2LOLA

Nmr structure of an acyl-carrier protein from rickettsia prowazekii, seattle structural genomics center for infectious disease (ssgcid)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
MSTTDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPDDEATKIKTVSDVIKYIKERQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title NMR structure of an acyl-carrier protein from Rickettsia prowazekii, Seattle Structural Genomics Center for Infectious Disease (SSGCID)
rcsb
source organism Rickettsia prowazekii str. madrid e
molecule tags Lipid transport
total genus 17
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2012-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lolA00
4HKGA 2KOOA 2LOLA 2N5IA 1DV5A 2L4BA 5CZDB 1AF8A 2LL8A 2KR5A 2FQ2A 1L0IA 2N5HA 1DNYA 5HVCA 2LMLA 2JQ4A 4H2YC 1L0HA 3EJDA 5EJDA 1HY8A 2KOQA 2PNGA 1HQBA 2KGCA 2XZ0D 2MVVA 2JGPA 2N6ZA 4MRTC 4IZ6A 2JU2A 2FVFA 2K93A 3RG2A 2K92A 1NQ4A 2EHTA 2FQ1A 2N50A 2KOPA 3EJBA 2LIUA 1ACPA 1T8KA 2GDXA 2KWLA 3NY7B 5HV8A 2GDWA 2LPKA 4BPGA 2K0XA 2KG6A 4H2WC 2CQ8A 5KP6B 3GZLA 1OR5A 1VKUA 2FQ0A 2MVUA 4BPFA 2FVEA 4PWVB 2KGDA 1F80D 2XZ1C 2L9FA 2KGAA 2AVAA 1KLPA 2MR7A 2LTEA 4BPHA 2KGEA 4DG9A 2FHSC 2M5RA 2KW2A 2ROQA 2K0YA 2GDYA 5KP8B 2LIWA 2FAEA 2DNWA 4PXHB 2AF8A 5KP7B 2LKIA 2CGQA 4H2XC 3EJEA 2KG8A 2MD9A 3CE7A 2AFEA 2KORA 2L22A 2L0QA 2CG5B 2N98A 2X2BA 2EHSA 4NEOA 2VSQA 2QNWA 2KOSA 2CNRA 2MF4A 2JU1A 2KG9A 3GZMA 2FACA 2MR8A 1X3OA 3LMOA 4CA3A 2FADA 2K94A 2K2QA 2N6YA 2FVAA 2MY5A 2AFDA 4R0MA
chains in the Genus database with same CATH superfamily
2KOOA 2QA4P 2LOLA 1DV5A 2L4BA 7CEIA 2LL8A 2GZGA 1L0IA 1DNYA 5HVCA 2LF4A 1HY8A 2WPTA 3WBHA 3G28A 5BS2A 1AYIA 5HGNA 1M6NA 2PNGA 1HQBA 2PEJA 2EG5A 1CEIA 2BHVA 1VQ8P 1NQ4A 2FQ1A 2VLNA 2LIUA 1T8KA 2OTJP 3CCUP 2GDXA 3DPHA 5F2OA 4H2WC 5KP6B 2FVEA 3OW2O 3LRYA 2KGDA 2JBGA 1M6EX 2AVAA 1KC8Q 3I55P 3HZQA 1M90Q 3U43A 4DG9A 4XROA 5HGLA 2M5RA 2KW2A 2K0YA 2M8PA 1M74A 2JYGA 2LIWA 3GJNA 2DNWA 3H47A 4GR6A 2GZFA 2AF8A 2LKIA 2CGQA 1VQPP 4H2XC 2VLOA 3EJEA 1K9MQ 2KORA 3CC4P 3CCRP 3G1GA 2VLQA 4NEOA 1BXIA 1VQOP 1QVFO 3LMOA 4CA3A 2K94A 5EW5E 2OTLP 1AUMA 1IMQA 3RG6C 1JJ2O 1VQNP 4XRQA 2N5HA 2NO8A 4U0FA 5HGMA 2Z45A 5BS1A 4H2YC 1VQMP 5HGOA 3EJDA 2EFJA 1YHQP 3CCEP 2CWOA 2DGYA 2KGCA 3DS4A 2MVVA 1ZMBA 2JU2A 2EHTA 1BAJA 2GZJA 2JO0A 2PEIA 1Q81Q 1M1KQ 3HYBA 5HV8A 3VRLC 3CMAP 2ONTA 2LPKA 2KG6A 4M0IA 1OR5A 1VKUA 2M8NA 4F37A 1VQ4P 3G71P 2L9FA 1W2BO 2XV6A 1Q7YQ 1YJNP 1KD1Q 2FAEA 1VQ5P 3G21A 3DS0A 4PXHB 5KP7B 4QKOA 3G26A 3CE7A 2L6EA 2PEQA 2L22A 2JAZA 4WYMA 1K73Q 2JYLA 2N98A 1YJ9P 3CCJP 1VQKP 2EHSA 2KODA 4GR2A 2VSQA 2QNWA 1A8OA 3CPWO 2XXMA 2KOSA 3CCSP 3GZMA 3DS1A 1NJIQ 2OARA 1RO0A 4U0AA 2FVAA 3G1IA 4XFXA 2MY5A 1Q86Q 3CMEP 4HKGA 2N5IA 1ZNVA 4COCA 3B5IA 2KR5A 2LMLA 2VLPA 2JQ4A 2PENA 4XFYA 2E1MA 2PEKA 5EJDA 1EOQA 3CCMP 2KOQA 1VQ6P 2N6ZA 4MRTC 3CXCO 2FVFA 2GZEA 2K92A 3M1MA 3G0VA 2N50A 2KOPA 3EJBA 4UHPB 2K0DX 1ACPA 3NY7B 1VQ7P 2GDWA 4BPGA 2K0XA 1QVGO 1K30A 3GKLC 2CQ8A 3GZLA 3G6EP 2FQ0A 2MVUA 1UJZA 2XT1A 3P05A 2GZIA 1RNIA 1IUQA 3E2DA 1F80D 2KGAA 1FR2A 4COPA 2MR7A 3G29A 3DS5A 3DS3A 2FHSC 1S72P 1YITP 2JB0A 2ROQA 1MZ8A 5KP8B 3I56P 4U0DA 2K5XA 3H4EA 2MD9A 3Q20A 1D1DA 1VQLP 2L0QA 3B4QA 2X2BA 3NTEA 1YI2P 5DCKA 3CCVP 2CNRA 3DS2A 2KG9A 1X3OA 1K8AQ 2N6YA 2AFDA 4R0MA 4U0EA 1YIJP 1GXGA 5CZDB 3CD6P 1AF8A 1RO2A 2QEXP 2FQ2A 1EIAA 1L0HA 4QNBA 5JPAA 2XZ0D 2JGPA 4IZ6A 1QRJA 2K93A 3RG2A 1UNKA 3G4SP 2PY8A 1A43A 2BUOA 3CCQP 2KWLA 1E0HA 2Z46A 1IMPA 2P9XA 4BPFA 4PWVB 1E6JP 2PEOA 2XZ1C 4PH1A 2PEMA 1KLPA 1GXHA 2LTEA 3MGEA 2ERHA 3CC2P 4BPHA 2KGEA 1GPJA 1Q82Q 4U0CA 5F2NA 2GDYA 1YJWP 4XFZA 1Z6MA 5I4TG 1EMVA 2KG8A 2M8LA 2AFEA 3DTJA 1VQ9P 3CCLP 2CG5B 4IPYA 1N8RQ 3CC7P 4PH0A 2EIAA 5F2KA 2GYKA 2MF4A 1KQSO 2JU1A 2FACA 2MR8A 2FADA 2K2QA 2Z44A 1VHNA 4U0BA 3H0DA
chains in the Genus database with same CATH topology
4HKGA 2KOOA 2LOLA 2N5IA 1DV5A 2L4BA 5CZDB 1AF8A 2LL8A 2KR5A 2FQ2A 1L0IA 2N5HA 1DNYA 5HVCA 2LMLA 2JQ4A 4H2YC 1L0HA 3EJDA 5EJDA 1HY8A 2KOQA 2PNGA 1HQBA 2KGCA 2XZ0D 2MVVA 2JGPA 2N6ZA 4MRTC 4IZ6A 2JU2A 2FVFA 2K93A 3RG2A 2K92A 1NQ4A 2EHTA 2FQ1A 2N50A 2KOPA 3EJBA 2LIUA 1ACPA 1T8KA 2GDXA 2KWLA 3NY7B 5HV8A 2GDWA 2LPKA 4BPGA 2K0XA 2KG6A 4H2WC 2CQ8A 5KP6B 3GZLA 1OR5A 1VKUA 2FQ0A 2MVUA 4BPFA 2FVEA 4PWVB 2KGDA 1F80D 2XZ1C 2L9FA 2KGAA 2AVAA 1KLPA 2MR7A 2LTEA 4BPHA 2KGEA 4DG9A 2FHSC 2M5RA 2KW2A 2ROQA 2K0YA 2GDYA 5KP8B 2LIWA 2FAEA 2DNWA 4PXHB 2AF8A 5KP7B 2LKIA 2CGQA 4H2XC 3EJEA 2KG8A 2MD9A 3CE7A 2AFEA 2KORA 2L22A 2L0QA 2CG5B 2N98A 2X2BA 2EHSA 4NEOA 2VSQA 2QNWA 2KOSA 2CNRA 2MF4A 2JU1A 2KG9A 3GZMA 2FACA 2MR8A 1X3OA 3LMOA 4CA3A 2FADA 2K94A 2K2QA 2N6YA 2FVAA 2MY5A 2AFDA 4R0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKG A;  2KOO A;  2LOL A;  2N5I A;  1DV5 A;  2L4B A;  5CZD B;  1AF8 A;  2LL8 A;  2KR5 A;  2FQ2 A;  1L0I A;  2N5H A;  1DNY A;  5HVC A;  2LML A;  2JQ4 A;  4H2Y C;  1L0H A;  3EJD A;  5EJD A;  1HY8 A;  2KOQ A;  2PNG A;  1HQB A;  2KGC A;  2XZ0 D;  2MVV A;  2JGP A;  2N6Z A;  4MRT C;  4IZ6 A;  2JU2 A;  2FVF A;  2K93 A;  3RG2 A;  2K92 A;  1NQ4 A;  2EHT A;  2FQ1 A;  2N50 A;  2KOP A;  3EJB A;  2LIU A;  1ACP A;  1T8K A;  2GDX A;  2KWL A;  3NY7 B;  5HV8 A;  2GDW A;  2LPK A;  4BPG A;  2K0X A;  2KG6 A;  4H2W C;  2CQ8 A;  5KP6 B;  3GZL A;  1OR5 A;  1VKU A;  2FQ0 A;  2MVU A;  4BPF A;  2FVE A;  4PWV B;  2KGD A;  1F80 D;  2XZ1 C;  2L9F A;  2KGA A;  2AVA A;  1KLP A;  2MR7 A;  2LTE A;  4BPH A;  2KGE A;  4DG9 A;  2FHS C;  2M5R A;  2KW2 A;  2ROQ A;  2K0Y A;  2GDY A;  5KP8 B;  2LIW A;  2FAE A;  2DNW A;  4PXH B;  2AF8 A;  5KP7 B;  2LKI A;  2CGQ A;  4H2X C;  3EJE A;  2KG8 A;  2MD9 A;  3CE7 A;  2AFE A;  2KOR A;  2L22 A;  2L0Q A;  2CG5 B;  2N98 A;  2X2B A;  2EHS A;  4NEO A;  2VSQ A;  2QNW A;  2KOS A;  2CNR A;  2MF4 A;  2JU1 A;  2KG9 A;  3GZM A;  2FAC A;  2MR8 A;  1X3O A;  3LMO A;  4CA3 A;  2FAD A;  2K94 A;  2K2Q A;  2N6Y A;  2FVA A;  2MY5 A;  2AFD A;  4R0M A; 
#chains in the Genus database with same CATH topology
 2KOO A;  2QA4 P;  2LOL A;  1DV5 A;  2L4B A;  7CEI A;  2LL8 A;  2GZG A;  1L0I A;  1DNY A;  5HVC A;  2LF4 A;  1HY8 A;  2WPT A;  3WBH A;  3G28 A;  5BS2 A;  1AYI A;  5HGN A;  1M6N A;  2PNG A;  1HQB A;  2PEJ A;  2EG5 A;  1CEI A;  2BHV A;  1VQ8 P;  1NQ4 A;  2FQ1 A;  2VLN A;  2LIU A;  1T8K A;  2OTJ P;  3CCU P;  2GDX A;  3DPH A;  5F2O A;  4H2W C;  5KP6 B;  2FVE A;  3OW2 O;  3LRY A;  2KGD A;  2JBG A;  1M6E X;  2AVA A;  1KC8 Q;  3I55 P;  3HZQ A;  1M90 Q;  3U43 A;  4DG9 A;  4XRO A;  5HGL A;  2M5R A;  2KW2 A;  2K0Y A;  2M8P A;  1M74 A;  2JYG A;  2LIW A;  3GJN A;  2DNW A;  3H47 A;  4GR6 A;  2GZF A;  2AF8 A;  2LKI A;  2CGQ A;  1VQP P;  4H2X C;  2VLO A;  3EJE A;  1K9M Q;  2KOR A;  3CC4 P;  3CCR P;  3G1G A;  2VLQ A;  4NEO A;  1BXI A;  1VQO P;  1QVF O;  3LMO A;  4CA3 A;  2K94 A;  5EW5 E;  2OTL P;  1AUM A;  1IMQ A;  3RG6 C;  1JJ2 O;  1VQN P;  4XRQ A;  2N5H A;  2NO8 A;  4U0F A;  5HGM A;  2Z45 A;  5BS1 A;  4H2Y C;  1VQM P;  5HGO A;  3EJD A;  2EFJ A;  1YHQ P;  3CCE P;  2CWO A;  2DGY A;  2KGC A;  3DS4 A;  2MVV A;  1ZMB A;  2JU2 A;  2EHT A;  1BAJ A;  2GZJ A;  2JO0 A;  2PEI A;  1Q81 Q;  1M1K Q;  3HYB A;  5HV8 A;  3VRL C;  3CMA P;  2ONT A;  2LPK A;  2KG6 A;  4M0I A;  1OR5 A;  1VKU A;  2M8N A;  4F37 A;  1VQ4 P;  3G71 P;  2L9F A;  1W2B O;  2XV6 A;  1Q7Y Q;  1YJN P;  1KD1 Q;  2FAE A;  1VQ5 P;  3G21 A;  3DS0 A;  4PXH B;  5KP7 B;  4QKO A;  3G26 A;  3CE7 A;  2L6E A;  2PEQ A;  2L22 A;  2JAZ A;  4WYM A;  1K73 Q;  2JYL A;  2N98 A;  1YJ9 P;  3CCJ P;  1VQK P;  2EHS A;  2KOD A;  4GR2 A;  2VSQ A;  2QNW A;  1A8O A;  3CPW O;  2XXM A;  2KOS A;  3CCS P;  3GZM A;  3DS1 A;  1NJI Q;  2OAR A;  1RO0 A;  4U0A A;  2FVA A;  3G1I A;  4XFX A;  2MY5 A;  1Q86 Q;  3CME P;  4HKG A;  2N5I A;  1ZNV A;  4COC A;  3B5I A;  2KR5 A;  2LML A;  2VLP A;  2JQ4 A;  2PEN A;  4XFY A;  2E1M A;  2PEK A;  5EJD A;  1EOQ A;  3CCM P;  2KOQ A;  1VQ6 P;  2N6Z A;  4MRT C;  3CXC O;  2FVF A;  2GZE A;  2K92 A;  3M1M A;  3G0V A;  2N50 A;  2KOP A;  3EJB A;  4UHP B;  2K0D X;  1ACP A;  3NY7 B;  1VQ7 P;  2GDW A;  4BPG A;  2K0X A;  1QVG O;  1K30 A;  3GKL C;  2CQ8 A;  3GZL A;  3G6E P;  2FQ0 A;  2MVU A;  1UJZ A;  2XT1 A;  3P05 A;  2GZI A;  1RNI A;  1IUQ A;  3E2D A;  1F80 D;  2KGA A;  1FR2 A;  4COP A;  2MR7 A;  3G29 A;  3DS5 A;  3DS3 A;  2FHS C;  1S72 P;  1YIT P;  2JB0 A;  2ROQ A;  1MZ8 A;  5KP8 B;  3I56 P;  4U0D A;  2K5X A;  3H4E A;  2MD9 A;  3Q20 A;  1D1D A;  1VQL P;  2L0Q A;  3B4Q A;  2X2B A;  3NTE A;  1YI2 P;  5DCK A;  3CCV P;  2CNR A;  3DS2 A;  2KG9 A;  1X3O A;  1K8A Q;  2N6Y A;  2AFD A;  4R0M A;  4U0E A;  1YIJ P;  1GXG A;  5CZD B;  3CD6 P;  1AF8 A;  1RO2 A;  2QEX P;  2FQ2 A;  1EIA A;  1L0H A;  4QNB A;  5JPA A;  2XZ0 D;  2JGP A;  4IZ6 A;  1QRJ A;  2K93 A;  3RG2 A;  1UNK A;  3G4S P;  2PY8 A;  1A43 A;  2BUO A;  3CCQ P;  2KWL A;  1E0H A;  2Z46 A;  1IMP A;  2P9X A;  4BPF A;  4PWV B;  1E6J P;  2PEO A;  2XZ1 C;  4PH1 A;  2PEM A;  1KLP A;  1GXH A;  2LTE A;  3MGE A;  2ERH A;  3CC2 P;  4BPH A;  2KGE A;  1GPJ A;  1Q82 Q;  4U0C A;  5F2N A;  2GDY A;  1YJW P;  4XFZ A;  1Z6M A;  5I4T G;  1EMV A;  2KG8 A;  2M8L A;  2AFE A;  3DTJ A;  1VQ9 P;  3CCL P;  2CG5 B;  4IPY A;  1N8R Q;  3CC7 P;  4PH0 A;  2EIA A;  5F2K A;  2GYK A;  2MF4 A;  1KQS O;  2JU1 A;  2FAC A;  2MR8 A;  2FAD A;  2K2Q A;  2Z44 A;  1VHN A;  4U0B A;  3H0D A; 
#chains in the Genus database with same CATH homology
 4HKG A;  2KOO A;  2LOL A;  2N5I A;  1DV5 A;  2L4B A;  5CZD B;  1AF8 A;  2LL8 A;  2KR5 A;  2FQ2 A;  1L0I A;  2N5H A;  1DNY A;  5HVC A;  2LML A;  2JQ4 A;  4H2Y C;  1L0H A;  3EJD A;  5EJD A;  1HY8 A;  2KOQ A;  2PNG A;  1HQB A;  2KGC A;  2XZ0 D;  2MVV A;  2JGP A;  2N6Z A;  4MRT C;  4IZ6 A;  2JU2 A;  2FVF A;  2K93 A;  3RG2 A;  2K92 A;  1NQ4 A;  2EHT A;  2FQ1 A;  2N50 A;  2KOP A;  3EJB A;  2LIU A;  1ACP A;  1T8K A;  2GDX A;  2KWL A;  3NY7 B;  5HV8 A;  2GDW A;  2LPK A;  4BPG A;  2K0X A;  2KG6 A;  4H2W C;  2CQ8 A;  5KP6 B;  3GZL A;  1OR5 A;  1VKU A;  2FQ0 A;  2MVU A;  4BPF A;  2FVE A;  4PWV B;  2KGD A;  1F80 D;  2XZ1 C;  2L9F A;  2KGA A;  2AVA A;  1KLP A;  2MR7 A;  2LTE A;  4BPH A;  2KGE A;  4DG9 A;  2FHS C;  2M5R A;  2KW2 A;  2ROQ A;  2K0Y A;  2GDY A;  5KP8 B;  2LIW A;  2FAE A;  2DNW A;  4PXH B;  2AF8 A;  5KP7 B;  2LKI A;  2CGQ A;  4H2X C;  3EJE A;  2KG8 A;  2MD9 A;  3CE7 A;  2AFE A;  2KOR A;  2L22 A;  2L0Q A;  2CG5 B;  2N98 A;  2X2B A;  2EHS A;  4NEO A;  2VSQ A;  2QNW A;  2KOS A;  2CNR A;  2MF4 A;  2JU1 A;  2KG9 A;  3GZM A;  2FAC A;  2MR8 A;  1X3O A;  3LMO A;  4CA3 A;  2FAD A;  2K94 A;  2K2Q A;  2N6Y A;  2FVA A;  2MY5 A;  2AFD A;  4R0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...