2LOLA

Nmr structure of an acyl-carrier protein from rickettsia prowazekii, seattle structural genomics center for infectious disease (ssgcid)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
MSTTDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPDDEATKIKTVSDVIKYIKERQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title NMR structure of an acyl-carrier protein from Rickettsia prowazekii, Seattle Structural Genomics Center for Infectious Disease (SSGCID)
rcsb
source organism Rickettsia prowazekii str. madrid e
molecule tags Lipid transport
total genus 17
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2012-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lolA00
2LMLA 5HVCA 2KOOA 2XZ1C 2L9FA 2FACA 1F80D 2CQ8A 2AFDA 2JU1A 3RG2A 2N5HA 4HKGA 1OR5A 2LL8A 2MD9A 2KOSA 2DNWA 5CZDB 2XZ0D 2K92A 2EHTA 2KG6A 5HV8A 1L0HA 2KOQA 2PNGA 2CGQA 2FQ2A 3EJDA 2FQ0A 2KOPA 1KLPA 3EJEA 2MF4A 1DV5A 2MR7A 4NEOA 2KWLA 2ROQA 2KGDA 2GDWA 4BPGA 5EJDA 4H2XC 2K94A 3GZLA 2LPKA 1NQ4A 4BPFA 2GDYA 2FVEA 2GDXA 1ACPA 2LIUA 2N5IA 5KP7B 2LTEA 2L4BA 1T8KA 2AF8A 2K2QA 2FAEA 3NY7B 2JQ4A 2N50A 2N6YA 4BPHA 1VKUA 5KP8B 2LKIA 2KGEA 2MY5A 2KR5A 2N98A 2AVAA 2CG5B 2K93A 2FADA 1X3OA 2QNWA 2FVFA 3GZMA 3CE7A 2KGCA 2K0XA 2L22A 4CA3A 2JGPA 2M5RA 4H2WC 2FVAA 4PXHB 2X2BA 2K0YA 2KW2A 2FHSC 1DNYA 2VSQA 2EHSA 2LIWA 2N6ZA 2JU2A 5KP6B 2MVUA 2CNRA 4MRTC 4PWVB 2KGAA 2KG9A 2MVVA 3EJBA 4R0MA 4DG9A 1HQBA 2KORA 3LMOA 2LOLA 1HY8A 1L0IA 2AFEA 1AF8A 2MR8A 2FQ1A 4IZ6A 2KG8A 4H2YC 2L0QA
chains in the Genus database with same CATH superfamily
2XZ1C 2L9FA 4COCA 2EG5A 1YHQP 3DS0A 2JB0A 2PENA 3DPHA 1YJWP 4XROA 5HGMA 2VLPA 2EHTA 2JAZA 2KG6A 1KQSO 3B5IA 4GR6A 2OTJP 2FQ2A 3EJDA 3CCMP 3GKLC 1FR2A 5HGLA 4BPGA 1S72P 3DS3A 2JBGA 3GZLA 1Q82Q 2LPKA 1NQ4A 3B4QA 2FVEA 2GDXA 2BHVA 5KP7B 3NTEA 4U0CA 3G1IA 1K8AQ 1M90Q 3CCSP 2JQ4A 2N50A 3H0DA 4U0DA 2E1MA 1UJZA 2PEMA 1QVGO 5F2KA 2KR5A 2CG5B 1VQKP 2FADA 2QNWA 2FVFA 3CC4P 3CE7A 2K0XA 2JGPA 2CWOA 2PEJA 3G0VA 3E2DA 1N8RQ 2K0YA 2FHSC 2VSQA 1EIAA 1Q81Q 1CEIA 2JU2A 5F2NA 1BXIA 1HQBA 1VQLP 2AFEA 1AF8A 2EIAA 3CMAP 4IZ6A 2LMLA 5HVCA 2KOOA 4F37A 3G1GA 2AFDA 1IMQA 2LF4A 1GPJA 4GR2A 5EW5E 2KOSA 2OARA 1GXGA 1L0HA 1E6JP 1YJNP 2KOQA 2PNGA 2FQ0A 2KOPA 1KLPA 3DS1A 4NEOA 2ROQA 5EJDA 4H2XC 2K94A 3CCVP 1KD1Q 3GJNA 2GDYA 3G71P 1ACPA 3DTJA 1A43A 5HGNA 2L4BA 3MGEA 2AF8A 1YI2P 2FAEA 3NY7B 4XRQA 2Z46A 5KP8B 2K5XA 4PH0A 2KGEA 2L6EA 2N98A 3G26A 2K93A 3LRYA 1RO0A 1X3OA 1Q7YQ 2EFJA 2L22A 4CA3A 4H2WC 4PXHB 2XV6A 2X2BA 3CCUP 1JJ2O 2LIWA 1VQPP 2PY8A 1VHNA 2GZFA 3CC2P 4M0IA 5JPAA 4QKOA 2MVUA 3CC7P 3EJBA 2ONTA 3LMOA 2KORA 4QNBA 2BUOA 2XXMA 1GXHA 3CCEP 2DGYA 3CCJP 2MR8A 4COPA 2NO8A 2KG8A 1VQ5P 1D1DA 1VQ4P 2L0QA 2KODA 3OW2O 2QA4P 2JU1A 1ZNVA 2VLOA 3RG2A 2N5HA 2PEOA 1YJ9P 1OR5A 2MD9A 2DNWA 2M8PA 5CZDB 7CEIA 2XZ0D 5BS2A 1MZ8A 1M74A 2K92A 2VLNA 2K0DX 3HYBA 2M8NA 2PEIA 3M1MA 3U43A 1K73Q 5F2OA 1DV5A 2MR7A 2P9XA 2KGDA 2GDWA 3HZQA 2JO0A 3H47A 3Q20A 4U0EA 3WBHA 1VQ6P 2LIUA 2N5IA 4UHPB 1T8KA 3H4EA 2PEQA 1VQOP 2N6YA 3P05A 4BPHA 1VKUA 1YIJP 3CD6P 3G21A 2LKIA 3CCRP 2GZJA 2AVAA 1M6EX 2KGCA 1RO2A 5DCKA 2M5RA 2GZGA 2PEKA 1DNYA 2KW2A 2EHSA 4U0BA 3CMEP 1K30A 2N6ZA 4PH1A 2CNRA 4MRTC 2KG9A 2MVVA 1IUQA 4R0MA 4DG9A 2LOLA 1HY8A 1NJIQ 1AUMA 2JYLA 1YITP 2FQ1A 3CXCO 1M1KQ 1IMPA 2OTLP 3G6EP 3G29A 1VQ9P 2FACA 1EOQA 1F80D 2CQ8A 1AYIA 1QVFO 4HKGA 2LL8A 1VQ8P 2Z44A 2GZIA 1KC8Q 2Z45A 2VLQA 2WPTA 1VQ7P 4XFXA 5HV8A 5BS1A 1BAJA 2CGQA 3RG6C 1K9MQ 1VQNP 3DS5A 2QEXP 3EJEA 2MF4A 1W2BO 2KWLA 3CPWO 1UNKA 4IPYA 3DS2A 2GYKA 3G28A 4BPFA 3VRLC 2LTEA 1Z6MA 2K2QA 1ZMBA 2XT1A 3CCLP 4U0FA 5HGOA 4XFZA 4U0AA 2ERHA 1M6NA 2JYGA 2MY5A 2M8LA 3I56P 3G4SP 4XFYA 3GZMA 3I55P 4WYMA 1RNIA 1Q86Q 2FVAA 1VQMP 1A8OA 5KP6B 5I4TG 4PWVB 2KGAA 1EMVA 1L0IA 1QRJA 3CCQP 3DS4A 1E0HA 4H2YC 2GZEA
chains in the Genus database with same CATH topology
2LMLA 5HVCA 2KOOA 2XZ1C 2L9FA 2FACA 1F80D 2CQ8A 2AFDA 2JU1A 3RG2A 2N5HA 4HKGA 1OR5A 2LL8A 2MD9A 2KOSA 2DNWA 5CZDB 2XZ0D 2K92A 2EHTA 2KG6A 5HV8A 1L0HA 2KOQA 2PNGA 2CGQA 2FQ2A 3EJDA 2FQ0A 2KOPA 1KLPA 3EJEA 2MF4A 1DV5A 2MR7A 4NEOA 2KWLA 2ROQA 2KGDA 2GDWA 4BPGA 5EJDA 4H2XC 2K94A 3GZLA 2LPKA 1NQ4A 4BPFA 2GDYA 2FVEA 2GDXA 1ACPA 2LIUA 2N5IA 5KP7B 2LTEA 2L4BA 1T8KA 2AF8A 2K2QA 2FAEA 3NY7B 2JQ4A 2N50A 2N6YA 4BPHA 1VKUA 5KP8B 2LKIA 2KGEA 2MY5A 2KR5A 2N98A 2AVAA 2CG5B 2K93A 2FADA 1X3OA 2QNWA 2FVFA 3GZMA 3CE7A 2KGCA 2K0XA 2L22A 4CA3A 2JGPA 2M5RA 4H2WC 2FVAA 4PXHB 2X2BA 2K0YA 2KW2A 2FHSC 1DNYA 2VSQA 2EHSA 2LIWA 2N6ZA 2JU2A 5KP6B 2MVUA 2CNRA 4MRTC 4PWVB 2KGAA 2KG9A 2MVVA 3EJBA 4R0MA 4DG9A 1HQBA 2KORA 3LMOA 2LOLA 1HY8A 1L0IA 2AFEA 1AF8A 2MR8A 2FQ1A 4IZ6A 2KG8A 4H2YC 2L0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LML A;  5HVC A;  2KOO A;  2XZ1 C;  2L9F A;  2FAC A;  1F80 D;  2CQ8 A;  2AFD A;  2JU1 A;  3RG2 A;  2N5H A;  4HKG A;  1OR5 A;  2LL8 A;  2MD9 A;  2KOS A;  2DNW A;  5CZD B;  2XZ0 D;  2K92 A;  2EHT A;  2KG6 A;  5HV8 A;  1L0H A;  2KOQ A;  2PNG A;  2CGQ A;  2FQ2 A;  3EJD A;  2FQ0 A;  2KOP A;  1KLP A;  3EJE A;  2MF4 A;  1DV5 A;  2MR7 A;  4NEO A;  2KWL A;  2ROQ A;  2KGD A;  2GDW A;  4BPG A;  5EJD A;  4H2X C;  2K94 A;  3GZL A;  2LPK A;  1NQ4 A;  4BPF A;  2GDY A;  2FVE A;  2GDX A;  1ACP A;  2LIU A;  2N5I A;  5KP7 B;  2LTE A;  2L4B A;  1T8K A;  2AF8 A;  2K2Q A;  2FAE A;  3NY7 B;  2JQ4 A;  2N50 A;  2N6Y A;  4BPH A;  1VKU A;  5KP8 B;  2LKI A;  2KGE A;  2MY5 A;  2KR5 A;  2N98 A;  2AVA A;  2CG5 B;  2K93 A;  2FAD A;  1X3O A;  2QNW A;  2FVF A;  3GZM A;  3CE7 A;  2KGC A;  2K0X A;  2L22 A;  4CA3 A;  2JGP A;  2M5R A;  4H2W C;  2FVA A;  4PXH B;  2X2B A;  2K0Y A;  2KW2 A;  2FHS C;  1DNY A;  2VSQ A;  2EHS A;  2LIW A;  2N6Z A;  2JU2 A;  5KP6 B;  2MVU A;  2CNR A;  4MRT C;  4PWV B;  2KGA A;  2KG9 A;  2MVV A;  3EJB A;  4R0M A;  4DG9 A;  1HQB A;  2KOR A;  3LMO A;  2LOL A;  1HY8 A;  1L0I A;  2AFE A;  1AF8 A;  2MR8 A;  2FQ1 A;  4IZ6 A;  2KG8 A;  4H2Y C;  2L0Q A; 
#chains in the Genus database with same CATH topology
 2XZ1 C;  2L9F A;  4COC A;  2EG5 A;  1YHQ P;  3DS0 A;  2JB0 A;  2PEN A;  3DPH A;  1YJW P;  4XRO A;  5HGM A;  2VLP A;  2EHT A;  2JAZ A;  2KG6 A;  1KQS O;  3B5I A;  4GR6 A;  2OTJ P;  2FQ2 A;  3EJD A;  3CCM P;  3GKL C;  1FR2 A;  5HGL A;  4BPG A;  1S72 P;  3DS3 A;  2JBG A;  3GZL A;  1Q82 Q;  2LPK A;  1NQ4 A;  3B4Q A;  2FVE A;  2GDX A;  2BHV A;  5KP7 B;  3NTE A;  4U0C A;  3G1I A;  1K8A Q;  1M90 Q;  3CCS P;  2JQ4 A;  2N50 A;  3H0D A;  4U0D A;  2E1M A;  1UJZ A;  2PEM A;  1QVG O;  5F2K A;  2KR5 A;  2CG5 B;  1VQK P;  2FAD A;  2QNW A;  2FVF A;  3CC4 P;  3CE7 A;  2K0X A;  2JGP A;  2CWO A;  2PEJ A;  3G0V A;  3E2D A;  1N8R Q;  2K0Y A;  2FHS C;  2VSQ A;  1EIA A;  1Q81 Q;  1CEI A;  2JU2 A;  5F2N A;  1BXI A;  1HQB A;  1VQL P;  2AFE A;  1AF8 A;  2EIA A;  3CMA P;  4IZ6 A;  2LML A;  5HVC A;  2KOO A;  4F37 A;  3G1G A;  2AFD A;  1IMQ A;  2LF4 A;  1GPJ A;  4GR2 A;  5EW5 E;  2KOS A;  2OAR A;  1GXG A;  1L0H A;  1E6J P;  1YJN P;  2KOQ A;  2PNG A;  2FQ0 A;  2KOP A;  1KLP A;  3DS1 A;  4NEO A;  2ROQ A;  5EJD A;  4H2X C;  2K94 A;  3CCV P;  1KD1 Q;  3GJN A;  2GDY A;  3G71 P;  1ACP A;  3DTJ A;  1A43 A;  5HGN A;  2L4B A;  3MGE A;  2AF8 A;  1YI2 P;  2FAE A;  3NY7 B;  4XRQ A;  2Z46 A;  5KP8 B;  2K5X A;  4PH0 A;  2KGE A;  2L6E A;  2N98 A;  3G26 A;  2K93 A;  3LRY A;  1RO0 A;  1X3O A;  1Q7Y Q;  2EFJ A;  2L22 A;  4CA3 A;  4H2W C;  4PXH B;  2XV6 A;  2X2B A;  3CCU P;  1JJ2 O;  2LIW A;  1VQP P;  2PY8 A;  1VHN A;  2GZF A;  3CC2 P;  4M0I A;  5JPA A;  4QKO A;  2MVU A;  3CC7 P;  3EJB A;  2ONT A;  3LMO A;  2KOR A;  4QNB A;  2BUO A;  2XXM A;  1GXH A;  3CCE P;  2DGY A;  3CCJ P;  2MR8 A;  4COP A;  2NO8 A;  2KG8 A;  1VQ5 P;  1D1D A;  1VQ4 P;  2L0Q A;  2KOD A;  3OW2 O;  2QA4 P;  2JU1 A;  1ZNV A;  2VLO A;  3RG2 A;  2N5H A;  2PEO A;  1YJ9 P;  1OR5 A;  2MD9 A;  2DNW A;  2M8P A;  5CZD B;  7CEI A;  2XZ0 D;  5BS2 A;  1MZ8 A;  1M74 A;  2K92 A;  2VLN A;  2K0D X;  3HYB A;  2M8N A;  2PEI A;  3M1M A;  3U43 A;  1K73 Q;  5F2O A;  1DV5 A;  2MR7 A;  2P9X A;  2KGD A;  2GDW A;  3HZQ A;  2JO0 A;  3H47 A;  3Q20 A;  4U0E A;  3WBH A;  1VQ6 P;  2LIU A;  2N5I A;  4UHP B;  1T8K A;  3H4E A;  2PEQ A;  1VQO P;  2N6Y A;  3P05 A;  4BPH A;  1VKU A;  1YIJ P;  3CD6 P;  3G21 A;  2LKI A;  3CCR P;  2GZJ A;  2AVA A;  1M6E X;  2KGC A;  1RO2 A;  5DCK A;  2M5R A;  2GZG A;  2PEK A;  1DNY A;  2KW2 A;  2EHS A;  4U0B A;  3CME P;  1K30 A;  2N6Z A;  4PH1 A;  2CNR A;  4MRT C;  2KG9 A;  2MVV A;  1IUQ A;  4R0M A;  4DG9 A;  2LOL A;  1HY8 A;  1NJI Q;  1AUM A;  2JYL A;  1YIT P;  2FQ1 A;  3CXC O;  1M1K Q;  1IMP A;  2OTL P;  3G6E P;  3G29 A;  1VQ9 P;  2FAC A;  1EOQ A;  1F80 D;  2CQ8 A;  1AYI A;  1QVF O;  4HKG A;  2LL8 A;  1VQ8 P;  2Z44 A;  2GZI A;  1KC8 Q;  2Z45 A;  2VLQ A;  2WPT A;  1VQ7 P;  4XFX A;  5HV8 A;  5BS1 A;  1BAJ A;  2CGQ A;  3RG6 C;  1K9M Q;  1VQN P;  3DS5 A;  2QEX P;  3EJE A;  2MF4 A;  1W2B O;  2KWL A;  3CPW O;  1UNK A;  4IPY A;  3DS2 A;  2GYK A;  3G28 A;  4BPF A;  3VRL C;  2LTE A;  1Z6M A;  2K2Q A;  1ZMB A;  2XT1 A;  3CCL P;  4U0F A;  5HGO A;  4XFZ A;  4U0A A;  2ERH A;  1M6N A;  2JYG A;  2MY5 A;  2M8L A;  3I56 P;  3G4S P;  4XFY A;  3GZM A;  3I55 P;  4WYM A;  1RNI A;  1Q86 Q;  2FVA A;  1VQM P;  1A8O A;  5KP6 B;  5I4T G;  4PWV B;  2KGA A;  1EMV A;  1L0I A;  1QRJ A;  3CCQ P;  3DS4 A;  1E0H A;  4H2Y C;  2GZE A; 
#chains in the Genus database with same CATH homology
 2LML A;  5HVC A;  2KOO A;  2XZ1 C;  2L9F A;  2FAC A;  1F80 D;  2CQ8 A;  2AFD A;  2JU1 A;  3RG2 A;  2N5H A;  4HKG A;  1OR5 A;  2LL8 A;  2MD9 A;  2KOS A;  2DNW A;  5CZD B;  2XZ0 D;  2K92 A;  2EHT A;  2KG6 A;  5HV8 A;  1L0H A;  2KOQ A;  2PNG A;  2CGQ A;  2FQ2 A;  3EJD A;  2FQ0 A;  2KOP A;  1KLP A;  3EJE A;  2MF4 A;  1DV5 A;  2MR7 A;  4NEO A;  2KWL A;  2ROQ A;  2KGD A;  2GDW A;  4BPG A;  5EJD A;  4H2X C;  2K94 A;  3GZL A;  2LPK A;  1NQ4 A;  4BPF A;  2GDY A;  2FVE A;  2GDX A;  1ACP A;  2LIU A;  2N5I A;  5KP7 B;  2LTE A;  2L4B A;  1T8K A;  2AF8 A;  2K2Q A;  2FAE A;  3NY7 B;  2JQ4 A;  2N50 A;  2N6Y A;  4BPH A;  1VKU A;  5KP8 B;  2LKI A;  2KGE A;  2MY5 A;  2KR5 A;  2N98 A;  2AVA A;  2CG5 B;  2K93 A;  2FAD A;  1X3O A;  2QNW A;  2FVF A;  3GZM A;  3CE7 A;  2KGC A;  2K0X A;  2L22 A;  4CA3 A;  2JGP A;  2M5R A;  4H2W C;  2FVA A;  4PXH B;  2X2B A;  2K0Y A;  2KW2 A;  2FHS C;  1DNY A;  2VSQ A;  2EHS A;  2LIW A;  2N6Z A;  2JU2 A;  5KP6 B;  2MVU A;  2CNR A;  4MRT C;  4PWV B;  2KGA A;  2KG9 A;  2MVV A;  3EJB A;  4R0M A;  4DG9 A;  1HQB A;  2KOR A;  3LMO A;  2LOL A;  1HY8 A;  1L0I A;  2AFE A;  1AF8 A;  2MR8 A;  2FQ1 A;  4IZ6 A;  2KG8 A;  4H2Y C;  2L0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...