3RG6C

Crystal structure of a chaperone-bound assembly intermediate of form i rubisco
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLALWLHNFSAGKVQDGEKYIEELFLEKPDLALRIMTVREHIAEEIAEFLPEMVVTGIQQANMEKRRQHLERMTQVSLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase large chain
publication title Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Photosynthesis
total genus 37
structure length 115
sequence length 115
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3rg6C00
2PY8A 2Z44A 5BS1A 4GR6A 2PEMA 2PEIA 2PEKA 2Z45A 2PENA 2PEOA 2Z46A 3Q20A 2PEQA 2PEJA 3RG6C 3HYBA 5BS2A 4GR2A
chains in the Genus database with same CATH superfamily
3CE7A 2KG8A 2N6ZA 2MF4A 2FQ2A 2LL8A 2GZFA 1K9MQ 3CMEP 2FADA 2K0XA 2XZ1C 2LIWA 1KLPA 2MVUA 5KP8B 5BS2A 1RO2A 3DPHA 1EMVA 5KP6B 4WYMA 2LTEA 2FVAA 2KR5A 2KOQA 3RG2A 3MGEA 3G21A 3CCLP 2VLPA 4PH0A 2Z44A 3DS2A 3CCJP 2KGCA 4H2WC 1YJNP 2GDWA 5CZDB 1YIJP 1NQ4A 1KQSO 3G6EP 2PEOA 7CEIA 4MRTC 1ACPA 2BUOA 1QRJA 3B4QA 5HVCA 2LIUA 5I4TG 5EW5E 2OTLP 2K93A 1QVGO 5F2NA 2LMLA 2FQ1A 2PY8A 1FR2A 4R0MA 3RG6C 1IMQA 2AVAA 1OR5A 3E2DA 1VQPP 3NY7B 1F80D 1Q81Q 1AF8A 2K5XA 3CCQP 1W2BO 1Z6MA 2CQ8A 1UJZA 3HZQA 2M5RA 2QNWA 4M0IA 5EJDA 2PENA 1T8KA 4U0EA 3EJBA 2M8NA 2VLQA 2N5HA 3DTJA 2KG6A 3CC2P 3CCEP 3H4EA 3GZMA 4H2XC 1M74A 2GDYA 3CCMP 2GYKA 2KOSA 1A43A 1EIAA 4CA3A 1M6EX 5BS1A 2FHSC 2JYGA 3GJNA 3G71P 2QA4P 1JJ2O 4BPHA 3CCRP 1VQNP 2KGEA 4U0BA 1NJIQ 3H47A 3G28A 3I56P 3M1MA 3LMOA 1Q86Q 1VHNA 2EIAA 3DS4A 2LPKA 1KD1Q 2OARA 1L0HA 1X3OA 2XZ0D 4XFXA 5HGLA 2L0QA 2N50A 2JQ4A 4H2YC 2CNRA 3OW2O 2DGYA 1IUQA 1ZMBA 4NEOA 1IMPA 5DCKA 3H0DA 2ERHA 1GXHA 1VQ4P 5KP7B 1VQOP 1VQKP 3WBHA 1DNYA 2BHVA 4U0AA 1AUMA 2KGAA 1M6NA 2E1MA 4BPGA 2DNWA 2MR8A 3G1IA 3Q20A 2KG9A 3B5IA 3CC4P 2PEKA 3CC7P 1UNKA 1GPJA 2WPTA 5JPAA 1BAJA 4XFZA 1HQBA 1BXIA 2GZEA 2JYLA 2VLOA 4COCA 1YITP 4U0CA 4XFYA 3G0VA 4GR2A 2JB0A 2N6YA 2OTJP 2LOLA 2N5IA 1VQMP 2PEJA 4HKGA 1A8OA 2GZIA 3G1GA 3DS0A 2CG5B 2GZGA 2MR7A 2LF4A 1MZ8A 1YJ9P 4BPFA 3LRYA 3DS1A 2KODA 3U43A 1RO0A 4XRQA 2L9FA 4UHPB 2EHSA 3EJDA 2PEQA 2K2QA 2M8PA 3CD6P 4GR6A 2KOPA 4QKOA 2ROQA 1M90Q 1VQLP 2K0DX 2VLNA 4XROA 3NTEA 3VRLC 1RNIA 3EJEA 2K0YA 1ZNVA 3CCUP 2FAEA 2EHTA 4PH1A 1Q7YQ 2CWOA 2EFJA 2MVVA 2P9XA 2JU1A 2N98A 2JO0A 1D1DA 2MD9A 2XT1A 2Z46A 3P05A 5HGNA 1GXGA 1K8AQ 2PEMA 2CGQA 3G26A 2PNGA 4DG9A 2XXMA 1EOQA 2K94A 2KOOA 1M1KQ 1E0HA 3G4SP 2X2BA 2JAZA 3DS3A 2Z45A 4U0FA 2FVFA 2JU2A 2ONTA 5F2KA 1VQ7P 2LKIA 2FQ0A 4PWVB 1YI2P 1K30A 2AF8A 1VQ9P 5HGMA 5F2OA 3CXCO 2L4BA 1VQ8P 1KC8Q 2FACA 4COPA 3I55P 1AYIA 2L6EA 2AFDA 5HGOA 2JGPA 1VQ5P 2M8LA 5HV8A 1QVFO 2K92A 1L0IA 2VSQA 2KGDA 4F37A 1YJWP 3CMAP 1K73Q 2KORA 1DV5A 3DS5A 1S72P 1YHQP 2EG5A 4U0DA 1E6JP 4QNBA 1VQ6P 3G29A 1Q82Q 2JBGA 2GZJA 2KWLA 3HYBA 2AFEA 1HY8A 2NO8A 2L22A 2FVEA 4IPYA 1CEIA 2GDXA 3CPWO 3CCVP 1N8RQ 3CCSP 2XV6A 2QEXP 2MY5A 2KW2A 2PEIA 3GKLC 4PXHB 1VKUA 3GZLA 4IZ6A
chains in the Genus database with same CATH topology
4M0IA 1K8AQ 4XFZA 2PEMA 3G26A 2PENA 2JYLA 4U0EA 4COCA 2M8NA 4U0CA 2XXMA 1YITP 1EOQA 3DTJA 4XFYA 3CC2P 1K9MQ 1M1KQ 3G4SP 3CCEP 3G0VA 4GR2A 3H4EA 2OTJP 3CMEP 3DS3A 2Z45A 4U0FA 1VQMP 1M74A 2PEJA 2ONTA 3CCMP 5F2KA 1A8OA 1VQ7P 3G1GA 1A43A 1EIAA 5BS2A 1M6EX 3DS0A 1RO2A 5BS1A 3DPHA 1YI2P 1K30A 2JYGA 4WYMA 5F2OA 5HGMA 3CXCO 1VQ9P 3G71P 2QA4P 5JPAA 2LF4A 1VQ8P 1YJ9P 3LRYA 1KC8Q 3CCLP 3MGEA 3G21A 1JJ2O 4COPA 3I55P 3DS1A 4PH0A 2KODA 2Z44A 3DS2A 3CCJP 1RO0A 3CCRP 4XRQA 1VQNP 2PEQA 1YJNP 2L6EA 5HGOA 4U0BA 1NJIQ 2M8PA 1YIJP 3H47A 3CD6P 1VQ5P 3G28A 2M8LA 1KQSO 3I56P 1QVFO 3G6EP 4GR6A 3M1MA 2PEOA 1Q86Q 2EIAA 3DS4A 1YJWP 1KD1Q 2OARA 4XFXA 3CMAP 5HGLA 1M90Q 1K73Q 1VQLP 2BUOA 1QRJA 5I4TG 4XROA 2OTLP 3DS5A 1S72P 3OW2O 3NTEA 2EG5A 1YHQP 2DGYA 4U0DA 3VRLC 1RNIA 1IUQA 1E6JP 4QNBA 1QVGO 3G29A 5F2NA 1VQ6P 1ZMBA 3CCUP 5DCKA 1Q82Q 4PH1A 3H0DA 2CWOA 1Q7YQ 2PY8A 2EFJA 2P9XA 3RG6C 3HYBA 1VQ4P 1VQOP 1VQKP 3WBHA 2BHVA 3E2DA 4IPYA 3CCVP 3CPWO 1VQPP 4U0AA 1AUMA 1Q81Q 2JO0A 1D1DA 1M6NA 1N8RQ 3CCQP 1W2BO 2E1MA 2XT1A 2Z46A 3Q20A 3G1IA 3CCSP 2XV6A 3P05A 2QEXP 5HGNA 3B5IA 3CC4P 2PEIA 2PEKA 3CC7P 3HZQA 1BAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PY8 A;  2Z44 A;  5BS1 A;  4GR6 A;  2PEM A;  2PEI A;  2PEK A;  2Z45 A;  2PEN A;  2PEO A;  2Z46 A;  3Q20 A;  2PEQ A;  2PEJ A;  3RG6 C;  3HYB A;  5BS2 A;  4GR2 A; 
#chains in the Genus database with same CATH topology
 3CE7 A;  2KG8 A;  2N6Z A;  2MF4 A;  2FQ2 A;  2LL8 A;  2GZF A;  1K9M Q;  3CME P;  2FAD A;  2K0X A;  2XZ1 C;  2LIW A;  1KLP A;  2MVU A;  5KP8 B;  5BS2 A;  1RO2 A;  3DPH A;  1EMV A;  5KP6 B;  4WYM A;  2LTE A;  2FVA A;  2KR5 A;  2KOQ A;  3RG2 A;  3MGE A;  3G21 A;  3CCL P;  2VLP A;  4PH0 A;  2Z44 A;  3DS2 A;  3CCJ P;  2KGC A;  4H2W C;  1YJN P;  2GDW A;  5CZD B;  1YIJ P;  1NQ4 A;  1KQS O;  3G6E P;  2PEO A;  7CEI A;  4MRT C;  1ACP A;  2BUO A;  1QRJ A;  3B4Q A;  5HVC A;  2LIU A;  5I4T G;  5EW5 E;  2OTL P;  2K93 A;  1QVG O;  5F2N A;  2LML A;  2FQ1 A;  2PY8 A;  1FR2 A;  4R0M A;  3RG6 C;  1IMQ A;  2AVA A;  1OR5 A;  3E2D A;  1VQP P;  3NY7 B;  1F80 D;  1Q81 Q;  1AF8 A;  2K5X A;  3CCQ P;  1W2B O;  1Z6M A;  2CQ8 A;  1UJZ A;  3HZQ A;  2M5R A;  2QNW A;  4M0I A;  5EJD A;  2PEN A;  1T8K A;  4U0E A;  3EJB A;  2M8N A;  2VLQ A;  2N5H A;  3DTJ A;  2KG6 A;  3CC2 P;  3CCE P;  3H4E A;  3GZM A;  4H2X C;  1M74 A;  2GDY A;  3CCM P;  2GYK A;  2KOS A;  1A43 A;  1EIA A;  4CA3 A;  1M6E X;  5BS1 A;  2FHS C;  2JYG A;  3GJN A;  3G71 P;  2QA4 P;  1JJ2 O;  4BPH A;  3CCR P;  1VQN P;  2KGE A;  4U0B A;  1NJI Q;  3H47 A;  3G28 A;  3I56 P;  3M1M A;  3LMO A;  1Q86 Q;  1VHN A;  2EIA A;  3DS4 A;  2LPK A;  1KD1 Q;  2OAR A;  1L0H A;  1X3O A;  2XZ0 D;  4XFX A;  5HGL A;  2L0Q A;  2N50 A;  2JQ4 A;  4H2Y C;  2CNR A;  3OW2 O;  2DGY A;  1IUQ A;  1ZMB A;  4NEO A;  1IMP A;  5DCK A;  3H0D A;  2ERH A;  1GXH A;  1VQ4 P;  5KP7 B;  1VQO P;  1VQK P;  3WBH A;  1DNY A;  2BHV A;  4U0A A;  1AUM A;  2KGA A;  1M6N A;  2E1M A;  4BPG A;  2DNW A;  2MR8 A;  3G1I A;  3Q20 A;  2KG9 A;  3B5I A;  3CC4 P;  2PEK A;  3CC7 P;  1UNK A;  1GPJ A;  2WPT A;  5JPA A;  1BAJ A;  4XFZ A;  1HQB A;  1BXI A;  2GZE A;  2JYL A;  2VLO A;  4COC A;  1YIT P;  4U0C A;  4XFY A;  3G0V A;  4GR2 A;  2JB0 A;  2N6Y A;  2OTJ P;  2LOL A;  2N5I A;  1VQM P;  2PEJ A;  4HKG A;  1A8O A;  2GZI A;  3G1G A;  3DS0 A;  2CG5 B;  2GZG A;  2MR7 A;  2LF4 A;  1MZ8 A;  1YJ9 P;  4BPF A;  3LRY A;  3DS1 A;  2KOD A;  3U43 A;  1RO0 A;  4XRQ A;  2L9F A;  4UHP B;  2EHS A;  3EJD A;  2PEQ A;  2K2Q A;  2M8P A;  3CD6 P;  4GR6 A;  2KOP A;  4QKO A;  2ROQ A;  1M90 Q;  1VQL P;  2K0D X;  2VLN A;  4XRO A;  3NTE A;  3VRL C;  1RNI A;  3EJE A;  2K0Y A;  1ZNV A;  3CCU P;  2FAE A;  2EHT A;  4PH1 A;  1Q7Y Q;  2CWO A;  2EFJ A;  2MVV A;  2P9X A;  2JU1 A;  2N98 A;  2JO0 A;  1D1D A;  2MD9 A;  2XT1 A;  2Z46 A;  3P05 A;  5HGN A;  1GXG A;  1K8A Q;  2PEM A;  2CGQ A;  3G26 A;  2PNG A;  4DG9 A;  2XXM A;  1EOQ A;  2K94 A;  2KOO A;  1M1K Q;  1E0H A;  3G4S P;  2X2B A;  2JAZ A;  3DS3 A;  2Z45 A;  4U0F A;  2FVF A;  2JU2 A;  2ONT A;  5F2K A;  1VQ7 P;  2LKI A;  2FQ0 A;  4PWV B;  1YI2 P;  1K30 A;  2AF8 A;  1VQ9 P;  5HGM A;  5F2O A;  3CXC O;  2L4B A;  1VQ8 P;  1KC8 Q;  2FAC A;  4COP A;  3I55 P;  1AYI A;  2L6E A;  2AFD A;  5HGO A;  2JGP A;  1VQ5 P;  2M8L A;  5HV8 A;  1QVF O;  2K92 A;  1L0I A;  2VSQ A;  2KGD A;  4F37 A;  1YJW P;  3CMA P;  1K73 Q;  2KOR A;  1DV5 A;  3DS5 A;  1S72 P;  1YHQ P;  2EG5 A;  4U0D A;  1E6J P;  4QNB A;  1VQ6 P;  3G29 A;  1Q82 Q;  2JBG A;  2GZJ A;  2KWL A;  3HYB A;  2AFE A;  1HY8 A;  2NO8 A;  2L22 A;  2FVE A;  4IPY A;  1CEI A;  2GDX A;  3CPW O;  3CCV P;  1N8R Q;  3CCS P;  2XV6 A;  2QEX P;  2MY5 A;  2KW2 A;  2PEI A;  3GKL C;  4PXH B;  1VKU A;  3GZL A;  4IZ6 A; 
#chains in the Genus database with same CATH homology
 4M0I A;  1K8A Q;  4XFZ A;  2PEM A;  3G26 A;  2PEN A;  2JYL A;  4U0E A;  4COC A;  2M8N A;  4U0C A;  2XXM A;  1YIT P;  1EOQ A;  3DTJ A;  4XFY A;  3CC2 P;  1K9M Q;  1M1K Q;  3G4S P;  3CCE P;  3G0V A;  4GR2 A;  3H4E A;  2OTJ P;  3CME P;  3DS3 A;  2Z45 A;  4U0F A;  1VQM P;  1M74 A;  2PEJ A;  2ONT A;  3CCM P;  5F2K A;  1A8O A;  1VQ7 P;  3G1G A;  1A43 A;  1EIA A;  5BS2 A;  1M6E X;  3DS0 A;  1RO2 A;  5BS1 A;  3DPH A;  1YI2 P;  1K30 A;  2JYG A;  4WYM A;  5F2O A;  5HGM A;  3CXC O;  1VQ9 P;  3G71 P;  2QA4 P;  5JPA A;  2LF4 A;  1VQ8 P;  1YJ9 P;  3LRY A;  1KC8 Q;  3CCL P;  3MGE A;  3G21 A;  1JJ2 O;  4COP A;  3I55 P;  3DS1 A;  4PH0 A;  2KOD A;  2Z44 A;  3DS2 A;  3CCJ P;  1RO0 A;  3CCR P;  4XRQ A;  1VQN P;  2PEQ A;  1YJN P;  2L6E A;  5HGO A;  4U0B A;  1NJI Q;  2M8P A;  1YIJ P;  3H47 A;  3CD6 P;  1VQ5 P;  3G28 A;  2M8L A;  1KQS O;  3I56 P;  1QVF O;  3G6E P;  4GR6 A;  3M1M A;  2PEO A;  1Q86 Q;  2EIA A;  3DS4 A;  1YJW P;  1KD1 Q;  2OAR A;  4XFX A;  3CMA P;  5HGL A;  1M90 Q;  1K73 Q;  1VQL P;  2BUO A;  1QRJ A;  5I4T G;  4XRO A;  2OTL P;  3DS5 A;  1S72 P;  3OW2 O;  3NTE A;  2EG5 A;  1YHQ P;  2DGY A;  4U0D A;  3VRL C;  1RNI A;  1IUQ A;  1E6J P;  4QNB A;  1QVG O;  3G29 A;  5F2N A;  1VQ6 P;  1ZMB A;  3CCU P;  5DCK A;  1Q82 Q;  4PH1 A;  3H0D A;  2CWO A;  1Q7Y Q;  2PY8 A;  2EFJ A;  2P9X A;  3RG6 C;  3HYB A;  1VQ4 P;  1VQO P;  1VQK P;  3WBH A;  2BHV A;  3E2D A;  4IPY A;  3CCV P;  3CPW O;  1VQP P;  4U0A A;  1AUM A;  1Q81 Q;  2JO0 A;  1D1D A;  1M6N A;  1N8R Q;  3CCQ P;  1W2B O;  2E1M A;  2XT1 A;  2Z46 A;  3Q20 A;  3G1I A;  3CCS P;  2XV6 A;  3P05 A;  2QEX P;  5HGN A;  3B5I A;  3CC4 P;  2PEI A;  2PEK A;  3CC7 P;  3HZQ A;  1BAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...