3RG6C

Crystal structure of a chaperone-bound assembly intermediate of form i rubisco
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLALWLHNFSAGKVQDGEKYIEELFLEKPDLALRIMTVREHIAEEIAEFLPEMVVTGIQQANMEKRRQHLERMTQVSLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Photosynthesis
molecule keywords Ribulose bisphosphate carboxylase large chain
total genus 37
structure length 115
sequence length 115
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3rg6C00
3Q20A 2PEKA 2PENA 2Z45A 5BS2A 2Z46A 2PEMA 3HYBA 3RG6C 4GR6A 2PEIA 2PEOA 2PY8A 5BS1A 2Z44A 2PEQA 2PEJA 4GR2A
chains in the Genus database with same CATH superfamily
2LIUA 5HGMA 2BUOA 3CCRP 1YI2P 2LPKA 2VLPA 3I56P 2XZ0D 2M8LA 1KQSO 2XZ1C 1VQ4P 3LRYA 2K0DX 2JYLA 4IPYA 5HV8A 1K73Q 2BHVA 2FVFA 1YJWP 1QVGO 1A43A 2LKIA 2JB0A 3G26A 4PWVB 4DG9A 2EHTA 2GZGA 2JU1A 1YITP 3B4QA 3CCQP 4U0BA 4XFZA 1QRJA 3RG6C 2KGCA 4QNBA 4XFXA 3G21A 3Q20A 1IMQA 7CEIA 3CC7P 3CD6P 1CEIA 1YJ9P 4XROA 2JQ4A 4R0MA 1N8RQ 1M90Q 2K0XA 2N6ZA 1F80D 2PEOA 4CA3A 1AYIA 4F37A 4GR2A 2FVEA 2CG5B 3CC2P 1L0IA 2FQ2A 2FAEA 2CNRA 2EHSA 2K5XA 2GYKA 1HY8A 4H2WC 2JAZA 4U0FA 2JYGA 1YIJP 1E0HA 1UJZA 1UNKA 4XFYA 3B5IA 1YHQP 2AFEA 2LL8A 2K0YA 2PEIA 1M1KQ 3HZQA 2QNWA 2Z44A 2K2QA 4BPHA 3DS1A 1HQBA 1KLPA 3G0VA 1FR2A 3E2DA 5KP8B 2P9XA 2GZEA 1DNYA 2MR8A 2NO8A 1Q82Q 5DCKA 3MGEA 1RO2A 3DS2A 2AF8A 2JU2A 3CCSP 2PEKA 2MY5A 4PH0A 1VKUA 3GJNA 1ACPA 2KGAA 2KG8A 4H2XC 1M74A 1VHNA 2M8NA 3DS3A 2ONTA 3CCMP 1NQ4A 3G6EP 5HVCA 3CMAP 3EJBA 1S72P 2KWLA 3NY7B 1Q81Q 2MD9A 2L0QA 3H0DA 3OW2O 1M6EX 2AVAA 3G29A 1Q7YQ 2Z46A 2N98A 2FHSC 2PEJA 2MR7A 1VQKP 4GR6A 3GKLC 1BAJA 2CGQA 2FACA 1VQ6P 5BS1A 2FVAA 3U43A 1IUQA 4QKOA 1OR5A 3DS4A 5CZDB 2FADA 3G4SP 3DS0A 3CCLP 2FQ0A 5HGOA 2LIWA 2XXMA 2DGYA 5F2NA 4U0DA 3HYBA 3CPWO 1GPJA 2XT1A 1VQ7P 1ZNVA 2AFDA 2WPTA 2LOLA 3H4EA 1JJ2O 1GXGA 4HKGA 2GZIA 1K8AQ 2E1MA 1NJIQ 2OTLP 3DTJA 2VLNA 2L22A 1KC8Q 4BPGA 4PH1A 2EG5A 2L4BA 3G71P 1EIAA 2PEQA 2LTEA 4COCA 4U0AA 2N50A 4M0IA 1K9MQ 2GZJA 4H2YC 4U0EA 4XRQA 4UHPB 1BXIA 2X2BA 5F2OA 2PNGA 1Z6MA 2N5HA 5KP7B 2K93A 2KODA 2LF4A 2ROQA 2VSQA 2KW2A 1E6JP 2KOOA 1VQ9P 4COPA 4U0CA 5EJDA 1RO0A 2MVUA 3CCEP 4IZ6A 3VRLC 2KORA 3G28A 2L9FA 3CCUP 1QVFO 1RNIA 2GDYA 1D1DA 1L0HA 1M6NA 4PXHB 3P05A 3CCVP 1MZ8A 1IMPA 2OTJP 4BPFA 2JGPA 2GDXA 3EJEA 2KGEA 2N6YA 1VQNP 5EW5E 2CQ8A 1KD1Q 1X3OA 2QEXP 2K94A 2LMLA 1VQ8P 1VQPP 2OARA 4WYMA 2KR5A 3LMOA 2EIAA 1VQMP 3G1IA 2MF4A 3H47A 2MVVA 1W2BO 2KG6A 3CMEP 2JBGA 1DV5A 1ZMBA 4MRTC 2M8PA 2KOSA 3CCJP 1VQLP 2XV6A 3NTEA 1YJNP 2GZFA 5BS2A 5JPAA 1GXHA 4NEOA 1K30A 2DNWA 5I4TG 2Z45A 2VLQA 3M1MA 1VQ5P 1A8OA 2KOPA 2QA4P 3CC4P 2N5IA 1EOQA 1T8KA 3DPHA 3CXCO 2CWOA 2FQ1A 3DS5A 2KG9A 1VQOP 3I55P 1Q86Q 5KP6B 2GDWA 1AF8A 2PENA 5HGNA 2KOQA 2PEMA 2K92A 3WBHA 2PY8A 5HGLA 2KGDA 3RG2A 2JO0A 2VLOA 1EMVA 5F2KA 3EJDA 3GZMA 1AUMA 3GZLA 3G1GA 2ERHA 3CE7A 2EFJA 2M5RA 2L6EA
chains in the Genus database with same CATH topology
1M1KQ 3G4SP 3DS0A 1VQNP 3HZQA 5HGMA 3CCLP 5HGOA 2XXMA 2Z44A 2DGYA 2BUOA 5F2NA 3CCRP 1YI2P 4U0DA 3I56P 3HYBA 3CPWO 2XT1A 3DS1A 1VQ7P 2M8LA 1KD1Q 1KQSO 3G0VA 3E2DA 2P9XA 2QEXP 1VQ4P 1Q82Q 3MGEA 3H4EA 3LRYA 2JYLA 5DCKA 4IPYA 1JJ2O 1VQ8P 1RO2A 1VQPP 2OARA 1K73Q 2BHVA 3DS2A 1YJWP 4WYMA 1QVGO 1A43A 2E1MA 1K8AQ 1NJIQ 3CCSP 3G26A 2EIAA 1VQMP 2PEKA 3G1IA 2OTLP 3H47A 3DTJA 4PH0A 1KC8Q 1YITP 1W2BO 3CCQP 4PH1A 2EG5A 4U0BA 3G71P 1EIAA 3CMEP 2PEQA 4XFZA 1QRJA 4COCA 1ZMBA 2M8PA 3RG6C 4U0AA 4QNBA 3CCJP 4M0IA 1M74A 2XV6A 1VQLP 3NTEA 2M8NA 3G21A 4XFXA 1YJNP 3DS3A 3Q20A 1K9MQ 4U0EA 5BS2A 5JPAA 2ONTA 4XRQA 3CCMP 1K30A 3G6EP 5F2OA 5I4TG 3CC7P 3CD6P 2Z45A 1YJ9P 4XROA 3M1MA 3CMAP 2KODA 1VQ5P 1N8RQ 1M90Q 2LF4A 1S72P 1A8OA 2QA4P 2PEOA 3CC4P 1Q81Q 1E6JP 3H0DA 3OW2O 1M6EX 1EOQA 3G29A 4GR2A 1VQ9P 1Q7YQ 4COPA 3CC2P 2Z46A 3DPHA 3CXCO 4U0CA 1RO0A 2PEJA 2CWOA 3DS5A 1VQKP 4GR6A 3CCEP 1VQOP 3I55P 1Q86Q 2PENA 4U0FA 3VRLC 1BAJA 2JYGA 5HGNA 2PEMA 3G28A 1YIJP 3WBHA 2PY8A 1VQ6P 5BS1A 3CCUP 5HGLA 1QVFO 1RNIA 2JO0A 1D1DA 1M6NA 1IUQA 3P05A 5F2KA 3CCVP 4XFYA 3B5IA 2OTJP 3DS4A 1AUMA 1YHQP 3G1GA 2PEIA 2EFJA 2L6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q20 A;  2PEK A;  2PEN A;  2Z45 A;  5BS2 A;  2Z46 A;  2PEM A;  3HYB A;  3RG6 C;  4GR6 A;  2PEI A;  2PEO A;  2PY8 A;  5BS1 A;  2Z44 A;  2PEQ A;  2PEJ A;  4GR2 A; 
#chains in the Genus database with same CATH topology
 2LIU A;  5HGM A;  2BUO A;  3CCR P;  1YI2 P;  2LPK A;  2VLP A;  3I56 P;  2XZ0 D;  2M8L A;  1KQS O;  2XZ1 C;  1VQ4 P;  3LRY A;  2K0D X;  2JYL A;  4IPY A;  5HV8 A;  1K73 Q;  2BHV A;  2FVF A;  1YJW P;  1QVG O;  1A43 A;  2LKI A;  2JB0 A;  3G26 A;  4PWV B;  4DG9 A;  2EHT A;  2GZG A;  2JU1 A;  1YIT P;  3B4Q A;  3CCQ P;  4U0B A;  4XFZ A;  1QRJ A;  3RG6 C;  2KGC A;  4QNB A;  4XFX A;  3G21 A;  3Q20 A;  1IMQ A;  7CEI A;  3CC7 P;  3CD6 P;  1CEI A;  1YJ9 P;  4XRO A;  2JQ4 A;  4R0M A;  1N8R Q;  1M90 Q;  2K0X A;  2N6Z A;  1F80 D;  2PEO A;  4CA3 A;  1AYI A;  4F37 A;  4GR2 A;  2FVE A;  2CG5 B;  3CC2 P;  1L0I A;  2FQ2 A;  2FAE A;  2CNR A;  2EHS A;  2K5X A;  2GYK A;  1HY8 A;  4H2W C;  2JAZ A;  4U0F A;  2JYG A;  1YIJ P;  1E0H A;  1UJZ A;  1UNK A;  4XFY A;  3B5I A;  1YHQ P;  2AFE A;  2LL8 A;  2K0Y A;  2PEI A;  1M1K Q;  3HZQ A;  2QNW A;  2Z44 A;  2K2Q A;  4BPH A;  3DS1 A;  1HQB A;  1KLP A;  3G0V A;  1FR2 A;  3E2D A;  5KP8 B;  2P9X A;  2GZE A;  1DNY A;  2MR8 A;  2NO8 A;  1Q82 Q;  5DCK A;  3MGE A;  1RO2 A;  3DS2 A;  2AF8 A;  2JU2 A;  3CCS P;  2PEK A;  2MY5 A;  4PH0 A;  1VKU A;  3GJN A;  1ACP A;  2KGA A;  2KG8 A;  4H2X C;  1M74 A;  1VHN A;  2M8N A;  3DS3 A;  2ONT A;  3CCM P;  1NQ4 A;  3G6E P;  5HVC A;  3CMA P;  3EJB A;  1S72 P;  2KWL A;  3NY7 B;  1Q81 Q;  2MD9 A;  2L0Q A;  3H0D A;  3OW2 O;  1M6E X;  2AVA A;  3G29 A;  1Q7Y Q;  2Z46 A;  2N98 A;  2FHS C;  2PEJ A;  2MR7 A;  1VQK P;  4GR6 A;  3GKL C;  1BAJ A;  2CGQ A;  2FAC A;  1VQ6 P;  5BS1 A;  2FVA A;  3U43 A;  1IUQ A;  4QKO A;  1OR5 A;  3DS4 A;  5CZD B;  2FAD A;  3G4S P;  3DS0 A;  3CCL P;  2FQ0 A;  5HGO A;  2LIW A;  2XXM A;  2DGY A;  5F2N A;  4U0D A;  3HYB A;  3CPW O;  1GPJ A;  2XT1 A;  1VQ7 P;  1ZNV A;  2AFD A;  2WPT A;  2LOL A;  3H4E A;  1JJ2 O;  1GXG A;  4HKG A;  2GZI A;  1K8A Q;  2E1M A;  1NJI Q;  2OTL P;  3DTJ A;  2VLN A;  2L22 A;  1KC8 Q;  4BPG A;  4PH1 A;  2EG5 A;  2L4B A;  3G71 P;  1EIA A;  2PEQ A;  2LTE A;  4COC A;  4U0A A;  2N50 A;  4M0I A;  1K9M Q;  2GZJ A;  4H2Y C;  4U0E A;  4XRQ A;  4UHP B;  1BXI A;  2X2B A;  5F2O A;  2PNG A;  1Z6M A;  2N5H A;  5KP7 B;  2K93 A;  2KOD A;  2LF4 A;  2ROQ A;  2VSQ A;  2KW2 A;  1E6J P;  2KOO A;  1VQ9 P;  4COP A;  4U0C A;  5EJD A;  1RO0 A;  2MVU A;  3CCE P;  4IZ6 A;  3VRL C;  2KOR A;  3G28 A;  2L9F A;  3CCU P;  1QVF O;  1RNI A;  2GDY A;  1D1D A;  1L0H A;  1M6N A;  4PXH B;  3P05 A;  3CCV P;  1MZ8 A;  1IMP A;  2OTJ P;  4BPF A;  2JGP A;  2GDX A;  3EJE A;  2KGE A;  2N6Y A;  1VQN P;  5EW5 E;  2CQ8 A;  1KD1 Q;  1X3O A;  2QEX P;  2K94 A;  2LML A;  1VQ8 P;  1VQP P;  2OAR A;  4WYM A;  2KR5 A;  3LMO A;  2EIA A;  1VQM P;  3G1I A;  2MF4 A;  3H47 A;  2MVV A;  1W2B O;  2KG6 A;  3CME P;  2JBG A;  1DV5 A;  1ZMB A;  4MRT C;  2M8P A;  2KOS A;  3CCJ P;  1VQL P;  2XV6 A;  3NTE A;  1YJN P;  2GZF A;  5BS2 A;  5JPA A;  1GXH A;  4NEO A;  1K30 A;  2DNW A;  5I4T G;  2Z45 A;  2VLQ A;  3M1M A;  1VQ5 P;  1A8O A;  2KOP A;  2QA4 P;  3CC4 P;  2N5I A;  1EOQ A;  1T8K A;  3DPH A;  3CXC O;  2CWO A;  2FQ1 A;  3DS5 A;  2KG9 A;  1VQO P;  3I55 P;  1Q86 Q;  5KP6 B;  2GDW A;  1AF8 A;  2PEN A;  5HGN A;  2KOQ A;  2PEM A;  2K92 A;  3WBH A;  2PY8 A;  5HGL A;  2KGD A;  3RG2 A;  2JO0 A;  2VLO A;  1EMV A;  5F2K A;  3EJD A;  3GZM A;  1AUM A;  3GZL A;  3G1G A;  2ERH A;  3CE7 A;  2EFJ A;  2M5R A;  2L6E A; 
#chains in the Genus database with same CATH homology
 1M1K Q;  3G4S P;  3DS0 A;  1VQN P;  3HZQ A;  5HGM A;  3CCL P;  5HGO A;  2XXM A;  2Z44 A;  2DGY A;  2BUO A;  5F2N A;  3CCR P;  1YI2 P;  4U0D A;  3I56 P;  3HYB A;  3CPW O;  2XT1 A;  3DS1 A;  1VQ7 P;  2M8L A;  1KD1 Q;  1KQS O;  3G0V A;  3E2D A;  2P9X A;  2QEX P;  1VQ4 P;  1Q82 Q;  3MGE A;  3H4E A;  3LRY A;  2JYL A;  5DCK A;  4IPY A;  1JJ2 O;  1VQ8 P;  1RO2 A;  1VQP P;  2OAR A;  1K73 Q;  2BHV A;  3DS2 A;  1YJW P;  4WYM A;  1QVG O;  1A43 A;  2E1M A;  1K8A Q;  1NJI Q;  3CCS P;  3G26 A;  2EIA A;  1VQM P;  2PEK A;  3G1I A;  2OTL P;  3H47 A;  3DTJ A;  4PH0 A;  1KC8 Q;  1YIT P;  1W2B O;  3CCQ P;  4PH1 A;  2EG5 A;  4U0B A;  3G71 P;  1EIA A;  3CME P;  2PEQ A;  4XFZ A;  1QRJ A;  4COC A;  1ZMB A;  2M8P A;  3RG6 C;  4U0A A;  4QNB A;  3CCJ P;  4M0I A;  1M74 A;  2XV6 A;  1VQL P;  3NTE A;  2M8N A;  3G21 A;  4XFX A;  1YJN P;  3DS3 A;  3Q20 A;  1K9M Q;  4U0E A;  5BS2 A;  5JPA A;  2ONT A;  4XRQ A;  3CCM P;  1K30 A;  3G6E P;  5F2O A;  5I4T G;  3CC7 P;  3CD6 P;  2Z45 A;  1YJ9 P;  4XRO A;  3M1M A;  3CMA P;  2KOD A;  1VQ5 P;  1N8R Q;  1M90 Q;  2LF4 A;  1S72 P;  1A8O A;  2QA4 P;  2PEO A;  3CC4 P;  1Q81 Q;  1E6J P;  3H0D A;  3OW2 O;  1M6E X;  1EOQ A;  3G29 A;  4GR2 A;  1VQ9 P;  1Q7Y Q;  4COP A;  3CC2 P;  2Z46 A;  3DPH A;  3CXC O;  4U0C A;  1RO0 A;  2PEJ A;  2CWO A;  3DS5 A;  1VQK P;  4GR6 A;  3CCE P;  1VQO P;  3I55 P;  1Q86 Q;  2PEN A;  4U0F A;  3VRL C;  1BAJ A;  2JYG A;  5HGN A;  2PEM A;  3G28 A;  1YIJ P;  3WBH A;  2PY8 A;  1VQ6 P;  5BS1 A;  3CCU P;  5HGL A;  1QVF O;  1RNI A;  2JO0 A;  1D1D A;  1M6N A;  1IUQ A;  3P05 A;  5F2K A;  3CCV P;  4XFY A;  3B5I A;  2OTJ P;  3DS4 A;  1AUM A;  1YHQ P;  3G1G A;  2PEI A;  2EFJ A;  2L6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...