3RG6C

Crystal structure of a chaperone-bound assembly intermediate of form i rubisco
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
b'MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLALWLHNFSAGKVQDGEKYIEELFLEKPDLALRIMTVREHIAEEIAEFLPEMVVTGIQQANMEKRRQHLERMTQVSLSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase large chain
publication title Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Photosynthesis
total genus 37
structure length 115
sequence length 115
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3rg6C00
4GR6A 2PEKA 2PEMA 2PEOA 2PEIA 3Q20A 2PY8A 2Z46A 2PEQA 5BS2A 2PEJA 5BS1A 3HYBA 2PENA 2Z44A 3RG6C 2Z45A 4GR2A
chains in the Genus database with same CATH superfamily
2BUOA 4MRTC 2E1MA 1M90Q 3CCRP 4QNBA 1L0IA 4XFZA 4COPA 1X3OA 2L9FA 1S72P 2CG5B 2LKIA 2KODA 1EIAA 2L6EA 4BPHA 3CC4P 1L0HA 1YITP 3DS3A 2GZIA 2DNWA 2K2QA 2JO0A 1Q7YQ 2JQ4A 2WPTA 4H2WC 2LL8A 2KOSA 2JBGA 1Q86Q 2QEXP 1M1KQ 2M5RA 2FVAA 3NY7B 3CCQP 2MR8A 1VHNA 2M8NA 2XXMA 3G1GA 2KW2A 2LIUA 2FQ1A 2MVUA 2VLPA 1QVFO 1EMVA 4M0IA 3LMOA 4CA3A 2N6YA 3NTEA 1GPJA 4GR6A 2KGDA 2EHSA 3G1IA 2JB0A 3CXCO 3DPHA 3G28A 5KP6B 2X2BA 1FR2A 4U0CA 3DS5A 1YJWP 1E6JP 2KG9A 2FVFA 2GZFA 2VSQA 5HGMA 3G4SP 2AVAA 2XT1A 2BHVA 2PEQA 5JPAA 3RG2A 1T8KA 1Q82Q 2FACA 3CCUP 1YI2P 3DS2A 1VQ8P 1VQPP 1VQ4P 1A43A 1M6EX 4PXHB 2ERHA 1AUMA 4PH0A 3VRLC 1BAJA 1W2BO 2GYKA 1VQ7P 4GR2A 4U0EA 5EW5E 2VLNA 1CEIA 4U0FA 3G6EP 2AF8A 2KG6A 1K73Q 3G26A 2KG8A 2GDXA 2OTLP 3CC7P 1GXHA 1K9MQ 2K0YA 2KOPA 2PEJA 2GZEA 2AFEA 2FAEA 5KP8B 2CGQA 3CC2P 2MY5A 2PEMA 5BS1A 1IMPA 1RO2A 2CQ8A 2KORA 2N6ZA 1VQ5P 2DGYA 2KGEA 2MR7A 4R0MA 5CZDB 1ZNVA 3E2DA 2JYLA 3CE7A 2Z45A 3H4EA 1KLPA 2XV6A 2PEIA 3GZLA 2KOOA 1KD1Q 3WBHA 4IZ6A 2FVEA 1K8AQ 4WYMA 3CMAP 1UNKA 1VQNP 3Q20A 3P05A 2NO8A 1A8OA 2JU1A 1K30A 2PY8A 2Z46A 4U0DA 1IUQA 3H47A 1YJ9P 2L4BA 2OARA 1VQ6P 1MZ8A 3H0DA 3CCVP 5I4TG 5F2NA 5DCKA 2MF4A 3G21A 5F2OA 2N98A 3B4QA 2LIWA 4IPYA 4HKGA 3CMEP 3DS1A 1IMQA 2GZJA 2LMLA 2LOLA 2GDWA 4BPGA 4H2XC 1ACPA 4XRQA 2AFDA 1BXIA 2JGPA 1UJZA 2N5IA 2OTJP 5HVCA 3G71P 3CD6P 7CEIA 2EHTA 5HGLA 4XROA 2QNWA 3GJNA 2KGCA 2PNGA 2K5XA 3GKLC 1DV5A 3DTJA 1ZMBA 5HGOA 2Z44A 3G0VA 5F2KA 2JU2A 2N50A 2K94A 2VLQA 2CWOA 5HV8A 5EJDA 1AF8A 3I55P 4H2YC 1AYIA 2GZGA 2PENA 4U0BA 2P9XA 2KWLA 2FQ0A 1Z6MA 1VQOP 2CNRA 4UHPB 2XZ1C 2XZ0D 2MD9A 1NQ4A 2L0QA 1YJNP 2FADA 1DNYA 1M6NA 3CCJP 1RNIA 1VQ9P 3DS0A 3U43A 2LPKA 2EIAA 4PH1A 1EOQA 3EJEA 2LF4A 1HY8A 3EJDA 2ONTA 3OW2O 1M74A 1NJIQ 1Q81Q 2KOQA 3CCLP 2GDYA 5BS2A 4DG9A 2FHSC 4XFXA 3CCSP 2EG5A 3CCMP 1OR5A 4QKOA 4F37A 2L22A 4PWVB 2N5HA 3HZQA 2JYGA 4U0AA 1KQSO 3MGEA 3G29A 2JAZA 1JJ2O 1VQKP 3LRYA 1F80D 4BPFA 3CPWO 5KP7B 1QRJA 1E0HA 1YHQP 2LTEA 1YIJP 2EFJA 2KGAA 1HQBA 1VQMP 2PEKA 2PEOA 1VKUA 3CCEP 1N8RQ 3M1MA 2ROQA 2M8LA 2M8PA 3HYBA 3EJBA 3RG6C 2QA4P 2K93A 5HGNA 2KR5A 1QVGO 2K0XA 2VLOA 2K0DX 4NEOA 4COCA 2FQ2A 2K92A 3GZMA 1RO0A 2MVVA 3I56P 1KC8Q 3DS4A 4XFYA 1D1DA 1VQLP 3B5IA 1GXGA
chains in the Genus database with same CATH topology
3DS0A 1YJ9P 1Q82Q 3CCUP 1YI2P 2BUOA 3DS2A 2E1MA 1M90Q 3CCRP 1VQ8P 2OARA 4QNBA 1VQPP 1VQ4P 1VQ6P 1A43A 4XFZA 1M6EX 2EIAA 4COPA 3H0DA 3CCVP 4PH1A 5I4TG 1S72P 1EOQA 1AUMA 5F2NA 5DCKA 4PH0A 3VRLC 2LF4A 2KODA 1BAJA 2ONTA 1EIAA 3G21A 2L6EA 3OW2O 1M74A 5F2OA 1W2BO 1Q81Q 1NJIQ 4IPYA 1VQ7P 3CCLP 3CMEP 4GR2A 4U0EA 3DS1A 3CC4P 1YITP 3DS3A 5BS2A 4U0FA 3G6EP 4XFXA 3CCSP 2EG5A 1K73Q 2JO0A 3G26A 3CCMP 2OTLP 3CC7P 4XRQA 1K9MQ 1Q7YQ 2PEJA 1Q86Q 2OTJP 3HZQA 3G71P 3CD6P 2QEXP 2JYGA 1M1KQ 4U0AA 1KQSO 3MGEA 3G29A 3CCQP 1JJ2O 5HGLA 1VQKP 3CC2P 4XROA 3LRYA 2PEMA 2M8NA 2XXMA 3CPWO 3G1GA 5BS1A 3DTJA 1ZMBA 1D1DA 5HGOA 1QRJA 2Z44A 1YHQP 1YIJP 1RO2A 3G0VA 2EFJA 5F2KA 1VQ5P 1QVFO 4M0IA 1VQMP 2DGYA 2PEKA 2PEOA 3NTEA 3CCEP 1N8RQ 3M1MA 2CWOA 4GR6A 3G1IA 2M8PA 2M8LA 3E2DA 3I55P 2JYLA 3HYBA 3CXCO 2PENA 3RG6C 2QA4P 3DPHA 3H4EA 2Z45A 4U0BA 2XV6A 5HGNA 3G28A 2P9XA 2PEIA 1KD1Q 3WBHA 1QVGO 1VQOP 4U0CA 3DS5A 4COCA 1YJWP 1E6JP 1K8AQ 4WYMA 3CMAP 1VQNP 3Q20A 3P05A 1A8OA 1RO0A 5HGMA 3I56P 3G4SP 1YJNP 2XT1A 1K30A 2BHVA 3DS4A 1KC8Q 2PY8A 2Z46A 2PEQA 4XFYA 4U0DA 1IUQA 1M6NA 5JPAA 1VQLP 3CCJP 3B5IA 1RNIA 1VQ9P 3H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GR6 A;  2PEK A;  2PEM A;  2PEO A;  2PEI A;  3Q20 A;  2PY8 A;  2Z46 A;  2PEQ A;  5BS2 A;  2PEJ A;  5BS1 A;  3HYB A;  2PEN A;  2Z44 A;  3RG6 C;  2Z45 A;  4GR2 A; 
#chains in the Genus database with same CATH topology
 2BUO A;  4MRT C;  2E1M A;  1M90 Q;  3CCR P;  4QNB A;  1L0I A;  4XFZ A;  4COP A;  1X3O A;  2L9F A;  1S72 P;  2CG5 B;  2LKI A;  2KOD A;  1EIA A;  2L6E A;  4BPH A;  3CC4 P;  1L0H A;  1YIT P;  3DS3 A;  2GZI A;  2DNW A;  2K2Q A;  2JO0 A;  1Q7Y Q;  2JQ4 A;  2WPT A;  4H2W C;  2LL8 A;  2KOS A;  2JBG A;  1Q86 Q;  2QEX P;  1M1K Q;  2M5R A;  2FVA A;  3NY7 B;  3CCQ P;  2MR8 A;  1VHN A;  2M8N A;  2XXM A;  3G1G A;  2KW2 A;  2LIU A;  2FQ1 A;  2MVU A;  2VLP A;  1QVF O;  1EMV A;  4M0I A;  3LMO A;  4CA3 A;  2N6Y A;  3NTE A;  1GPJ A;  4GR6 A;  2KGD A;  2EHS A;  3G1I A;  2JB0 A;  3CXC O;  3DPH A;  3G28 A;  5KP6 B;  2X2B A;  1FR2 A;  4U0C A;  3DS5 A;  1YJW P;  1E6J P;  2KG9 A;  2FVF A;  2GZF A;  2VSQ A;  5HGM A;  3G4S P;  2AVA A;  2XT1 A;  2BHV A;  2PEQ A;  5JPA A;  3RG2 A;  1T8K A;  1Q82 Q;  2FAC A;  3CCU P;  1YI2 P;  3DS2 A;  1VQ8 P;  1VQP P;  1VQ4 P;  1A43 A;  1M6E X;  4PXH B;  2ERH A;  1AUM A;  4PH0 A;  3VRL C;  1BAJ A;  1W2B O;  2GYK A;  1VQ7 P;  4GR2 A;  4U0E A;  5EW5 E;  2VLN A;  1CEI A;  4U0F A;  3G6E P;  2AF8 A;  2KG6 A;  1K73 Q;  3G26 A;  2KG8 A;  2GDX A;  2OTL P;  3CC7 P;  1GXH A;  1K9M Q;  2K0Y A;  2KOP A;  2PEJ A;  2GZE A;  2AFE A;  2FAE A;  5KP8 B;  2CGQ A;  3CC2 P;  2MY5 A;  2PEM A;  5BS1 A;  1IMP A;  1RO2 A;  2CQ8 A;  2KOR A;  2N6Z A;  1VQ5 P;  2DGY A;  2KGE A;  2MR7 A;  4R0M A;  5CZD B;  1ZNV A;  3E2D A;  2JYL A;  3CE7 A;  2Z45 A;  3H4E A;  1KLP A;  2XV6 A;  2PEI A;  3GZL A;  2KOO A;  1KD1 Q;  3WBH A;  4IZ6 A;  2FVE A;  1K8A Q;  4WYM A;  3CMA P;  1UNK A;  1VQN P;  3Q20 A;  3P05 A;  2NO8 A;  1A8O A;  2JU1 A;  1K30 A;  2PY8 A;  2Z46 A;  4U0D A;  1IUQ A;  3H47 A;  1YJ9 P;  2L4B A;  2OAR A;  1VQ6 P;  1MZ8 A;  3H0D A;  3CCV P;  5I4T G;  5F2N A;  5DCK A;  2MF4 A;  3G21 A;  5F2O A;  2N98 A;  3B4Q A;  2LIW A;  4IPY A;  4HKG A;  3CME P;  3DS1 A;  1IMQ A;  2GZJ A;  2LML A;  2LOL A;  2GDW A;  4BPG A;  4H2X C;  1ACP A;  4XRQ A;  2AFD A;  1BXI A;  2JGP A;  1UJZ A;  2N5I A;  2OTJ P;  5HVC A;  3G71 P;  3CD6 P;  7CEI A;  2EHT A;  5HGL A;  4XRO A;  2QNW A;  3GJN A;  2KGC A;  2PNG A;  2K5X A;  3GKL C;  1DV5 A;  3DTJ A;  1ZMB A;  5HGO A;  2Z44 A;  3G0V A;  5F2K A;  2JU2 A;  2N50 A;  2K94 A;  2VLQ A;  2CWO A;  5HV8 A;  5EJD A;  1AF8 A;  3I55 P;  4H2Y C;  1AYI A;  2GZG A;  2PEN A;  4U0B A;  2P9X A;  2KWL A;  2FQ0 A;  1Z6M A;  1VQO P;  2CNR A;  4UHP B;  2XZ1 C;  2XZ0 D;  2MD9 A;  1NQ4 A;  2L0Q A;  1YJN P;  2FAD A;  1DNY A;  1M6N A;  3CCJ P;  1RNI A;  1VQ9 P;  3DS0 A;  3U43 A;  2LPK A;  2EIA A;  4PH1 A;  1EOQ A;  3EJE A;  2LF4 A;  1HY8 A;  3EJD A;  2ONT A;  3OW2 O;  1M74 A;  1NJI Q;  1Q81 Q;  2KOQ A;  3CCL P;  2GDY A;  5BS2 A;  4DG9 A;  2FHS C;  4XFX A;  3CCS P;  2EG5 A;  3CCM P;  1OR5 A;  4QKO A;  4F37 A;  2L22 A;  4PWV B;  2N5H A;  3HZQ A;  2JYG A;  4U0A A;  1KQS O;  3MGE A;  3G29 A;  2JAZ A;  1JJ2 O;  1VQK P;  3LRY A;  1F80 D;  4BPF A;  3CPW O;  5KP7 B;  1QRJ A;  1E0H A;  1YHQ P;  2LTE A;  1YIJ P;  2EFJ A;  2KGA A;  1HQB A;  1VQM P;  2PEK A;  2PEO A;  1VKU A;  3CCE P;  1N8R Q;  3M1M A;  2ROQ A;  2M8L A;  2M8P A;  3HYB A;  3EJB A;  3RG6 C;  2QA4 P;  2K93 A;  5HGN A;  2KR5 A;  1QVG O;  2K0X A;  2VLO A;  2K0D X;  4NEO A;  4COC A;  2FQ2 A;  2K92 A;  3GZM A;  1RO0 A;  2MVV A;  3I56 P;  1KC8 Q;  3DS4 A;  4XFY A;  1D1D A;  1VQL P;  3B5I A;  1GXG A; 
#chains in the Genus database with same CATH homology
 3DS0 A;  1YJ9 P;  1Q82 Q;  3CCU P;  1YI2 P;  2BUO A;  3DS2 A;  2E1M A;  1M90 Q;  3CCR P;  1VQ8 P;  2OAR A;  4QNB A;  1VQP P;  1VQ4 P;  1VQ6 P;  1A43 A;  4XFZ A;  1M6E X;  2EIA A;  4COP A;  3H0D A;  3CCV P;  4PH1 A;  5I4T G;  1S72 P;  1EOQ A;  1AUM A;  5F2N A;  5DCK A;  4PH0 A;  3VRL C;  2LF4 A;  2KOD A;  1BAJ A;  2ONT A;  1EIA A;  3G21 A;  2L6E A;  3OW2 O;  1M74 A;  5F2O A;  1W2B O;  1Q81 Q;  1NJI Q;  4IPY A;  1VQ7 P;  3CCL P;  3CME P;  4GR2 A;  4U0E A;  3DS1 A;  3CC4 P;  1YIT P;  3DS3 A;  5BS2 A;  4U0F A;  3G6E P;  4XFX A;  3CCS P;  2EG5 A;  1K73 Q;  2JO0 A;  3G26 A;  3CCM P;  2OTL P;  3CC7 P;  4XRQ A;  1K9M Q;  1Q7Y Q;  2PEJ A;  1Q86 Q;  2OTJ P;  3HZQ A;  3G71 P;  3CD6 P;  2QEX P;  2JYG A;  1M1K Q;  4U0A A;  1KQS O;  3MGE A;  3G29 A;  3CCQ P;  1JJ2 O;  5HGL A;  1VQK P;  3CC2 P;  4XRO A;  3LRY A;  2PEM A;  2M8N A;  2XXM A;  3CPW O;  3G1G A;  5BS1 A;  3DTJ A;  1ZMB A;  1D1D A;  5HGO A;  1QRJ A;  2Z44 A;  1YHQ P;  1YIJ P;  1RO2 A;  3G0V A;  2EFJ A;  5F2K A;  1VQ5 P;  1QVF O;  4M0I A;  1VQM P;  2DGY A;  2PEK A;  2PEO A;  3NTE A;  3CCE P;  1N8R Q;  3M1M A;  2CWO A;  4GR6 A;  3G1I A;  2M8P A;  2M8L A;  3E2D A;  3I55 P;  2JYL A;  3HYB A;  3CXC O;  2PEN A;  3RG6 C;  2QA4 P;  3DPH A;  3H4E A;  2Z45 A;  4U0B A;  2XV6 A;  5HGN A;  3G28 A;  2P9X A;  2PEI A;  1KD1 Q;  3WBH A;  1QVG O;  1VQO P;  4U0C A;  3DS5 A;  4COC A;  1YJW P;  1E6J P;  1K8A Q;  4WYM A;  3CMA P;  1VQN P;  3Q20 A;  3P05 A;  1A8O A;  1RO0 A;  5HGM A;  3I56 P;  3G4S P;  1YJN P;  2XT1 A;  1K30 A;  2BHV A;  3DS4 A;  1KC8 Q;  2PY8 A;  2Z46 A;  2PEQ A;  4XFY A;  4U0D A;  1IUQ A;  1M6N A;  5JPA A;  1VQL P;  3CCJ P;  3B5I A;  1RNI A;  1VQ9 P;  3H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...