2LOLA

Nmr structure of an acyl-carrier protein from rickettsia prowazekii, seattle structural genomics center for infectious disease (ssgcid)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
81
structure length
81
Chain Sequence
MSTTDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPDDEATKIKTVSDVIKYIKERQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Acyl carrier protein
publication title NMR structure of an acyl-carrier protein from Rickettsia prowazekii, Seattle Structural Genomics Center for Infectious Disease (SSGCID)
rcsb
source organism Rickettsia prowazekii str. madrid e
total genus 17
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2012-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2lolA00
3EJBA 2M5RA 2CG5B 3EJEA 1HY8A 1VKUA 2LOLA 1AF8A 5KP7B 5EJDA 1L0IA 1KLPA 2N6ZA 2CQ8A 2MF4A 2MVVA 2MVUA 2KOOA 2EHTA 2L0QA 2KOSA 5HVCA 2KG6A 2FAEA 2JQ4A 2ROQA 1DV5A 4H2YC 4PXHB 1NQ4A 3CE7A 3LMOA 2FQ2A 2AF8A 2DNWA 2GDYA 2KGEA 5KP8B 2FACA 2CNRA 2L22A 2N50A 3NY7B 2LKIA 4PWVB 2JU2A 2K93A 2K94A 4HKGA 4BPGA 2VSQA 2FVEA 3EJDA 2N5IA 4DG9A 2KG8A 2KG9A 3GZMA 2PNGA 2MR8A 1F80D 2CGQA 3GZLA 4H2WC 2K0YA 2LTEA 2L9FA 4R0MA 1X3OA 2K0XA 2AVAA 2LL8A 2KOQA 2JGPA 2KOPA 1L0HA 2QNWA 2K92A 2N98A 2X2BA 2L4BA 2KGCA 4MRTC 4BPHA 4CA3A 2FHSC 4NEOA 1HQBA 1DNYA 2FQ0A 2MY5A 2FVFA 2XZ1C 5CZDB 2N6YA 2GDXA 2LIUA 2KW2A 4H2XC 2KGDA 2LMLA 2FQ1A 2KR5A 5HV8A 2AFEA 2JU1A 5KP6B 3RG2A 4IZ6A 2AFDA 2MD9A 2GDWA 2KORA 2XZ0D 2LPKA 2FADA 2FVAA 4BPFA 2EHSA 1ACPA 2MR7A 2N5HA 2KWLA 1T8KA 2K2QA 1OR5A 2LIWA 2KGAA
chains in the Genus database with same CATH superfamily
1YITP 1KC8Q 3EJEA 2JO0A 2LOLA 1L0IA 2KODA 1EOQA 2MVUA 2KOOA 2VLQA 3G71P 4XFXA 2KG6A 3Q20A 3P05A 4PXHB 1NQ4A 3DS0A 3LMOA 2PEOA 3CCLP 3G21A 5BS1A 3G6EP 1E0HA 3G28A 4COCA 2K93A 2K94A 1M1KQ 3EJDA 2PNGA 1QVFO 1F80D 2PY8A 5HGOA 3G0VA 2CGQA 1M74A 2Z45A 2PEQA 1BAJA 2AVAA 2CWOA 2JYLA 2QNWA 5DCKA 2NO8A 1YIJP 1ZMBA 2X2BA 2KGCA 4MRTC 4BPHA 3H0DA 3DS2A 1IUQA 5CZDB 2E1MA 1Q86Q 1AYIA 2FQ1A 2GZGA 3CD6P 2KR5A 4XROA 3H4EA 2EFJA 2GZIA 3DS5A 4PH1A 5I4TG 2KORA 2XZ0D 3B4QA 2Z44A 2FADA 2L6EA 2FVAA 2ONTA 1VHNA 2EHSA 2KWLA 1T8KA 2K2QA 4COPA 3CCJP 2KGAA 3EJBA 3G26A 3GJNA 4M0IA 2CG5B 3DTJA 4U0BA 3DPHA 5KP7B 1M6EX 3HZQA 3LRYA 5JPAA 5HVCA 1Q82Q 2VLPA 2WPTA 3CC2P 7CEIA 2GDYA 2DNWA 2FACA 2CNRA 3H47A 2BUOA 2N50A 3GKLC 2LKIA 4PWVB 5HGNA 3G1GA 4HKGA 2K5XA 2N5IA 4DG9A 2KG8A 3HYBA 3CMAP 1K73Q 2K0YA 1X3OA 2K0XA 1FR2A 2PENA 3I55P 2GZJA 4XRQA 1VQNP 2KOPA 4GR6A 5F2OA 1QVGO 2L4BA 2GZEA 4NEOA 4F37A 2BHVA 2XV6A 1HQBA 2PEKA 2JYGA 2XZ1C 2GZFA 2KW2A 4H2XC 3G4SP 2QA4P 3CCQP 2JU1A 5BS2A 4U0CA 2LPKA 1M90Q 2GYKA 2XXMA 4U0EA 2JB0A 1K30A 1OR5A 2LIWA 2OARA 2VLOA 1UNKA 1GXGA 2JBGA 1KQSO 1NJIQ 2CQ8A 1VQLP 2MF4A 3CCRP 2MVVA 1GPJA 1M6NA 2L0QA 1MZ8A 1YJNP 2JQ4A 5HGMA 2JAZA 1K9MQ 1DV5A 4H2YC 3CE7A 2FQ2A 2AF8A 2KGEA 3DS4A 3DS1A 1EIAA 3CCUP 1IMPA 2L22A 1YI2P 3NY7B 1EMVA 3CC4P 1JJ2O 1VQ8P 2XT1A 4BPGA 2FVEA 4U0DA 2KG9A 3WBHA 2MR8A 1VQ7P 3NTEA 1N8RQ 2LTEA 2L9FA 4U0AA 4R0MA 1RO0A 2LL8A 2KOQA 3CCSP 2JGPA 1D1DA 2M8NA 1Z6MA 2M8PA 1VQ4P 3E2DA 3U43A 3B5IA 4UHPB 2FHSC 2OTJP 2DGYA 3CCVP 2OTLP 3RG6C 2FQ0A 2FVFA 2N6YA 2LIUA 1GXHA 2LMLA 1QRJA 2P9XA 5KP6B 1VQKP 3RG2A 4IZ6A 2MD9A 2GDWA 5F2KA 1ACPA 2N5HA 1VQOP 3CXCO 3CMEP 3MGEA 2M5RA 4GR2A 1VQPP 1HY8A 2K0DX 1VKUA 4WYMA 1AF8A 1KD1Q 5EJDA 1S72P 1KLPA 2N6ZA 1Q7YQ 3G29A 1A8OA 2EHTA 2KOSA 5F2NA 2FAEA 2PEIA 2ERHA 1IMQA 3G1IA 2ROQA 2PEJA 2VLNA 4PH0A 2LF4A 5EW5E 5KP8B 1AUMA 1BXIA 1E6JP 2JU2A 3I56P 1VQ6P 2VSQA 3VRLC 2QEXP 3DS3A 1CEIA 3GZMA 5HGLA 2Z46A 3GZLA 4H2WC 2M8LA 4XFYA 1UJZA 1L0HA 2K92A 2N98A 3CC7P 1VQ9P 1VQ5P 3OW2O 1YHQP 4CA3A 1VQMP 4QNBA 1DNYA 1YJWP 2MY5A 4XFZA 2GDXA 1RNIA 2KGDA 2EIAA 2PEMA 2AFEA 5HV8A 3CCMP 4IPYA 1A43A 2AFDA 1RO2A 3CPWO 1YJ9P 4QKOA 1K8AQ 1Q81Q 2EG5A 4U0FA 3CCEP 1ZNVA 3M1MA 4BPFA 1W2BO 2MR7A
chains in the Genus database with same CATH topology
3EJBA 2M5RA 2CG5B 3EJEA 1HY8A 1VKUA 2LOLA 1AF8A 5KP7B 5EJDA 1L0IA 1KLPA 2N6ZA 2CQ8A 2MF4A 2MVVA 2MVUA 2KOOA 2EHTA 2L0QA 2KOSA 5HVCA 2KG6A 2FAEA 2JQ4A 2ROQA 1DV5A 4H2YC 4PXHB 1NQ4A 3CE7A 3LMOA 2FQ2A 2AF8A 2DNWA 2GDYA 2KGEA 5KP8B 2FACA 2CNRA 2L22A 2N50A 3NY7B 2LKIA 4PWVB 2JU2A 2K93A 2K94A 4HKGA 4BPGA 2VSQA 2FVEA 3EJDA 2N5IA 4DG9A 2KG8A 2KG9A 3GZMA 2PNGA 2MR8A 1F80D 2CGQA 3GZLA 4H2WC 2K0YA 2LTEA 2L9FA 4R0MA 1X3OA 2K0XA 2AVAA 2LL8A 2KOQA 2JGPA 2KOPA 1L0HA 2QNWA 2K92A 2N98A 2X2BA 2L4BA 2KGCA 4MRTC 4BPHA 4CA3A 2FHSC 4NEOA 1HQBA 1DNYA 2FQ0A 2MY5A 2FVFA 2XZ1C 5CZDB 2N6YA 2GDXA 2LIUA 2KW2A 4H2XC 2KGDA 2LMLA 2FQ1A 2KR5A 5HV8A 2AFEA 2JU1A 5KP6B 3RG2A 4IZ6A 2AFDA 2MD9A 2GDWA 2KORA 2XZ0D 2LPKA 2FADA 2FVAA 4BPFA 2EHSA 1ACPA 2MR7A 2N5HA 2KWLA 1T8KA 2K2QA 1OR5A 2LIWA 2KGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJB A;  2M5R A;  2CG5 B;  3EJE A;  1HY8 A;  1VKU A;  2LOL A;  1AF8 A;  5KP7 B;  5EJD A;  1L0I A;  1KLP A;  2N6Z A;  2CQ8 A;  2MF4 A;  2MVV A;  2MVU A;  2KOO A;  2EHT A;  2L0Q A;  2KOS A;  5HVC A;  2KG6 A;  2FAE A;  2JQ4 A;  2ROQ A;  1DV5 A;  4H2Y C;  4PXH B;  1NQ4 A;  3CE7 A;  3LMO A;  2FQ2 A;  2AF8 A;  2DNW A;  2GDY A;  2KGE A;  5KP8 B;  2FAC A;  2CNR A;  2L22 A;  2N50 A;  3NY7 B;  2LKI A;  4PWV B;  2JU2 A;  2K93 A;  2K94 A;  4HKG A;  4BPG A;  2VSQ A;  2FVE A;  3EJD A;  2N5I A;  4DG9 A;  2KG8 A;  2KG9 A;  3GZM A;  2PNG A;  2MR8 A;  1F80 D;  2CGQ A;  3GZL A;  4H2W C;  2K0Y A;  2LTE A;  2L9F A;  4R0M A;  1X3O A;  2K0X A;  2AVA A;  2LL8 A;  2KOQ A;  2JGP A;  2KOP A;  1L0H A;  2QNW A;  2K92 A;  2N98 A;  2X2B A;  2L4B A;  2KGC A;  4MRT C;  4BPH A;  4CA3 A;  2FHS C;  4NEO A;  1HQB A;  1DNY A;  2FQ0 A;  2MY5 A;  2FVF A;  2XZ1 C;  5CZD B;  2N6Y A;  2GDX A;  2LIU A;  2KW2 A;  4H2X C;  2KGD A;  2LML A;  2FQ1 A;  2KR5 A;  5HV8 A;  2AFE A;  2JU1 A;  5KP6 B;  3RG2 A;  4IZ6 A;  2AFD A;  2MD9 A;  2GDW A;  2KOR A;  2XZ0 D;  2LPK A;  2FAD A;  2FVA A;  4BPF A;  2EHS A;  1ACP A;  2MR7 A;  2N5H A;  2KWL A;  1T8K A;  2K2Q A;  1OR5 A;  2LIW A;  2KGA A; 
#chains in the Genus database with same CATH topology
 1YIT P;  1KC8 Q;  3EJE A;  2JO0 A;  2LOL A;  1L0I A;  2KOD A;  1EOQ A;  2MVU A;  2KOO A;  2VLQ A;  3G71 P;  4XFX A;  2KG6 A;  3Q20 A;  3P05 A;  4PXH B;  1NQ4 A;  3DS0 A;  3LMO A;  2PEO A;  3CCL P;  3G21 A;  5BS1 A;  3G6E P;  1E0H A;  3G28 A;  4COC A;  2K93 A;  2K94 A;  1M1K Q;  3EJD A;  2PNG A;  1QVF O;  1F80 D;  2PY8 A;  5HGO A;  3G0V A;  2CGQ A;  1M74 A;  2Z45 A;  2PEQ A;  1BAJ A;  2AVA A;  2CWO A;  2JYL A;  2QNW A;  5DCK A;  2NO8 A;  1YIJ P;  1ZMB A;  2X2B A;  2KGC A;  4MRT C;  4BPH A;  3H0D A;  3DS2 A;  1IUQ A;  5CZD B;  2E1M A;  1Q86 Q;  1AYI A;  2FQ1 A;  2GZG A;  3CD6 P;  2KR5 A;  4XRO A;  3H4E A;  2EFJ A;  2GZI A;  3DS5 A;  4PH1 A;  5I4T G;  2KOR A;  2XZ0 D;  3B4Q A;  2Z44 A;  2FAD A;  2L6E A;  2FVA A;  2ONT A;  1VHN A;  2EHS A;  2KWL A;  1T8K A;  2K2Q A;  4COP A;  3CCJ P;  2KGA A;  3EJB A;  3G26 A;  3GJN A;  4M0I A;  2CG5 B;  3DTJ A;  4U0B A;  3DPH A;  5KP7 B;  1M6E X;  3HZQ A;  3LRY A;  5JPA A;  5HVC A;  1Q82 Q;  2VLP A;  2WPT A;  3CC2 P;  7CEI A;  2GDY A;  2DNW A;  2FAC A;  2CNR A;  3H47 A;  2BUO A;  2N50 A;  3GKL C;  2LKI A;  4PWV B;  5HGN A;  3G1G A;  4HKG A;  2K5X A;  2N5I A;  4DG9 A;  2KG8 A;  3HYB A;  3CMA P;  1K73 Q;  2K0Y A;  1X3O A;  2K0X A;  1FR2 A;  2PEN A;  3I55 P;  2GZJ A;  4XRQ A;  1VQN P;  2KOP A;  4GR6 A;  5F2O A;  1QVG O;  2L4B A;  2GZE A;  4NEO A;  4F37 A;  2BHV A;  2XV6 A;  1HQB A;  2PEK A;  2JYG A;  2XZ1 C;  2GZF A;  2KW2 A;  4H2X C;  3G4S P;  2QA4 P;  3CCQ P;  2JU1 A;  5BS2 A;  4U0C A;  2LPK A;  1M90 Q;  2GYK A;  2XXM A;  4U0E A;  2JB0 A;  1K30 A;  1OR5 A;  2LIW A;  2OAR A;  2VLO A;  1UNK A;  1GXG A;  2JBG A;  1KQS O;  1NJI Q;  2CQ8 A;  1VQL P;  2MF4 A;  3CCR P;  2MVV A;  1GPJ A;  1M6N A;  2L0Q A;  1MZ8 A;  1YJN P;  2JQ4 A;  5HGM A;  2JAZ A;  1K9M Q;  1DV5 A;  4H2Y C;  3CE7 A;  2FQ2 A;  2AF8 A;  2KGE A;  3DS4 A;  3DS1 A;  1EIA A;  3CCU P;  1IMP A;  2L22 A;  1YI2 P;  3NY7 B;  1EMV A;  3CC4 P;  1JJ2 O;  1VQ8 P;  2XT1 A;  4BPG A;  2FVE A;  4U0D A;  2KG9 A;  3WBH A;  2MR8 A;  1VQ7 P;  3NTE A;  1N8R Q;  2LTE A;  2L9F A;  4U0A A;  4R0M A;  1RO0 A;  2LL8 A;  2KOQ A;  3CCS P;  2JGP A;  1D1D A;  2M8N A;  1Z6M A;  2M8P A;  1VQ4 P;  3E2D A;  3U43 A;  3B5I A;  4UHP B;  2FHS C;  2OTJ P;  2DGY A;  3CCV P;  2OTL P;  3RG6 C;  2FQ0 A;  2FVF A;  2N6Y A;  2LIU A;  1GXH A;  2LML A;  1QRJ A;  2P9X A;  5KP6 B;  1VQK P;  3RG2 A;  4IZ6 A;  2MD9 A;  2GDW A;  5F2K A;  1ACP A;  2N5H A;  1VQO P;  3CXC O;  3CME P;  3MGE A;  2M5R A;  4GR2 A;  1VQP P;  1HY8 A;  2K0D X;  1VKU A;  4WYM A;  1AF8 A;  1KD1 Q;  5EJD A;  1S72 P;  1KLP A;  2N6Z A;  1Q7Y Q;  3G29 A;  1A8O A;  2EHT A;  2KOS A;  5F2N A;  2FAE A;  2PEI A;  2ERH A;  1IMQ A;  3G1I A;  2ROQ A;  2PEJ A;  2VLN A;  4PH0 A;  2LF4 A;  5EW5 E;  5KP8 B;  1AUM A;  1BXI A;  1E6J P;  2JU2 A;  3I56 P;  1VQ6 P;  2VSQ A;  3VRL C;  2QEX P;  3DS3 A;  1CEI A;  3GZM A;  5HGL A;  2Z46 A;  3GZL A;  4H2W C;  2M8L A;  4XFY A;  1UJZ A;  1L0H A;  2K92 A;  2N98 A;  3CC7 P;  1VQ9 P;  1VQ5 P;  3OW2 O;  1YHQ P;  4CA3 A;  1VQM P;  4QNB A;  1DNY A;  1YJW P;  2MY5 A;  4XFZ A;  2GDX A;  1RNI A;  2KGD A;  2EIA A;  2PEM A;  2AFE A;  5HV8 A;  3CCM P;  4IPY A;  1A43 A;  2AFD A;  1RO2 A;  3CPW O;  1YJ9 P;  4QKO A;  1K8A Q;  1Q81 Q;  2EG5 A;  4U0F A;  3CCE P;  1ZNV A;  3M1M A;  4BPF A;  1W2B O;  2MR7 A; 
#chains in the Genus database with same CATH homology
 3EJB A;  2M5R A;  2CG5 B;  3EJE A;  1HY8 A;  1VKU A;  2LOL A;  1AF8 A;  5KP7 B;  5EJD A;  1L0I A;  1KLP A;  2N6Z A;  2CQ8 A;  2MF4 A;  2MVV A;  2MVU A;  2KOO A;  2EHT A;  2L0Q A;  2KOS A;  5HVC A;  2KG6 A;  2FAE A;  2JQ4 A;  2ROQ A;  1DV5 A;  4H2Y C;  4PXH B;  1NQ4 A;  3CE7 A;  3LMO A;  2FQ2 A;  2AF8 A;  2DNW A;  2GDY A;  2KGE A;  5KP8 B;  2FAC A;  2CNR A;  2L22 A;  2N50 A;  3NY7 B;  2LKI A;  4PWV B;  2JU2 A;  2K93 A;  2K94 A;  4HKG A;  4BPG A;  2VSQ A;  2FVE A;  3EJD A;  2N5I A;  4DG9 A;  2KG8 A;  2KG9 A;  3GZM A;  2PNG A;  2MR8 A;  1F80 D;  2CGQ A;  3GZL A;  4H2W C;  2K0Y A;  2LTE A;  2L9F A;  4R0M A;  1X3O A;  2K0X A;  2AVA A;  2LL8 A;  2KOQ A;  2JGP A;  2KOP A;  1L0H A;  2QNW A;  2K92 A;  2N98 A;  2X2B A;  2L4B A;  2KGC A;  4MRT C;  4BPH A;  4CA3 A;  2FHS C;  4NEO A;  1HQB A;  1DNY A;  2FQ0 A;  2MY5 A;  2FVF A;  2XZ1 C;  5CZD B;  2N6Y A;  2GDX A;  2LIU A;  2KW2 A;  4H2X C;  2KGD A;  2LML A;  2FQ1 A;  2KR5 A;  5HV8 A;  2AFE A;  2JU1 A;  5KP6 B;  3RG2 A;  4IZ6 A;  2AFD A;  2MD9 A;  2GDW A;  2KOR A;  2XZ0 D;  2LPK A;  2FAD A;  2FVA A;  4BPF A;  2EHS A;  1ACP A;  2MR7 A;  2N5H A;  2KWL A;  1T8K A;  2K2Q A;  1OR5 A;  2LIW A;  2KGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...