3RG6C

Crystal structure of a chaperone-bound assembly intermediate of form i rubisco
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLALWLHNFSAGKVQDGEKYIEELFLEKPDLALRIMTVREHIAEEIAEFLPEMVVTGIQQANMEKRRQHLERMTQVSLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Ribulose bisphosphate carboxylase large chain
publication title Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco.
pubmed doi rcsb
source organism Synechococcus elongatus
total genus 37
structure length 115
sequence length 115
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3rg6C00
2PEOA 5BS2A 2PEJA 2PEMA 3HYBA 2Z46A 2PEQA 3Q20A 2PY8A 2Z45A 2Z44A 2PEKA 3RG6C 2PEIA 4GR2A 2PENA 5BS1A 4GR6A
chains in the Genus database with same CATH superfamily
2PEOA 3CMEP 2FQ1A 3LMOA 2PY8A 1VQ9P 2L4BA 1K9MQ 2Z46A 5BS1A 2NO8A 3DPHA 1S72P 3LRYA 2K0DX 7CEIA 2PNGA 3CCRP 2XT1A 1M90Q 1Q81Q 2KGDA 3G6EP 2PEMA 1UJZA 5F2NA 4QNBA 2CG5B 2CNRA 2K93A 4IPYA 2L6EA 3Q20A 2QA4P 3CCVP 3CCMP 4XFYA 3G4SP 2Z44A 1CEIA 1Z6MA 2KGCA 2JYLA 2BUOA 2FQ2A 1HQBA 1BXIA 1EMVA 1GXHA 3GJNA 1Q82Q 4BPGA 1VQNP 2KG9A 2K0YA 3I56P 4GR6A 5HGMA 2PEJA 2MR8A 2ROQA 2EFJA 1NJIQ 1QRJA 2XXMA 2CWOA 2OTJP 4U0EA 1L0IA 3I55P 1M1KQ 2OTLP 1VQMP 2VLNA 2XZ1C 3WBHA 2VSQA 2LIUA 1VQLP 2N6ZA 2GYKA 5KP8B 2JB0A 2P9XA 3DTJA 3CC2P 3G0VA 1VQ4P 2LOLA 1F80D 1DNYA 4UHPB 3B4QA 3DS5A 2KGEA 4MRTC 4GR2A 1ZMBA 1M74A 1M6EX 5EJDA 1AUMA 4H2WC 2MVUA 4HKGA 1VQ8P 3GZMA 2PEQA 3DS4A 1HY8A 2EIAA 2KOSA 4WYMA 1YJWP 5KP6B 3G28A 3CE7A 3E2DA 4M0IA 4XFXA 2FACA 2AFDA 2OARA 1DV5A 1VQPP 3M1MA 4PH1A 3CXCO 2GZFA 1GXGA 1BAJA 1EIAA 2KG8A 4H2XC 5KP7B 2L9FA 2KGAA 2JYGA 3H0DA 2MR7A 2N50A 3NTEA 5HV8A 2ONTA 3CC4P 3HYBA 5F2KA 2PEKA 2VLPA 4U0DA 2QEXP 1IMPA 3G1IA 2L0QA 1UNKA 2N6YA 3EJEA 4U0CA 2GZEA 2GZJA 1VHNA 3H47A 2FQ0A 1VQKP 2AFEA 1ZNVA 1VQ7P 2N98A 2N5HA 2BHVA 5HVCA 4R0MA 3G21A 5F2OA 2LPKA 3DS3A 1YITP 1AYIA 3P05A 1Q7YQ 5JPAA 1K30A 2VLOA 1YHQP 2FAEA 1RO0A 2AF8A 1VQOP 2N5IA 3DS0A 1MZ8A 1K8AQ 2LF4A 1M6NA 4DG9A 3DS2A 4BPFA 2PEIA 1YJNP 3DS1A 2ERHA 3CCLP 2K92A 4PWVB 2KW2A 2JU2A 3G71P 4COCA 1K73Q 2LL8A 2GDYA 1E6JP 2K5XA 1Q86Q 4PH0A 1L0HA 1EOQA 2JQ4A 3G29A 2MF4A 4NEOA 4PXHB 2JU1A 2JO0A 2KODA 2KOOA 3CCSP 2KR5A 3OW2O 2DGYA 1KC8Q 2FVFA 2KOQA 4XROA 1IUQA 1VKUA 2LMLA 2K0XA 4BPHA 2K2QA 3EJBA 2Z45A 4XRQA 2GDXA 4QKOA 1KQSO 1RNIA 2JGPA 5I4TG 2MY5A 2EG5A 2LIWA 2LTEA 5HGNA 1T8KA 2MD9A 2FVEA 2XZ0D 1VQ5P 2MVVA 1QVGO 4U0BA 3VRLC 4F37A 2VLQA 5CZDB 1N8RQ 2M8PA 5HGLA 2FVAA 3CCJP 3GZLA 2KG6A 3B5IA 2LKIA 1YJ9P 3HZQA 4U0FA 5BS2A 2L22A 1KLPA 2GZGA 2GDWA 3U43A 2E1MA 1A43A 1KD1Q 2FADA 2WPTA 5EW5E 1D1DA 1ACPA 1W2BO 3CCUP 2EHTA 1YIJP 3EJDA 2JBGA 2X2BA 3H4EA 1YI2P 1VQ6P 2M8LA 4CA3A 5HGOA 2KWLA 2EHSA 1X3OA 1A8OA 3MGEA 1GPJA 3CCEP 4H2YC 2DNWA 1OR5A 3RG6C 3G26A 4U0AA 1IMQA 2KORA 2M5RA 2KOPA 3CPWO 2GZIA 4COPA 4XFZA 3RG2A 5DCKA 2FHSC 2M8NA 3G1GA 2CGQA 1NQ4A 2PENA 3CC7P 2K94A 3NY7B 2QNWA 1E0HA 1QVFO 3CD6P 1FR2A 2XV6A 1RO2A 4IZ6A 3GKLC 3CMAP 1JJ2O 2AVAA 3CCQP 1AF8A 2CQ8A 2JAZA
chains in the Genus database with same CATH topology
2PEOA 3I55P 1M1KQ 2OTLP 1VQMP 3G21A 5F2OA 3CMEP 1VQ5P 1QVGO 3WBHA 4U0BA 3VRLC 1VQLP 3DS3A 2PY8A 1YITP 3P05A 1Q7YQ 5JPAA 1VQ9P 1K30A 1N8RQ 2M8PA 2P9XA 3DTJA 3CC2P 3G0VA 2Z46A 5HGLA 3CCJP 1YHQP 1K9MQ 1VQ4P 1RO0A 1VQOP 3B5IA 5BS1A 3DS0A 1YJ9P 3DPHA 3DS5A 1K8AQ 3HZQA 2LF4A 1M6NA 4GR2A 1S72P 1ZMBA 4U0FA 5BS2A 3LRYA 1M74A 1M6EX 3DS2A 3CCRP 1AUMA 2PEIA 1YJNP 2XT1A 1M90Q 3DS1A 1Q81Q 2E1MA 2PEMA 3G6EP 1A43A 2PEQA 1KD1Q 1VQ8P 3CCLP 1D1DA 3DS4A 1W2BO 2EIAA 3G71P 3CCUP 4COCA 4WYMA 4QNBA 5F2NA 1YIJP 1YJWP 1K73Q 3G28A 3H4EA 1YI2P 3E2DA 1E6JP 1VQ6P 2M8LA 4IPYA 2L6EA 3Q20A 5HGOA 4M0IA 1Q86Q 4PH0A 2QA4P 3CCVP 1EOQA 1A8OA 4XFXA 3CCMP 4XFYA 3G29A 3MGEA 3G4SP 3CCEP 2Z44A 2OARA 1VQPP 3M1MA 4PH1A 3RG6C 3CXCO 2JO0A 2KODA 3G26A 2JYLA 2BUOA 4U0AA 3CPWO 1BAJA 3CCSP 1EIAA 4COPA 4XFZA 3OW2O 2DGYA 2JYGA 3H0DA 1KC8Q 3NTEA 5DCKA 2ONTA 3CC4P 2M8NA 3G1GA 3HYBA 4XROA 1IUQA 5F2KA 2PEKA 4U0DA 2QEXP 2PENA 1Q82Q 3CC7P 3G1IA 2Z45A 1VQNP 4XRQA 4U0CA 1QVFO 3I56P 3H47A 4GR6A 5HGMA 3CD6P 1VQKP 2PEJA 2XV6A 1RO2A 1KQSO 1RNIA 3CMAP 1VQ7P 5I4TG 1JJ2O 2EG5A 2EFJA 1NJIQ 1QRJA 2BHVA 3CCQP 2XXMA 5HGNA 2CWOA 2OTJP 4U0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEO A;  5BS2 A;  2PEJ A;  2PEM A;  3HYB A;  2Z46 A;  2PEQ A;  3Q20 A;  2PY8 A;  2Z45 A;  2Z44 A;  2PEK A;  3RG6 C;  2PEI A;  4GR2 A;  2PEN A;  5BS1 A;  4GR6 A; 
#chains in the Genus database with same CATH topology
 2PEO A;  3CME P;  2FQ1 A;  3LMO A;  2PY8 A;  1VQ9 P;  2L4B A;  1K9M Q;  2Z46 A;  5BS1 A;  2NO8 A;  3DPH A;  1S72 P;  3LRY A;  2K0D X;  7CEI A;  2PNG A;  3CCR P;  2XT1 A;  1M90 Q;  1Q81 Q;  2KGD A;  3G6E P;  2PEM A;  1UJZ A;  5F2N A;  4QNB A;  2CG5 B;  2CNR A;  2K93 A;  4IPY A;  2L6E A;  3Q20 A;  2QA4 P;  3CCV P;  3CCM P;  4XFY A;  3G4S P;  2Z44 A;  1CEI A;  1Z6M A;  2KGC A;  2JYL A;  2BUO A;  2FQ2 A;  1HQB A;  1BXI A;  1EMV A;  1GXH A;  3GJN A;  1Q82 Q;  4BPG A;  1VQN P;  2KG9 A;  2K0Y A;  3I56 P;  4GR6 A;  5HGM A;  2PEJ A;  2MR8 A;  2ROQ A;  2EFJ A;  1NJI Q;  1QRJ A;  2XXM A;  2CWO A;  2OTJ P;  4U0E A;  1L0I A;  3I55 P;  1M1K Q;  2OTL P;  1VQM P;  2VLN A;  2XZ1 C;  3WBH A;  2VSQ A;  2LIU A;  1VQL P;  2N6Z A;  2GYK A;  5KP8 B;  2JB0 A;  2P9X A;  3DTJ A;  3CC2 P;  3G0V A;  1VQ4 P;  2LOL A;  1F80 D;  1DNY A;  4UHP B;  3B4Q A;  3DS5 A;  2KGE A;  4MRT C;  4GR2 A;  1ZMB A;  1M74 A;  1M6E X;  5EJD A;  1AUM A;  4H2W C;  2MVU A;  4HKG A;  1VQ8 P;  3GZM A;  2PEQ A;  3DS4 A;  1HY8 A;  2EIA A;  2KOS A;  4WYM A;  1YJW P;  5KP6 B;  3G28 A;  3CE7 A;  3E2D A;  4M0I A;  4XFX A;  2FAC A;  2AFD A;  2OAR A;  1DV5 A;  1VQP P;  3M1M A;  4PH1 A;  3CXC O;  2GZF A;  1GXG A;  1BAJ A;  1EIA A;  2KG8 A;  4H2X C;  5KP7 B;  2L9F A;  2KGA A;  2JYG A;  3H0D A;  2MR7 A;  2N50 A;  3NTE A;  5HV8 A;  2ONT A;  3CC4 P;  3HYB A;  5F2K A;  2PEK A;  2VLP A;  4U0D A;  2QEX P;  1IMP A;  3G1I A;  2L0Q A;  1UNK A;  2N6Y A;  3EJE A;  4U0C A;  2GZE A;  2GZJ A;  1VHN A;  3H47 A;  2FQ0 A;  1VQK P;  2AFE A;  1ZNV A;  1VQ7 P;  2N98 A;  2N5H A;  2BHV A;  5HVC A;  4R0M A;  3G21 A;  5F2O A;  2LPK A;  3DS3 A;  1YIT P;  1AYI A;  3P05 A;  1Q7Y Q;  5JPA A;  1K30 A;  2VLO A;  1YHQ P;  2FAE A;  1RO0 A;  2AF8 A;  1VQO P;  2N5I A;  3DS0 A;  1MZ8 A;  1K8A Q;  2LF4 A;  1M6N A;  4DG9 A;  3DS2 A;  4BPF A;  2PEI A;  1YJN P;  3DS1 A;  2ERH A;  3CCL P;  2K92 A;  4PWV B;  2KW2 A;  2JU2 A;  3G71 P;  4COC A;  1K73 Q;  2LL8 A;  2GDY A;  1E6J P;  2K5X A;  1Q86 Q;  4PH0 A;  1L0H A;  1EOQ A;  2JQ4 A;  3G29 A;  2MF4 A;  4NEO A;  4PXH B;  2JU1 A;  2JO0 A;  2KOD A;  2KOO A;  3CCS P;  2KR5 A;  3OW2 O;  2DGY A;  1KC8 Q;  2FVF A;  2KOQ A;  4XRO A;  1IUQ A;  1VKU A;  2LML A;  2K0X A;  4BPH A;  2K2Q A;  3EJB A;  2Z45 A;  4XRQ A;  2GDX A;  4QKO A;  1KQS O;  1RNI A;  2JGP A;  5I4T G;  2MY5 A;  2EG5 A;  2LIW A;  2LTE A;  5HGN A;  1T8K A;  2MD9 A;  2FVE A;  2XZ0 D;  1VQ5 P;  2MVV A;  1QVG O;  4U0B A;  3VRL C;  4F37 A;  2VLQ A;  5CZD B;  1N8R Q;  2M8P A;  5HGL A;  2FVA A;  3CCJ P;  3GZL A;  2KG6 A;  3B5I A;  2LKI A;  1YJ9 P;  3HZQ A;  4U0F A;  5BS2 A;  2L22 A;  1KLP A;  2GZG A;  2GDW A;  3U43 A;  2E1M A;  1A43 A;  1KD1 Q;  2FAD A;  2WPT A;  5EW5 E;  1D1D A;  1ACP A;  1W2B O;  3CCU P;  2EHT A;  1YIJ P;  3EJD A;  2JBG A;  2X2B A;  3H4E A;  1YI2 P;  1VQ6 P;  2M8L A;  4CA3 A;  5HGO A;  2KWL A;  2EHS A;  1X3O A;  1A8O A;  3MGE A;  1GPJ A;  3CCE P;  4H2Y C;  2DNW A;  1OR5 A;  3RG6 C;  3G26 A;  4U0A A;  1IMQ A;  2KOR A;  2M5R A;  2KOP A;  3CPW O;  2GZI A;  4COP A;  4XFZ A;  3RG2 A;  5DCK A;  2FHS C;  2M8N A;  3G1G A;  2CGQ A;  1NQ4 A;  2PEN A;  3CC7 P;  2K94 A;  3NY7 B;  2QNW A;  1E0H A;  1QVF O;  3CD6 P;  1FR2 A;  2XV6 A;  1RO2 A;  4IZ6 A;  3GKL C;  3CMA P;  1JJ2 O;  2AVA A;  3CCQ P;  1AF8 A;  2CQ8 A;  2JAZ A; 
#chains in the Genus database with same CATH homology
 2PEO A;  3I55 P;  1M1K Q;  2OTL P;  1VQM P;  3G21 A;  5F2O A;  3CME P;  1VQ5 P;  1QVG O;  3WBH A;  4U0B A;  3VRL C;  1VQL P;  3DS3 A;  2PY8 A;  1YIT P;  3P05 A;  1Q7Y Q;  5JPA A;  1VQ9 P;  1K30 A;  1N8R Q;  2M8P A;  2P9X A;  3DTJ A;  3CC2 P;  3G0V A;  2Z46 A;  5HGL A;  3CCJ P;  1YHQ P;  1K9M Q;  1VQ4 P;  1RO0 A;  1VQO P;  3B5I A;  5BS1 A;  3DS0 A;  1YJ9 P;  3DPH A;  3DS5 A;  1K8A Q;  3HZQ A;  2LF4 A;  1M6N A;  4GR2 A;  1S72 P;  1ZMB A;  4U0F A;  5BS2 A;  3LRY A;  1M74 A;  1M6E X;  3DS2 A;  3CCR P;  1AUM A;  2PEI A;  1YJN P;  2XT1 A;  1M90 Q;  3DS1 A;  1Q81 Q;  2E1M A;  2PEM A;  3G6E P;  1A43 A;  2PEQ A;  1KD1 Q;  1VQ8 P;  3CCL P;  1D1D A;  3DS4 A;  1W2B O;  2EIA A;  3G71 P;  3CCU P;  4COC A;  4WYM A;  4QNB A;  5F2N A;  1YIJ P;  1YJW P;  1K73 Q;  3G28 A;  3H4E A;  1YI2 P;  3E2D A;  1E6J P;  1VQ6 P;  2M8L A;  4IPY A;  2L6E A;  3Q20 A;  5HGO A;  4M0I A;  1Q86 Q;  4PH0 A;  2QA4 P;  3CCV P;  1EOQ A;  1A8O A;  4XFX A;  3CCM P;  4XFY A;  3G29 A;  3MGE A;  3G4S P;  3CCE P;  2Z44 A;  2OAR A;  1VQP P;  3M1M A;  4PH1 A;  3RG6 C;  3CXC O;  2JO0 A;  2KOD A;  3G26 A;  2JYL A;  2BUO A;  4U0A A;  3CPW O;  1BAJ A;  3CCS P;  1EIA A;  4COP A;  4XFZ A;  3OW2 O;  2DGY A;  2JYG A;  3H0D A;  1KC8 Q;  3NTE A;  5DCK A;  2ONT A;  3CC4 P;  2M8N A;  3G1G A;  3HYB A;  4XRO A;  1IUQ A;  5F2K A;  2PEK A;  4U0D A;  2QEX P;  2PEN A;  1Q82 Q;  3CC7 P;  3G1I A;  2Z45 A;  1VQN P;  4XRQ A;  4U0C A;  1QVF O;  3I56 P;  3H47 A;  4GR6 A;  5HGM A;  3CD6 P;  1VQK P;  2PEJ A;  2XV6 A;  1RO2 A;  1KQS O;  1RNI A;  3CMA P;  1VQ7 P;  5I4T G;  1JJ2 O;  2EG5 A;  2EFJ A;  1NJI Q;  1QRJ A;  2BHV A;  3CCQ P;  2XXM A;  5HGN A;  2CWO A;  2OTJ P;  4U0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...