3RG6C

Crystal structure of a chaperone-bound assembly intermediate of form i rubisco
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLALWLHNFSAGKVQDGEKYIEELFLEKPDLALRIMTVREHIAEEIAEFLPEMVVTGIQQANMEKRRQHLERMTQVSLSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose bisphosphate carboxylase large chain
publication title Crystal structure of a chaperone-bound assembly intermediate of form I Rubisco.
pubmed doi rcsb
source organism Synechococcus elongatus
molecule tags Photosynthesis
total genus 37
structure length 115
sequence length 115
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2011-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3rg6C00
2PEOA 3HYBA 2PEJA 2PENA 3Q20A 2Z44A 4GR2A 2PEKA 2PY8A 3RG6C 5BS1A 2PEIA 5BS2A 2Z46A 2PEMA 2PEQA 4GR6A 2Z45A
chains in the Genus database with same CATH superfamily
3I55P 3NY7B 5DCKA 4QNBA 2GZFA 4IZ6A 2PEJA 2KORA 3CCMP 2PEQA 5HGOA 2K93A 2CWOA 2EHSA 2PEKA 1VQ7P 3HZQA 4XFYA 3GZLA 2DGYA 2EFJA 2JAZA 2GYKA 4BPHA 1BAJA 1A43A 2K94A 2FQ2A 4U0AA 2K0XA 5F2KA 1VQPP 3G26A 5HGNA 2GZJA 4H2YC 3G6EP 4U0FA 2JYLA 2GZGA 1GPJA 2GDYA 3RG2A 1VQNP 2JB0A 4PH1A 3DS4A 3I56P 3B5IA 2L22A 2LKIA 4R0MA 2CGQA 2DNWA 2XZ1C 5F2OA 1VQKP 1W2BO 3GKLC 1VKUA 2BHVA 4BPGA 2FQ1A 3NTEA 3CC2P 2E1MA 2N6ZA 2FVFA 4XFXA 2JO0A 2PENA 2KR5A 1K30A 2N5HA 1RO0A 1M6NA 2AFDA 1YJWP 2PEOA 3E2DA 2VLQA 2KGAA 1JJ2O 2MF4A 2L6EA 5JPAA 4U0BA 1IMPA 1DV5A 4DG9A 4PWVB 3G1GA 3CC7P 2JGPA 3CCEP 3VRLC 1YITP 2N50A 1EOQA 5EJDA 3M1MA 2KOQA 1HY8A 2WPTA 2QA4P 1K8AQ 2L9FA 1YJ9P 2KG9A 2ONTA 3G21A 3G0VA 2PY8A 5KP7B 2EHTA 1T8KA 1HQBA 2KWLA 1L0HA 2GZEA 1EMVA 3P05A 7CEIA 1NQ4A 1VQLP 2JU1A 3CMAP 1YHQP 5HGLA 1KLPA 1RO2A 3MGEA 1Z6MA 2KODA 4XFZA 3CCLP 4XRQA 1F80D 5BS2A 3LMOA 3H47A 2KOPA 3CCSP 1VQ9P 3DS2A 1X3OA 2XXMA 4QKOA 2VLNA 2VSQA 5HV8A 1YIJP 3RG6C 2MVVA 2KGCA 2CG5B 2FAEA 1M74A 2LOLA 3EJEA 3LRYA 3CCJP 3G1IA 2JBGA 3OW2O 1ZMBA 4CA3A 4PH0A 4U0CA 1YJNP 2ROQA 3DPHA 2Z45A 3G4SP 1K73Q 2QEXP 1MZ8A 1KC8Q 1VQ4P 2FHSC 1L0IA 1N8RQ 3CCQP 2XT1A 4BPFA 1M1KQ 1D1DA 2KGDA 2AF8A 2JQ4A 5EW5E 2LIWA 1IMQA 2M8PA 3DS0A 2LIUA 1OR5A 3G28A 1AUMA 4H2WC 2FADA 2M5RA 2CQ8A 5HGMA 3CCRP 2KG6A 3DS5A 5CZDB 3GJNA 2AFEA 1Q82Q 3DTJA 2LL8A 1QVGO 3CMEP 1M90Q 4NEOA 3CXCO 3CPWO 1ACPA 3B4QA 2M8NA 2K0YA 2CNRA 2AVAA 4H2XC 1E6JP 5BS1A 2MR7A 2FQ0A 1VQMP 2JU2A 3HYBA 1A8OA 2EG5A 3EJBA 2L4BA 1GXHA 2ERHA 2N5IA 2NO8A 1VQ5P 3G29A 3CC4P 2BUOA 3H4EA 2K92A 2FACA 2MY5A 2QNWA 4IPYA 2XV6A 1K9MQ 4M0IA 2GDWA 4GR2A 2JYGA 5KP8B 2X2BA 1BXIA 3CD6P 1VHNA 2MD9A 2LPKA 5I4TG 1ZNVA 2N98A 4COCA 1DNYA 4COPA 2K2QA 1NJIQ 1VQOP 2FVAA 2EIAA 3CE7A 2K0DX 4WYMA 4U0EA 2OTLP 1RNIA 2OTJP 2L0QA 4MRTC 2PEIA 2OARA 2KGEA 1AYIA 4UHPB 4HKGA 1GXGA 1VQ8P 2KG8A 1M6EX 2XZ0D 4XROA 2PEMA 1EIAA 2GDXA 1KD1Q 4U0DA 1QRJA 1CEIA 2Z46A 2LF4A 2N6YA 3U43A 2KOSA 2KOOA 1AF8A 2VLPA 2GZIA 2LMLA 4GR6A 1YI2P 1Q86Q 3H0DA 3Q20A 1S72P 3CCUP 5F2NA 2MVUA 3DS1A 2LTEA 1VQ6P 3EJDA 4PXHB 1FR2A 1IUQA 3GZMA 2Z44A 5KP6B 2M8LA 4F37A 2FVEA 2P9XA 2MR8A 3WBHA 2PNGA 3DS3A 2KW2A 1UNKA 5HVCA 1KQSO 1Q7YQ 1E0HA 1Q81Q 1QVFO 3G71P 2K5XA 1UJZA 2VLOA 3CCVP
chains in the Genus database with same CATH topology
3I55P 1EOQA 5DCKA 1D1DA 4WYMA 3M1MA 4U0EA 2OTLP 1RNIA 4QNBA 2OTJP 2PEJA 3CCMP 2PEIA 2M8PA 2OARA 2PEQA 5HGOA 2CWOA 3DS0A 2QA4P 1K8AQ 2PEKA 1VQ7P 3HZQA 1YJ9P 4XFYA 2ONTA 3G21A 1VQ8P 2DGYA 3G0VA 2EFJA 2PY8A 1M6EX 1BAJA 1A43A 3G28A 4U0AA 1AUMA 4XROA 5F2KA 2PEMA 1VQPP 1EIAA 3P05A 1KD1Q 3G26A 4U0DA 5HGNA 1VQLP 1QRJA 5HGMA 3CMAP 2Z46A 2LF4A 3G6EP 5HGLA 3CCRP 1YHQP 4U0FA 3DS5A 2JYLA 1RO2A 3MGEA 2KODA 4XFZA 3CCLP 1Q82Q 3DTJA 4GR6A 1YI2P 1Q86Q 1QVGO 3H0DA 1VQNP 4PH1A 3Q20A 1S72P 4XRQA 3DS4A 5BS2A 3I56P 3CMEP 1M90Q 3B5IA 3CXCO 3CPWO 3H47A 3CCUP 2M8NA 5F2NA 3CCSP 1VQ9P 3DS2A 5F2OA 2XXMA 3DS1A 1VQKP 1VQ6P 1YIJP 1W2BO 1E6JP 3RG6C 5BS1A 1VQMP 2BHVA 3NTEA 3CC2P 2E1MA 1IUQA 3HYBA 1A8OA 2Z44A 2M8LA 2EG5A 4XFXA 1M74A 2JO0A 2PENA 3LRYA 3CCJP 3G1IA 1K30A 3OW2O 2P9XA 3G29A 1RO0A 1M6NA 1VQ5P 3CC4P 1ZMBA 2BUOA 2PEOA 1YJWP 4PH0A 3H4EA 4U0CA 1YJNP 3E2DA 3DPHA 3WBHA 4IPYA 2XV6A 2Z45A 1K9MQ 1JJ2O 4M0IA 3DS3A 4GR2A 2L6EA 2JYGA 3G4SP 5JPAA 4U0BA 1KQSO 1Q7YQ 1K73Q 3CD6P 1Q81Q 1QVFO 3G71P 2QEXP 3G1GA 5I4TG 1KC8Q 1VQ4P 3CC7P 3CCEP 1N8RQ 3CCQP 3VRLC 4COCA 2XT1A 4COPA 1YITP 1NJIQ 1VQOP 1M1KQ 3CCVP 2EIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEO A;  3HYB A;  2PEJ A;  2PEN A;  3Q20 A;  2Z44 A;  4GR2 A;  2PEK A;  2PY8 A;  3RG6 C;  5BS1 A;  2PEI A;  5BS2 A;  2Z46 A;  2PEM A;  2PEQ A;  4GR6 A;  2Z45 A; 
#chains in the Genus database with same CATH topology
 3I55 P;  3NY7 B;  5DCK A;  4QNB A;  2GZF A;  4IZ6 A;  2PEJ A;  2KOR A;  3CCM P;  2PEQ A;  5HGO A;  2K93 A;  2CWO A;  2EHS A;  2PEK A;  1VQ7 P;  3HZQ A;  4XFY A;  3GZL A;  2DGY A;  2EFJ A;  2JAZ A;  2GYK A;  4BPH A;  1BAJ A;  1A43 A;  2K94 A;  2FQ2 A;  4U0A A;  2K0X A;  5F2K A;  1VQP P;  3G26 A;  5HGN A;  2GZJ A;  4H2Y C;  3G6E P;  4U0F A;  2JYL A;  2GZG A;  1GPJ A;  2GDY A;  3RG2 A;  1VQN P;  2JB0 A;  4PH1 A;  3DS4 A;  3I56 P;  3B5I A;  2L22 A;  2LKI A;  4R0M A;  2CGQ A;  2DNW A;  2XZ1 C;  5F2O A;  1VQK P;  1W2B O;  3GKL C;  1VKU A;  2BHV A;  4BPG A;  2FQ1 A;  3NTE A;  3CC2 P;  2E1M A;  2N6Z A;  2FVF A;  4XFX A;  2JO0 A;  2PEN A;  2KR5 A;  1K30 A;  2N5H A;  1RO0 A;  1M6N A;  2AFD A;  1YJW P;  2PEO A;  3E2D A;  2VLQ A;  2KGA A;  1JJ2 O;  2MF4 A;  2L6E A;  5JPA A;  4U0B A;  1IMP A;  1DV5 A;  4DG9 A;  4PWV B;  3G1G A;  3CC7 P;  2JGP A;  3CCE P;  3VRL C;  1YIT P;  2N50 A;  1EOQ A;  5EJD A;  3M1M A;  2KOQ A;  1HY8 A;  2WPT A;  2QA4 P;  1K8A Q;  2L9F A;  1YJ9 P;  2KG9 A;  2ONT A;  3G21 A;  3G0V A;  2PY8 A;  5KP7 B;  2EHT A;  1T8K A;  1HQB A;  2KWL A;  1L0H A;  2GZE A;  1EMV A;  3P05 A;  7CEI A;  1NQ4 A;  1VQL P;  2JU1 A;  3CMA P;  1YHQ P;  5HGL A;  1KLP A;  1RO2 A;  3MGE A;  1Z6M A;  2KOD A;  4XFZ A;  3CCL P;  4XRQ A;  1F80 D;  5BS2 A;  3LMO A;  3H47 A;  2KOP A;  3CCS P;  1VQ9 P;  3DS2 A;  1X3O A;  2XXM A;  4QKO A;  2VLN A;  2VSQ A;  5HV8 A;  1YIJ P;  3RG6 C;  2MVV A;  2KGC A;  2CG5 B;  2FAE A;  1M74 A;  2LOL A;  3EJE A;  3LRY A;  3CCJ P;  3G1I A;  2JBG A;  3OW2 O;  1ZMB A;  4CA3 A;  4PH0 A;  4U0C A;  1YJN P;  2ROQ A;  3DPH A;  2Z45 A;  3G4S P;  1K73 Q;  2QEX P;  1MZ8 A;  1KC8 Q;  1VQ4 P;  2FHS C;  1L0I A;  1N8R Q;  3CCQ P;  2XT1 A;  4BPF A;  1M1K Q;  1D1D A;  2KGD A;  2AF8 A;  2JQ4 A;  5EW5 E;  2LIW A;  1IMQ A;  2M8P A;  3DS0 A;  2LIU A;  1OR5 A;  3G28 A;  1AUM A;  4H2W C;  2FAD A;  2M5R A;  2CQ8 A;  5HGM A;  3CCR P;  2KG6 A;  3DS5 A;  5CZD B;  3GJN A;  2AFE A;  1Q82 Q;  3DTJ A;  2LL8 A;  1QVG O;  3CME P;  1M90 Q;  4NEO A;  3CXC O;  3CPW O;  1ACP A;  3B4Q A;  2M8N A;  2K0Y A;  2CNR A;  2AVA A;  4H2X C;  1E6J P;  5BS1 A;  2MR7 A;  2FQ0 A;  1VQM P;  2JU2 A;  3HYB A;  1A8O A;  2EG5 A;  3EJB A;  2L4B A;  1GXH A;  2ERH A;  2N5I A;  2NO8 A;  1VQ5 P;  3G29 A;  3CC4 P;  2BUO A;  3H4E A;  2K92 A;  2FAC A;  2MY5 A;  2QNW A;  4IPY A;  2XV6 A;  1K9M Q;  4M0I A;  2GDW A;  4GR2 A;  2JYG A;  5KP8 B;  2X2B A;  1BXI A;  3CD6 P;  1VHN A;  2MD9 A;  2LPK A;  5I4T G;  1ZNV A;  2N98 A;  4COC A;  1DNY A;  4COP A;  2K2Q A;  1NJI Q;  1VQO P;  2FVA A;  2EIA A;  3CE7 A;  2K0D X;  4WYM A;  4U0E A;  2OTL P;  1RNI A;  2OTJ P;  2L0Q A;  4MRT C;  2PEI A;  2OAR A;  2KGE A;  1AYI A;  4UHP B;  4HKG A;  1GXG A;  1VQ8 P;  2KG8 A;  1M6E X;  2XZ0 D;  4XRO A;  2PEM A;  1EIA A;  2GDX A;  1KD1 Q;  4U0D A;  1QRJ A;  1CEI A;  2Z46 A;  2LF4 A;  2N6Y A;  3U43 A;  2KOS A;  2KOO A;  1AF8 A;  2VLP A;  2GZI A;  2LML A;  4GR6 A;  1YI2 P;  1Q86 Q;  3H0D A;  3Q20 A;  1S72 P;  3CCU P;  5F2N A;  2MVU A;  3DS1 A;  2LTE A;  1VQ6 P;  3EJD A;  4PXH B;  1FR2 A;  1IUQ A;  3GZM A;  2Z44 A;  5KP6 B;  2M8L A;  4F37 A;  2FVE A;  2P9X A;  2MR8 A;  3WBH A;  2PNG A;  3DS3 A;  2KW2 A;  1UNK A;  5HVC A;  1KQS O;  1Q7Y Q;  1E0H A;  1Q81 Q;  1QVF O;  3G71 P;  2K5X A;  1UJZ A;  2VLO A;  3CCV P; 
#chains in the Genus database with same CATH homology
 3I55 P;  1EOQ A;  5DCK A;  1D1D A;  4WYM A;  3M1M A;  4U0E A;  2OTL P;  1RNI A;  4QNB A;  2OTJ P;  2PEJ A;  3CCM P;  2PEI A;  2M8P A;  2OAR A;  2PEQ A;  5HGO A;  2CWO A;  3DS0 A;  2QA4 P;  1K8A Q;  2PEK A;  1VQ7 P;  3HZQ A;  1YJ9 P;  4XFY A;  2ONT A;  3G21 A;  1VQ8 P;  2DGY A;  3G0V A;  2EFJ A;  2PY8 A;  1M6E X;  1BAJ A;  1A43 A;  3G28 A;  4U0A A;  1AUM A;  4XRO A;  5F2K A;  2PEM A;  1VQP P;  1EIA A;  3P05 A;  1KD1 Q;  3G26 A;  4U0D A;  5HGN A;  1VQL P;  1QRJ A;  5HGM A;  3CMA P;  2Z46 A;  2LF4 A;  3G6E P;  5HGL A;  3CCR P;  1YHQ P;  4U0F A;  3DS5 A;  2JYL A;  1RO2 A;  3MGE A;  2KOD A;  4XFZ A;  3CCL P;  1Q82 Q;  3DTJ A;  4GR6 A;  1YI2 P;  1Q86 Q;  1QVG O;  3H0D A;  1VQN P;  4PH1 A;  3Q20 A;  1S72 P;  4XRQ A;  3DS4 A;  5BS2 A;  3I56 P;  3CME P;  1M90 Q;  3B5I A;  3CXC O;  3CPW O;  3H47 A;  3CCU P;  2M8N A;  5F2N A;  3CCS P;  1VQ9 P;  3DS2 A;  5F2O A;  2XXM A;  3DS1 A;  1VQK P;  1VQ6 P;  1YIJ P;  1W2B O;  1E6J P;  3RG6 C;  5BS1 A;  1VQM P;  2BHV A;  3NTE A;  3CC2 P;  2E1M A;  1IUQ A;  3HYB A;  1A8O A;  2Z44 A;  2M8L A;  2EG5 A;  4XFX A;  1M74 A;  2JO0 A;  2PEN A;  3LRY A;  3CCJ P;  3G1I A;  1K30 A;  3OW2 O;  2P9X A;  3G29 A;  1RO0 A;  1M6N A;  1VQ5 P;  3CC4 P;  1ZMB A;  2BUO A;  2PEO A;  1YJW P;  4PH0 A;  3H4E A;  4U0C A;  1YJN P;  3E2D A;  3DPH A;  3WBH A;  4IPY A;  2XV6 A;  2Z45 A;  1K9M Q;  1JJ2 O;  4M0I A;  3DS3 A;  4GR2 A;  2L6E A;  2JYG A;  3G4S P;  5JPA A;  4U0B A;  1KQS O;  1Q7Y Q;  1K73 Q;  3CD6 P;  1Q81 Q;  1QVF O;  3G71 P;  2QEX P;  3G1G A;  5I4T G;  1KC8 Q;  1VQ4 P;  3CC7 P;  3CCE P;  1N8R Q;  3CCQ P;  3VRL C;  4COC A;  2XT1 A;  4COP A;  1YIT P;  1NJI Q;  1VQO P;  1M1K Q;  3CCV P;  2EIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...