3RG6C

Crystal structure of a chaperone-bound assembly intermediate of form i rubisco
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLALWLHNFSAGKVQDGEKYIEELFLEKPDLALRIMTVREHIAEEIAEFLPEMVVTGIQQANMEKRRQHLERMTQVSLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Photosynthesis
molecule keywords Ribulose bisphosphate carboxylase large chain
total genus 37
structure length 115
sequence length 115
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3rg6C00
2Z46A 2PENA 3Q20A 4GR2A 5BS2A 2PEQA 2PY8A 3HYBA 4GR6A 2PEMA 3RG6C 2Z44A 5BS1A 2Z45A 2PEJA 2PEIA 2PEKA 2PEOA
chains in the Genus database with same CATH superfamily
2LIUA 1A8OA 2Z44A 4WYMA 2JU1A 1YJ9P 1YHQP 2LKIA 3GKLC 3EJDA 2OTLP 4COCA 5JPAA 4DG9A 5KP6B 1AF8A 1YITP 2FAEA 1S72P 2QNWA 3H47A 1VQ5P 2Z45A 3CD6P 4PH0A 2EHSA 2L9FA 2K5XA 3WBHA 2AF8A 2KGDA 2PEIA 2N6ZA 2KODA 2FQ2A 1Q7YQ 3CCEP 5HVCA 3DS0A 1K8AQ 1VQ8P 1JJ2O 2VLPA 2MR8A 2M8PA 3B5IA 3B4QA 2KGAA 1VQLP 2KG6A 3LMOA 2BHVA 2PNGA 2L4BA 3CCRP 3GJNA 2NO8A 2XT1A 2FHSC 1D1DA 3I55P 5F2KA 4HKGA 2GDXA 2KORA 2X2BA 2PEJA 2JGPA 2EIAA 2K94A 1VQOP 1Q81Q 3DS1A 1K73Q 1RNIA 3RG6C 1VQ6P 3RG2A 5F2NA 2FACA 2KGEA 4XROA 5HGNA 2DNWA 3EJBA 3CC2P 2M8NA 4M0IA 1VQNP 1M6NA 1DNYA 2OTJP 1E6JP 3OW2O 5I4TG 1E0HA 3G21A 2PEOA 5DCKA 2MVVA 5BS1A 1EOQA 1UJZA 1M90Q 4QKOA 4U0BA 2CWOA 1KQSO 2JYLA 2BUOA 2AFEA 2MVUA 4U0CA 2L6EA 4U0FA 2CG5B 2MF4A 1KC8Q 2L0QA 4BPHA 1Q86Q 2LOLA 1FR2A 1VQMP 2KW2A 5HV8A 4UHPB 2FQ1A 2L22A 2MR7A 2EFJA 1QVGO 3G28A 3NTEA 2FVEA 2LMLA 3HYBA 2LTEA 3CPWO 1GXHA 3I56P 2VLQA 3VRLC 5HGLA 2K92A 3LRYA 3CCLP 2JAZA 2LIWA 5EW5E 2MD9A 4IPYA 2PEQA 2CQ8A 1HY8A 3G1GA 3CC4P 1QRJA 3GZLA 1ACPA 3DS4A 1VQ7P 4PWVB 2ROQA 2JB0A 2PEKA 1X3OA 1YJNP 1M1KQ 4U0DA 2GDYA 2M5RA 3DTJA 2GZJA 1MZ8A 3G0VA 4XFZA 4XRQA 1M74A 4GR6A 2GZIA 3CE7A 1IMQA 3M1MA 5BS2A 3P05A 1T8KA 3U43A 2Z46A 2VSQA 2CGQA 3CCJP 1EIAA 2KWLA 3CXCO 1VQ4P 1NJIQ 2MY5A 3DPHA 2CNRA 2GDWA 2VLNA 4H2WC 3CCMP 2JBGA 2GYKA 1YJWP 2DGYA 2N98A 2P9XA 2K0XA 1NQ4A 3E2DA 2KOQA 4H2XC 2KGCA 1AUMA 2EHTA 2LF4A 2EG5A 2JQ4A 2E1MA 3CMAP 1GPJA 2ONTA 3CCVP 1YIJP 5CZDB 2FVFA 2XZ1C 1K30A 5KP8B 3EJEA 1A43A 1IMPA 3G6EP 1W2BO 5EJDA 1VQKP 5HGOA 2K2QA 3H4EA 1K9MQ 1GXGA 1VKUA 3Q20A 2WPTA 2K0YA 4BPGA 3CC7P 4MRTC 4H2YC 2K0DX 2N50A 3NY7B 1KLPA 2FVAA 1HQBA 4CA3A 1ZMBA 4COPA 5KP7B 4U0EA 2JYGA 1Z6MA 7CEIA 4F37A 1BAJA 2K93A 2N5HA 2JO0A 3HZQA 2FADA 2FQ0A 1Q82Q 3CCSP 1N8RQ 2AFDA 1L0IA 1L0HA 1VQ9P 2PENA 1OR5A 2N6YA 3G71P 2KG8A 3G1IA 3H0DA 1EMVA 5F2OA 1M6EX 1F80D 4BPFA 2QEXP 2PY8A 1YI2P 2XZ0D 4XFYA 2KR5A 2N5IA 5HGMA 2GZFA 1DV5A 1VQPP 2LPKA 3G4SP 3CCQP 3MGEA 2KOSA 4PH1A 1AYIA 1BXIA 2KG9A 4PXHB 2GZGA 2KOOA 3DS3A 4IZ6A 2OARA 3G29A 2XXMA 2GZEA 3CCUP 1RO0A 4U0AA 3DS2A 1CEIA 1ZNVA 3GZMA 1QVFO 2JU2A 2PEMA 2QA4P 2ERHA 4NEOA 2AVAA 4XFXA 1UNKA 3DS5A 4QNBA 1RO2A 3G26A 3CMEP 2M8LA 4R0MA 2LL8A 1IUQA 4GR2A 1KD1Q 2VLOA 2KOPA 2XV6A 1VHNA
chains in the Genus database with same CATH topology
3DTJA 1A8OA 3G0VA 4XFZA 2JYGA 1M74A 4GR6A 4XRQA 3OW2O 5I4TG 2Z44A 4WYMA 1YJ9P 3G21A 1BAJA 2PEOA 5DCKA 2JO0A 1YHQP 3HZQA 1Q82Q 3CCSP 5BS1A 1EOQA 1N8RQ 1VQ9P 3M1MA 2PENA 5BS2A 2OTLP 3G71P 3G1IA 3H0DA 3P05A 1M90Q 4U0BA 5F2OA 4COCA 5JPAA 2CWOA 2Z46A 1KQSO 2JYLA 1M6EX 2BUOA 4U0CA 2L6EA 4U0FA 3CCJP 1EIAA 2PY8A 3CXCO 2QEXP 1YITP 1KC8Q 1YI2P 1VQ4P 4XFYA 1NJIQ 1Q86Q 1VQMP 1S72P 5HGMA 3DPHA 3H47A 2EFJA 1VQ5P 1QVGO 1VQPP 2Z45A 3CD6P 4PH0A 3CCMP 3G4SP 3CCQP 3MGEA 3G28A 3WBHA 4PH1A 2PEIA 1YJWP 3NTEA 2KODA 2DGYA 2P9XA 1Q7YQ 3CCEP 3HYBA 3E2DA 3DS0A 3DS3A 1K8AQ 2OARA 1AUMA 2LF4A 1VQ8P 3CPWO 1JJ2O 2EG5A 2M8PA 2E1MA 3B5IA 3G29A 3CMAP 3I56P 3VRLC 2XXMA 2ONTA 5HGLA 3CCVP 1YIJP 3CCUP 1VQLP 1RO0A 1K30A 2BHVA 3CCRP 3LRYA 3CCLP 1A43A 2XT1A 4U0AA 3G6EP 3DS2A 1D1DA 4IPYA 1QVFO 3I55P 5F2KA 2PEQA 2PEMA 1W2BO 2QA4P 2PEJA 1VQKP 5HGOA 4XFXA 3H4EA 1K9MQ 2EIAA 3G1GA 3CC4P 1QRJA 3DS5A 1VQOP 1Q81Q 3DS4A 3Q20A 3DS1A 1K73Q 1RNIA 4QNBA 1VQ7P 3RG6C 5F2NA 1RO2A 3G26A 1VQ6P 4XROA 5HGNA 3CMEP 2M8LA 3CC7P 1IUQA 3CC2P 2M8NA 2PEKA 1YJNP 4M0IA 4GR2A 1KD1Q 1VQNP 1M1KQ 2XV6A 1M6NA 4U0DA 1ZMBA 4COPA 2OTJP 4U0EA 1E6JP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z46 A;  2PEN A;  3Q20 A;  4GR2 A;  5BS2 A;  2PEQ A;  2PY8 A;  3HYB A;  4GR6 A;  2PEM A;  3RG6 C;  2Z44 A;  5BS1 A;  2Z45 A;  2PEJ A;  2PEI A;  2PEK A;  2PEO A; 
#chains in the Genus database with same CATH topology
 2LIU A;  1A8O A;  2Z44 A;  4WYM A;  2JU1 A;  1YJ9 P;  1YHQ P;  2LKI A;  3GKL C;  3EJD A;  2OTL P;  4COC A;  5JPA A;  4DG9 A;  5KP6 B;  1AF8 A;  1YIT P;  2FAE A;  1S72 P;  2QNW A;  3H47 A;  1VQ5 P;  2Z45 A;  3CD6 P;  4PH0 A;  2EHS A;  2L9F A;  2K5X A;  3WBH A;  2AF8 A;  2KGD A;  2PEI A;  2N6Z A;  2KOD A;  2FQ2 A;  1Q7Y Q;  3CCE P;  5HVC A;  3DS0 A;  1K8A Q;  1VQ8 P;  1JJ2 O;  2VLP A;  2MR8 A;  2M8P A;  3B5I A;  3B4Q A;  2KGA A;  1VQL P;  2KG6 A;  3LMO A;  2BHV A;  2PNG A;  2L4B A;  3CCR P;  3GJN A;  2NO8 A;  2XT1 A;  2FHS C;  1D1D A;  3I55 P;  5F2K A;  4HKG A;  2GDX A;  2KOR A;  2X2B A;  2PEJ A;  2JGP A;  2EIA A;  2K94 A;  1VQO P;  1Q81 Q;  3DS1 A;  1K73 Q;  1RNI A;  3RG6 C;  1VQ6 P;  3RG2 A;  5F2N A;  2FAC A;  2KGE A;  4XRO A;  5HGN A;  2DNW A;  3EJB A;  3CC2 P;  2M8N A;  4M0I A;  1VQN P;  1M6N A;  1DNY A;  2OTJ P;  1E6J P;  3OW2 O;  5I4T G;  1E0H A;  3G21 A;  2PEO A;  5DCK A;  2MVV A;  5BS1 A;  1EOQ A;  1UJZ A;  1M90 Q;  4QKO A;  4U0B A;  2CWO A;  1KQS O;  2JYL A;  2BUO A;  2AFE A;  2MVU A;  4U0C A;  2L6E A;  4U0F A;  2CG5 B;  2MF4 A;  1KC8 Q;  2L0Q A;  4BPH A;  1Q86 Q;  2LOL A;  1FR2 A;  1VQM P;  2KW2 A;  5HV8 A;  4UHP B;  2FQ1 A;  2L22 A;  2MR7 A;  2EFJ A;  1QVG O;  3G28 A;  3NTE A;  2FVE A;  2LML A;  3HYB A;  2LTE A;  3CPW O;  1GXH A;  3I56 P;  2VLQ A;  3VRL C;  5HGL A;  2K92 A;  3LRY A;  3CCL P;  2JAZ A;  2LIW A;  5EW5 E;  2MD9 A;  4IPY A;  2PEQ A;  2CQ8 A;  1HY8 A;  3G1G A;  3CC4 P;  1QRJ A;  3GZL A;  1ACP A;  3DS4 A;  1VQ7 P;  4PWV B;  2ROQ A;  2JB0 A;  2PEK A;  1X3O A;  1YJN P;  1M1K Q;  4U0D A;  2GDY A;  2M5R A;  3DTJ A;  2GZJ A;  1MZ8 A;  3G0V A;  4XFZ A;  4XRQ A;  1M74 A;  4GR6 A;  2GZI A;  3CE7 A;  1IMQ A;  3M1M A;  5BS2 A;  3P05 A;  1T8K A;  3U43 A;  2Z46 A;  2VSQ A;  2CGQ A;  3CCJ P;  1EIA A;  2KWL A;  3CXC O;  1VQ4 P;  1NJI Q;  2MY5 A;  3DPH A;  2CNR A;  2GDW A;  2VLN A;  4H2W C;  3CCM P;  2JBG A;  2GYK A;  1YJW P;  2DGY A;  2N98 A;  2P9X A;  2K0X A;  1NQ4 A;  3E2D A;  2KOQ A;  4H2X C;  2KGC A;  1AUM A;  2EHT A;  2LF4 A;  2EG5 A;  2JQ4 A;  2E1M A;  3CMA P;  1GPJ A;  2ONT A;  3CCV P;  1YIJ P;  5CZD B;  2FVF A;  2XZ1 C;  1K30 A;  5KP8 B;  3EJE A;  1A43 A;  1IMP A;  3G6E P;  1W2B O;  5EJD A;  1VQK P;  5HGO A;  2K2Q A;  3H4E A;  1K9M Q;  1GXG A;  1VKU A;  3Q20 A;  2WPT A;  2K0Y A;  4BPG A;  3CC7 P;  4MRT C;  4H2Y C;  2K0D X;  2N50 A;  3NY7 B;  1KLP A;  2FVA A;  1HQB A;  4CA3 A;  1ZMB A;  4COP A;  5KP7 B;  4U0E A;  2JYG A;  1Z6M A;  7CEI A;  4F37 A;  1BAJ A;  2K93 A;  2N5H A;  2JO0 A;  3HZQ A;  2FAD A;  2FQ0 A;  1Q82 Q;  3CCS P;  1N8R Q;  2AFD A;  1L0I A;  1L0H A;  1VQ9 P;  2PEN A;  1OR5 A;  2N6Y A;  3G71 P;  2KG8 A;  3G1I A;  3H0D A;  1EMV A;  5F2O A;  1M6E X;  1F80 D;  4BPF A;  2QEX P;  2PY8 A;  1YI2 P;  2XZ0 D;  4XFY A;  2KR5 A;  2N5I A;  5HGM A;  2GZF A;  1DV5 A;  1VQP P;  2LPK A;  3G4S P;  3CCQ P;  3MGE A;  2KOS A;  4PH1 A;  1AYI A;  1BXI A;  2KG9 A;  4PXH B;  2GZG A;  2KOO A;  3DS3 A;  4IZ6 A;  2OAR A;  3G29 A;  2XXM A;  2GZE A;  3CCU P;  1RO0 A;  4U0A A;  3DS2 A;  1CEI A;  1ZNV A;  3GZM A;  1QVF O;  2JU2 A;  2PEM A;  2QA4 P;  2ERH A;  4NEO A;  2AVA A;  4XFX A;  1UNK A;  3DS5 A;  4QNB A;  1RO2 A;  3G26 A;  3CME P;  2M8L A;  4R0M A;  2LL8 A;  1IUQ A;  4GR2 A;  1KD1 Q;  2VLO A;  2KOP A;  2XV6 A;  1VHN A; 
#chains in the Genus database with same CATH homology
 3DTJ A;  1A8O A;  3G0V A;  4XFZ A;  2JYG A;  1M74 A;  4GR6 A;  4XRQ A;  3OW2 O;  5I4T G;  2Z44 A;  4WYM A;  1YJ9 P;  3G21 A;  1BAJ A;  2PEO A;  5DCK A;  2JO0 A;  1YHQ P;  3HZQ A;  1Q82 Q;  3CCS P;  5BS1 A;  1EOQ A;  1N8R Q;  1VQ9 P;  3M1M A;  2PEN A;  5BS2 A;  2OTL P;  3G71 P;  3G1I A;  3H0D A;  3P05 A;  1M90 Q;  4U0B A;  5F2O A;  4COC A;  5JPA A;  2CWO A;  2Z46 A;  1KQS O;  2JYL A;  1M6E X;  2BUO A;  4U0C A;  2L6E A;  4U0F A;  3CCJ P;  1EIA A;  2PY8 A;  3CXC O;  2QEX P;  1YIT P;  1KC8 Q;  1YI2 P;  1VQ4 P;  4XFY A;  1NJI Q;  1Q86 Q;  1VQM P;  1S72 P;  5HGM A;  3DPH A;  3H47 A;  2EFJ A;  1VQ5 P;  1QVG O;  1VQP P;  2Z45 A;  3CD6 P;  4PH0 A;  3CCM P;  3G4S P;  3CCQ P;  3MGE A;  3G28 A;  3WBH A;  4PH1 A;  2PEI A;  1YJW P;  3NTE A;  2KOD A;  2DGY A;  2P9X A;  1Q7Y Q;  3CCE P;  3HYB A;  3E2D A;  3DS0 A;  3DS3 A;  1K8A Q;  2OAR A;  1AUM A;  2LF4 A;  1VQ8 P;  3CPW O;  1JJ2 O;  2EG5 A;  2M8P A;  2E1M A;  3B5I A;  3G29 A;  3CMA P;  3I56 P;  3VRL C;  2XXM A;  2ONT A;  5HGL A;  3CCV P;  1YIJ P;  3CCU P;  1VQL P;  1RO0 A;  1K30 A;  2BHV A;  3CCR P;  3LRY A;  3CCL P;  1A43 A;  2XT1 A;  4U0A A;  3G6E P;  3DS2 A;  1D1D A;  4IPY A;  1QVF O;  3I55 P;  5F2K A;  2PEQ A;  2PEM A;  1W2B O;  2QA4 P;  2PEJ A;  1VQK P;  5HGO A;  4XFX A;  3H4E A;  1K9M Q;  2EIA A;  3G1G A;  3CC4 P;  1QRJ A;  3DS5 A;  1VQO P;  1Q81 Q;  3DS4 A;  3Q20 A;  3DS1 A;  1K73 Q;  1RNI A;  4QNB A;  1VQ7 P;  3RG6 C;  5F2N A;  1RO2 A;  3G26 A;  1VQ6 P;  4XRO A;  5HGN A;  3CME P;  2M8L A;  3CC7 P;  1IUQ A;  3CC2 P;  2M8N A;  2PEK A;  1YJN P;  4M0I A;  4GR2 A;  1KD1 Q;  1VQN P;  1M1K Q;  2XV6 A;  1M6N A;  4U0D A;  1ZMB A;  4COP A;  2OTJ P;  4U0E A;  1E6J P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...