q;  4XFX A;  2NO8 A;  2L0Q A;  3CCJ P;  1GPJ A;  3E2D A;  1D1D A;  3HYB A;  3EJD A;  2KGC A;  1QVF O;  4DG9 A;  5EJD A;  1YJN P;  3LMO A;  1F80 D;  3GJN A;  2KGA A;  1KLP A;  1HQB A;  2MVV A;  2XT1 A;  2JQ4 A;  4R0M A;  5EW5 E;  2AVA A;  1M6E X;  4XRO A;  3G26 A;  1NJI Q;  1M74 A;  2N5H A;  2JB0 A;  1N8R Q;  1EIA A;  2JYG A;  3CE7 A;  3CPW O;  4XFY A;  2E1M A;  2PEN A;  2VLO A;  2MD9 A;  1VQP P;  2KWL A;  2ERH A;  4IPY A;  7CEI A;  2JU1 A;  4XFZ A;  5HVC A;  3CCU P;  2JU2 A;  4COP A;  3CME P;  1OR5 A;  2CGQ A;  1EOQ A;  5HV8 A;  2K94 A;  3GZM A;  2MR8 A;  1M6N A;  4PWV B;  1YI2 P;  2Z44 A;  1NQ4 A;  2OAR A;  2LL8 A;  3WBH A;  1IMP A;  3U43 A;  2DGY A;  3EJE A;  3G6E P;  2CNR A;  4BPH A;  1VQ4 P;  1A43 A;  1FR2 A;  2PEK A;  2VLQ A;  2GZI A;  2WPT A;  2LPK A;  3CC7 P;  2GDY A;  2ROQ A;  2N98 A;  2K0Y A;  1IUQ A;  4UHP B;  4H2Y C;  1ZNV A;  2JYL A;  2DNW A;  2N5I A;  2KW2 A;  5F2K A;  2KG6 A;  1YJW P;  3CC2 P;  1K73 Q;  3DS0 A;  3EJB A;  2LIU A;  2AFD A;  2LOL A;  3GKL C;  2EHT A;  1M90 Q;  3G4S P;  1VQN P;  3DTJ A;  1AYI A;  1Q7Y Q;  2KOP A;  1MZ8 A;  5JPA A;  3CXC O;  1DNY A;  1S72 P;  2FAD A;  3G1G A;  4QKO A;  4MRT C;  2PY8 A;  4U0A A;  2GYK A;  1KC8 Q;  2GZF A;  1YIT P;  4U0C A;  1QRJ A;  2EG5 A;  2LML A;  2KG8 A;  2GDW A;  2L4B A;  1A8O A;  2QNW A;  4PH1 A;  5BS1 A;  4HKG A;  2FQ1 A;  3MGE A;  1L0I A;  2PEI A;  2KOQ A;  4QNB A;  1VQ8 P;  4F37 A;  2AF8 A;  4IZ6 A;  2KOS A;  1X3O A;  2FHS C;  2XXM A;  4U0E A;  3Q20 A;  2MR7 A;  3I56 P;  1YJ9 P;  3CCQ P;  2FVE A;  5HGM A;  3B5I A;  4NEO A;  3CCV P;  1VQL P;  4U0D A;  3DS1 A;  1JJ2 O;  2BUO A;  2GZG A;  1YHQ P;  2PEO A;  2N6Z A;  4WYM A;  2X2B A;  2JGP A;  4H2W C;  2VSQ A;  5KP7 B;  1RO0 A;  2KOO A;  2KGD A;  5KP8 B;  3G21 A;  2L9F A;  2KG9 A;  4U0B A;  2KOD A; 
#chains in the Genus database with same CATH homology
 2L6E A;  3H4E A;  5F2N A;  3CMA P;  4XFX A;  1Q86 Q;  1VQ5 P;  1VQ9 P;  1K30 A;  2JYL A;  3CCJ P;  3E2D A;  2Z45 A;  1K9M Q;  1YJW P;  5F2K A;  3CC2 P;  3VRL C;  2M8P A;  2QA4 P;  1K73 Q;  2P9X A;  1D1D A;  2BHV A;  3HYB A;  3G0V A;  3DS0 A;  1KD1 Q;  1QVF O;  5BS2 A;  5HGN A;  3CC4 P;  3I55 P;  4XRQ A;  1YJN P;  5HGO A;  3DS3 A;  2XT1 A;  1M90 Q;  2PEJ A;  3H47 A;  5HGL A;  3G4S P;  1VQN P;  3DTJ A;  1M6E X;  1Q7Y Q;  4XRO A;  3G26 A;  5JPA A;  1NJI Q;  1M74 A;  1E6J P;  3CXC O;  1N8R Q;  1S72 P;  1EIA A;  2JYG A;  3P05 A;  2EFJ A;  3CPW O;  4XFY A;  3CD6 P;  3G1G A;  3RG6 C;  2E1M A;  2PEM A;  2PEN A;  3DS4 A;  1VQP P;  2PY8 A;  4U0A A;  1VQ7 P;  1KC8 Q;  1YIT P;  4U0C A;  4IPY A;  1QRJ A;  3CCL P;  2ONT A;  2EG5 A;  1VQM P;  4XFZ A;  5DCK A;  3CCS P;  3CCU P;  1Q81 Q;  1A8O A;  3CCR P;  4COP A;  3CME P;  3M1M A;  3DS5 A;  3G29 A;  4PH1 A;  4U0F A;  1VQ6 P;  4COC A;  2Z46 A;  5BS1 A;  1EOQ A;  1BAJ A;  5F2O A;  1RO2 A;  3MGE A;  2OTL P;  2PEI A;  2JO0 A;  4QNB A;  1W2B O;  1VQ8 P;  1M6N A;  2QEX P;  2XXM A;  4U0E A;  2Z44 A;  1YI2 P;  3Q20 A;  2EIA A;  1YIJ P;  3G71 P;  2OAR A;  3I56 P;  3DPH A;  3CCM P;  1YJ9 P;  3DS2 A;  5I4T G;  1M1K Q;  3CCQ P;  3HZQ A;  3WBH A;  2M8L A;  5HGM A;  3B5I A;  4GR6 A;  2DGY A;  3CCV P;  3NTE A;  1VQL P;  3G6E P;  4U0D A;  1ZMB A;  3DS1 A;  1Q82 Q;  4M0I A;  1JJ2 O;  2BUO A;  3H0D A;  1VQ4 P;  1A43 A;  1YHQ P;  2PEK A;  2PEO A;  2PEQ A;  2M8N A;  3OW2 O;  2LF4 A;  4WYM A;  4PH0 A;  4GR2 A;  1KQS O;  1RO0 A;  1AUM A;  1K8A Q;  3CC7 P;  2CWO A;  3G1I A;  1VQK P;  3CCE P;  1VQO P;  3G28 A;  2OTJ P;  3G21 A;  1RNI A;  4U0B A;  1QVG O;  1IUQ A;  2XV6 A;  2KOD A;  3LRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...