3RG6C

Crystal structure of a chaperone-bound assembly intermediate of form i rubisco
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLALWLHNFSAGKVQDGEKYIEELFLEKPDLALRIMTVREHIAEEIAEFLPEMVVTGIQQANMEKRRQHLERMTQVSLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Photosynthesis
molecule keywords Ribulose bisphosphate carboxylase large chain
total genus 37
structure length 115
sequence length 115
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3rg6C00
2PENA 5BS2A 4GR6A 2PEOA 2PY8A 2Z44A 4GR2A 5BS1A 2PEQA 2PEMA 3Q20A 3RG6C 2PEKA 2PEIA 2Z45A 2Z46A 2PEJA 3HYBA
chains in the Genus database with same CATH superfamily
1IUQA 1RO2A 2PEOA 1YIJP 2K5XA 2MR8A 2MF4A 2GZFA 2GZIA 2KGEA 5KP8B 2L6EA 2ROQA 4XFXA 3NTEA 1NQ4A 2QA4P 1CEIA 2KODA 1T8KA 2LKIA 2PEQA 1Z6MA 1YHQP 3H4EA 2MY5A 1M6NA 3CC4P 4U0FA 3EJDA 1ACPA 3DS2A 2AFEA 2CQ8A 4BPHA 2KOOA 2FHSC 3LMOA 4GR2A 4IPYA 2PNGA 3U43A 3G6EP 3G29A 2Z46A 1YITP 3CCEP 4H2XC 2PY8A 2FQ2A 2M8PA 4XROA 1VQ8P 1KQSO 1VQ7P 2LIUA 5CZDB 3RG6C 2EFJA 2K0DX 4PWVB 5EJDA 2VLPA 1ZNVA 1N8RQ 2WPTA 2FVFA 5KP6B 1IMQA 3G1GA 1QVFO 3GZLA 4HKGA 4WYMA 2N6ZA 1K30A 4UHPB 1VQPP 1D1DA 2KGDA 2LOLA 2ONTA 3I56P 4U0AA 2KOPA 3NY7B 1K9MQ 2FADA 2XT1A 2JQ4A 3M1MA 2JBGA 1DNYA 3CCQP 1AF8A 1L0HA 5BS1A 1K8AQ 3CPWO 2PEJA 2JYLA 1YJ9P 1VQLP 4BPGA 2LL8A 1EIAA 5HGNA 1M74A 4CA3A 2EIAA 1AYIA 2MVVA 3HZQA 4H2WC 1KD1Q 1FR2A 1YI2P 2JB0A 1VQ4P 3CCLP 1OR5A 2N5IA 1VQOP 5HV8A 1Q7YQ 1VQ9P 3WBHA 2MR7A 2K93A 3EJEA 2GYKA 1BXIA 3B5IA 3DS0A 3E2DA 2K0YA 1KC8Q 2DGYA 1VQKP 3CXCO 2FVAA 2K2QA 2KG8A 2FQ0A 2L0QA 2LMLA 1JJ2O 3GZMA 2N98A 2GZJA 3G1IA 3GKLC 3CCUP 2KG6A 2JYGA 5F2NA 1GXGA 2Z44A 3HYBA 2OTLP 1RNIA 1E0HA 2LF4A 4H2YC 2FACA 1VHNA 1A8OA 2CG5B 1X3OA 2QEXP 3RG2A 1K73Q 2PEIA 3DS4A 5KP7B 4M0IA 3DS3A 4U0EA 2E1MA 3H47A 3G21A 1EMVA 1GPJA 2FAEA 3GJNA 5I4TG 4XFZA 3G4SP 4PH0A 2KGAA 2QNWA 5HGMA 2KOQA 2JU1A 2X2BA 1QVGO 2XZ0D 1HY8A 1ZMBA 2VSQA 2JU2A 5HGLA 1L0IA 1BAJA 2GZGA 2BUOA 1QRJA 3CE7A 2XV6A 2AVAA 2KORA 3CC7P 2JAZA 2GZEA 3G28A 3CC2P 4DG9A 4COCA 2VLOA 1M90Q 2GDYA 5JPAA 4BPFA 2M8NA 2LIWA 3CCJP 3OW2O 1GXHA 2OARA 2EHTA 3MGEA 3VRLC 4U0BA 3DTJA 3G26A 1W2BO 3CCRP 1VQNP 3CD6P 4PXHB 2JO0A 2NO8A 5F2KA 2PEMA 2L4BA 2KGCA 4COPA 3CCMP 1VKUA 1F80D 2JGPA 2ERHA 1Q81Q 2M5RA 1VQ6P 1MZ8A 3CCSP 2K92A 2VLNA 2CGQA 4XRQA 1E6JP 2EHSA 2CWOA 2CNRA 2DNWA 2GDXA 2AFDA 2EG5A 3G0VA 2PENA 2L22A 3Q20A 2KWLA 1VQMP 2OTJP 1NJIQ 2LTEA 2K0XA 4F37A 5EW5E 3CCVP 3DPHA 2AF8A 2MVUA 5HGOA 1EOQA 1DV5A 1IMPA 1HQBA 1A43A 4R0MA 1UNKA 2KOSA 3I55P 1Q82Q 4U0CA 3H0DA 2L9FA 7CEIA 3CMAP 1KLPA 4XFYA 1M6EX 3EJBA 2N50A 5DCKA 2Z45A 5HVCA 1UJZA 1YJNP 3G71P 1VQ5P 2GDWA 2KW2A 2FVEA 3DS1A 2M8LA 3LRYA 2KR5A 2N5HA 1Q86Q 2MD9A 4QKOA 2P9XA 2K94A 4U0DA 4MRTC 2XZ1C 1S72P 1AUMA 2LPKA 4IZ6A 4GR6A 1M1KQ 2BHVA 4NEOA 5BS2A 5F2OA 2VLQA 2KG9A 4QNBA 1YJWP 1RO0A 3DS5A 3P05A 2N6YA 2FQ1A 3CMEP 3B4QA 4PH1A 2XXMA 2PEKA
chains in the Genus database with same CATH topology
1E6JP 1IUQA 2QEXP 1K73Q 1RO2A 2ONTA 3I56P 2PEOA 4U0AA 1YIJP 2CWOA 2PEIA 3DS4A 1K9MQ 2XT1A 4M0IA 2EG5A 3DS3A 2L6EA 3G0VA 3M1MA 4U0EA 2E1MA 3H47A 4XFXA 2PENA 3CCQP 3G21A 3NTEA 2QA4P 3Q20A 1VQMP 2OTJP 5I4TG 4XFZA 3G4SP 4PH0A 2KODA 1NJIQ 5HGMA 5BS1A 1K8AQ 3CPWO 2PEJA 1QVGO 2JYLA 1ZMBA 1YJ9P 1VQLP 5HGLA 2PEQA 1EIAA 3CCVP 1BAJA 5HGNA 2BUOA 1QRJA 3DPHA 3H4EA 1YHQP 1M74A 2XV6A 2EIAA 3CC7P 5HGOA 3HZQA 1M6NA 3CC4P 1KD1Q 1EOQA 4U0FA 1YI2P 3G28A 3CC2P 1VQ4P 1A43A 4COCA 3DS2A 1M90Q 3I55P 3CCLP 1Q82Q 5JPAA 1VQOP 4U0CA 1Q7YQ 4GR2A 4IPYA 3H0DA 1VQ9P 3CMAP 3G6EP 3WBHA 2M8NA 3G29A 3CCJP 2Z46A 1YITP 3CCEP 3OW2O 4XFYA 1M6EX 2PY8A 2OARA 3B5IA 5DCKA 2Z45A 3DS0A 3E2DA 3MGEA 2M8PA 4XROA 3VRLC 1VQ8P 1YJNP 3G71P 1VQ5P 1KQSO 1VQ7P 4U0BA 3DTJA 3G26A 1KC8Q 3DS1A 2DGYA 2M8LA 3RG6C 1VQKP 3CXCO 3LRYA 1W2BO 1Q86Q 2EFJA 2P9XA 3CCRP 1VQNP 1A8OA 1N8RQ 3CD6P 4U0DA 2JO0A 1JJ2O 5F2KA 2PEMA 1S72P 1AUMA 4COPA 3G1IA 3CCMP 3G1GA 1QVFO 4GR6A 1M1KQ 2BHVA 4WYMA 3CCUP 2JYGA 5F2NA 2Z44A 2OTLP 3HYBA 1K30A 1RNIA 1Q81Q 5BS2A 5F2OA 1VQ6P 2LF4A 4QNBA 1VQPP 1YJWP 1D1DA 1RO0A 3DS5A 3CCSP 3P05A 3CMEP 4PH1A 2XXMA 2PEKA 4XRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEN A;  5BS2 A;  4GR6 A;  2PEO A;  2PY8 A;  2Z44 A;  4GR2 A;  5BS1 A;  2PEQ A;  2PEM A;  3Q20 A;  3RG6 C;  2PEK A;  2PEI A;  2Z45 A;  2Z46 A;  2PEJ A;  3HYB A; 
#chains in the Genus database with same CATH topology
 1IUQ A;  1RO2 A;  2PEO A;  1YIJ P;  2K5X A;  2MR8 A;  2MF4 A;  2GZF A;  2GZI A;  2KGE A;  5KP8 B;  2L6E A;  2ROQ A;  4XFX A;  3NTE A;  1NQ4 A;  2QA4 P;  1CEI A;  2KOD A;  1T8K A;  2LKI A;  2PEQ A;  1Z6M A;  1YHQ P;  3H4E A;  2MY5 A;  1M6N A;  3CC4 P;  4U0F A;  3EJD A;  1ACP A;  3DS2 A;  2AFE A;  2CQ8 A;  4BPH A;  2KOO A;  2FHS C;  3LMO A;  4GR2 A;  4IPY A;  2PNG A;  3U43 A;  3G6E P;  3G29 A;  2Z46 A;  1YIT P;  3CCE P;  4H2X C;  2PY8 A;  2FQ2 A;  2M8P A;  4XRO A;  1VQ8 P;  1KQS O;  1VQ7 P;  2LIU A;  5CZD B;  3RG6 C;  2EFJ A;  2K0D X;  4PWV B;  5EJD A;  2VLP A;  1ZNV A;  1N8R Q;  2WPT A;  2FVF A;  5KP6 B;  1IMQ A;  3G1G A;  1QVF O;  3GZL A;  4HKG A;  4WYM A;  2N6Z A;  1K30 A;  4UHP B;  1VQP P;  1D1D A;  2KGD A;  2LOL A;  2ONT A;  3I56 P;  4U0A A;  2KOP A;  3NY7 B;  1K9M Q;  2FAD A;  2XT1 A;  2JQ4 A;  3M1M A;  2JBG A;  1DNY A;  3CCQ P;  1AF8 A;  1L0H A;  5BS1 A;  1K8A Q;  3CPW O;  2PEJ A;  2JYL A;  1YJ9 P;  1VQL P;  4BPG A;  2LL8 A;  1EIA A;  5HGN A;  1M74 A;  4CA3 A;  2EIA A;  1AYI A;  2MVV A;  3HZQ A;  4H2W C;  1KD1 Q;  1FR2 A;  1YI2 P;  2JB0 A;  1VQ4 P;  3CCL P;  1OR5 A;  2N5I A;  1VQO P;  5HV8 A;  1Q7Y Q;  1VQ9 P;  3WBH A;  2MR7 A;  2K93 A;  3EJE A;  2GYK A;  1BXI A;  3B5I A;  3DS0 A;  3E2D A;  2K0Y A;  1KC8 Q;  2DGY A;  1VQK P;  3CXC O;  2FVA A;  2K2Q A;  2KG8 A;  2FQ0 A;  2L0Q A;  2LML A;  1JJ2 O;  3GZM A;  2N98 A;  2GZJ A;  3G1I A;  3GKL C;  3CCU P;  2KG6 A;  2JYG A;  5F2N A;  1GXG A;  2Z44 A;  3HYB A;  2OTL P;  1RNI A;  1E0H A;  2LF4 A;  4H2Y C;  2FAC A;  1VHN A;  1A8O A;  2CG5 B;  1X3O A;  2QEX P;  3RG2 A;  1K73 Q;  2PEI A;  3DS4 A;  5KP7 B;  4M0I A;  3DS3 A;  4U0E A;  2E1M A;  3H47 A;  3G21 A;  1EMV A;  1GPJ A;  2FAE A;  3GJN A;  5I4T G;  4XFZ A;  3G4S P;  4PH0 A;  2KGA A;  2QNW A;  5HGM A;  2KOQ A;  2JU1 A;  2X2B A;  1QVG O;  2XZ0 D;  1HY8 A;  1ZMB A;  2VSQ A;  2JU2 A;  5HGL A;  1L0I A;  1BAJ A;  2GZG A;  2BUO A;  1QRJ A;  3CE7 A;  2XV6 A;  2AVA A;  2KOR A;  3CC7 P;  2JAZ A;  2GZE A;  3G28 A;  3CC2 P;  4DG9 A;  4COC A;  2VLO A;  1M90 Q;  2GDY A;  5JPA A;  4BPF A;  2M8N A;  2LIW A;  3CCJ P;  3OW2 O;  1GXH A;  2OAR A;  2EHT A;  3MGE A;  3VRL C;  4U0B A;  3DTJ A;  3G26 A;  1W2B O;  3CCR P;  1VQN P;  3CD6 P;  4PXH B;  2JO0 A;  2NO8 A;  5F2K A;  2PEM A;  2L4B A;  2KGC A;  4COP A;  3CCM P;  1VKU A;  1F80 D;  2JGP A;  2ERH A;  1Q81 Q;  2M5R A;  1VQ6 P;  1MZ8 A;  3CCS P;  2K92 A;  2VLN A;  2CGQ A;  4XRQ A;  1E6J P;  2EHS A;  2CWO A;  2CNR A;  2DNW A;  2GDX A;  2AFD A;  2EG5 A;  3G0V A;  2PEN A;  2L22 A;  3Q20 A;  2KWL A;  1VQM P;  2OTJ P;  1NJI Q;  2LTE A;  2K0X A;  4F37 A;  5EW5 E;  3CCV P;  3DPH A;  2AF8 A;  2MVU A;  5HGO A;  1EOQ A;  1DV5 A;  1IMP A;  1HQB A;  1A43 A;  4R0M A;  1UNK A;  2KOS A;  3I55 P;  1Q82 Q;  4U0C A;  3H0D A;  2L9F A;  7CEI A;  3CMA P;  1KLP A;  4XFY A;  1M6E X;  3EJB A;  2N50 A;  5DCK A;  2Z45 A;  5HVC A;  1UJZ A;  1YJN P;  3G71 P;  1VQ5 P;  2GDW A;  2KW2 A;  2FVE A;  3DS1 A;  2M8L A;  3LRY A;  2KR5 A;  2N5H A;  1Q86 Q;  2MD9 A;  4QKO A;  2P9X A;  2K94 A;  4U0D A;  4MRT C;  2XZ1 C;  1S72 P;  1AUM A;  2LPK A;  4IZ6 A;  4GR6 A;  1M1K Q;  2BHV A;  4NEO A;  5BS2 A;  5F2O A;  2VLQ A;  2KG9 A;  4QNB A;  1YJW P;  1RO0 A;  3DS5 A;  3P05 A;  2N6Y A;  2FQ1 A;  3CME P;  3B4Q A;  4PH1 A;  2XXM A;  2PEK A; 
#chains in the Genus database with same CATH homology
 1E6J P;  1IUQ A;  2QEX P;  1K73 Q;  1RO2 A;  2ONT A;  3I56 P;  2PEO A;  4U0A A;  1YIJ P;  2CWO A;  2PEI A;  3DS4 A;  1K9M Q;  2XT1 A;  4M0I A;  2EG5 A;  3DS3 A;  2L6E A;  3G0V A;  3M1M A;  4U0E A;  2E1M A;  3H47 A;  4XFX A;  2PEN A;  3CCQ P;  3G21 A;  3NTE A;  2QA4 P;  3Q20 A;  1VQM P;  2OTJ P;  5I4T G;  4XFZ A;  3G4S P;  4PH0 A;  2KOD A;  1NJI Q;  5HGM A;  5BS1 A;  1K8A Q;  3CPW O;  2PEJ A;  1QVG O;  2JYL A;  1ZMB A;  1YJ9 P;  1VQL P;  5HGL A;  2PEQ A;  1EIA A;  3CCV P;  1BAJ A;  5HGN A;  2BUO A;  1QRJ A;  3DPH A;  3H4E A;  1YHQ P;  1M74 A;  2XV6 A;  2EIA A;  3CC7 P;  5HGO A;  3HZQ A;  1M6N A;  3CC4 P;  1KD1 Q;  1EOQ A;  4U0F A;  1YI2 P;  3G28 A;  3CC2 P;  1VQ4 P;  1A43 A;  4COC A;  3DS2 A;  1M90 Q;  3I55 P;  3CCL P;  1Q82 Q;  5JPA A;  1VQO P;  4U0C A;  1Q7Y Q;  4GR2 A;  4IPY A;  3H0D A;  1VQ9 P;  3CMA P;  3G6E P;  3WBH A;  2M8N A;  3G29 A;  3CCJ P;  2Z46 A;  1YIT P;  3CCE P;  3OW2 O;  4XFY A;  1M6E X;  2PY8 A;  2OAR A;  3B5I A;  5DCK A;  2Z45 A;  3DS0 A;  3E2D A;  3MGE A;  2M8P A;  4XRO A;  3VRL C;  1VQ8 P;  1YJN P;  3G71 P;  1VQ5 P;  1KQS O;  1VQ7 P;  4U0B A;  3DTJ A;  3G26 A;  1KC8 Q;  3DS1 A;  2DGY A;  2M8L A;  3RG6 C;  1VQK P;  3CXC O;  3LRY A;  1W2B O;  1Q86 Q;  2EFJ A;  2P9X A;  3CCR P;  1VQN P;  1A8O A;  1N8R Q;  3CD6 P;  4U0D A;  2JO0 A;  1JJ2 O;  5F2K A;  2PEM A;  1S72 P;  1AUM A;  4COP A;  3G1I A;  3CCM P;  3G1G A;  1QVF O;  4GR6 A;  1M1K Q;  2BHV A;  4WYM A;  3CCU P;  2JYG A;  5F2N A;  2Z44 A;  2OTL P;  3HYB A;  1K30 A;  1RNI A;  1Q81 Q;  5BS2 A;  5F2O A;  1VQ6 P;  2LF4 A;  4QNB A;  1VQP P;  1YJW P;  1D1D A;  1RO0 A;  3DS5 A;  3CCS P;  3P05 A;  3CME P;  4PH1 A;  2XXM A;  2PEK A;  4XRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...