3DS0A

Hiv-1 capsid c-terminal domain mutant (n183a) in complex with an inhibitor of particle assembly (cai)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKAWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 CAPSID PROTEIN
total genus 26
structure length 82
sequence length 82
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds0A00
1AUMA 3DPHA 2M8PA 3DS1A 3G21A 3DS3A 4IPYA 4U0AA 4U0CA 2L6EA 4XFYA 1QRJA 2XT1A 3G1IA 4U0BA 3DS2A 2JO0A 2JYLA 1EOQA 4U0DA 3DS0A 2M8NA 1A8OA 1A43A 2KODA 3H47A 5I4TG 4COCA 4M0IA 5HGNA 2EIAA 3DS5A 1EIAA 3G28A 3G26A 3DTJA 2BUOA 4U0FA 4XFZA 4COPA 5HGOA 4PH1A 4XRQA 3VRLC 1E6JP 3G1GA 2XXMA 3MGEA 3P05A 1D1DA 3DS4A 3G29A 3LRYA 4QNBA 2ONTA 4XFXA 3G0VA 5DCKA 5JPAA 3NTEA 4XROA 4U0EA 2LF4A 1BAJA 3H4EA 5HGMA 4PH0A 5HGLA 2XV6A 2M8LA 2JYGA 4WYMA
chains in the Genus database with same CATH superfamily
1HQBA 4U0AA 4IPYA 1VQPP 1YITP 2EHSA 2JBGA 4U0DA 1K73Q 2FQ2A 2Z44A 2L4BA 2N98A 4H2XC 2PEIA 1RNIA 2XXMA 1Q82Q 4XFXA 2AF8A 2NO8A 2M8LA 1L0HA 3DPHA 1M74A 2AVAA 2XT1A 2LIUA 5BS2A 2OTJP 2LTEA 2KOSA 3G26A 3EJEA 2FVFA 2L9FA 4U0FA 1VQLP 5HGOA 2LMLA 4PH1A 1VQ5P 3RG2A 2EHTA 3G0VA 4BPGA 1QVFO 1RO0A 3G6EP 1M6NA 1M1KQ 1JJ2O 2L6EA 2WPTA 1YJWP 3GZLA 2GZIA 5HVCA 2FVAA 2M8NA 3H47A 5HGNA 3DS5A 4XRQA 5KP7B 3G29A 7CEIA 5JPAA 2K0XA 3CCUP 4R0MA 4XROA 1GXHA 1F80D 2LPKA 2XZ0D 1VQ4P 4BPFA 2K5XA 4HKGA 3EJBA 1EOQA 1YHQP 2KG6A 2VSQA 3CC4P 1N8RQ 1AYIA 4GR6A 3MGEA 3G4SP 3NTEA 3CCRP 4PH0A 4H2YC 1CEIA 3CPWO 3DS1A 2DNWA 5F2OA 1ZNVA 2XZ1C 1A43A 2PEMA 2JU2A 4PWVB 3CCVP 1YJNP 1KLPA 3Q20A 3CXCO 5CZDB 3DS4A 3CCSP 2JU1A 3CCQP 1IUQA 4IZ6A 3WBHA 2LL8A 1VQKP 3DS3A 1EMVA 2CG5B 1OR5A 2JB0A 1K8AQ 4M0IA 3NY7B 3VRLC 2CNRA 1BXIA 2GZFA 4CA3A 1BAJA 3H4EA 2LOLA 1GXGA 1QVGO 2CQ8A 2E1MA 4MRTC 2AFDA 2QEXP 1VQNP 2MF4A 3DS2A 3GKLC 2KODA 2KR5A 3GJNA 2JQ4A 3CCMP 3DTJA 2EFJA 3M1MA 2OARA 2GDWA 2PEOA 2L22A 2LIWA 4NEOA 2MVVA 2GZJA 4U0EA 1FR2A 4QKOA 1KD1Q 2JYLA 2PEQA 2KOQA 1RO2A 2EIAA 2AFEA 3G28A 1W2BO 3CC2P 4PXHB 1VQ9P 1Z6MA 3CMAP 2ERHA 3OW2O 3GZMA 1VQMP 1M6EX 3H0DA 4WYMA 4U0CA 2JAZA 2P9XA 5EJDA 1Q7YQ 2KGEA 3CC7P 2CGQA 4BPHA 2FVEA 3U43A 4QNBA 3CD6P 2K94A 5HGMA 1E0HA 1DV5A 2FADA 1KC8Q 1QRJA 2PEJA 4DG9A 1NJIQ 3CMEP 3HYBA 1YI2P 3CE7A 1AF8A 2MR8A 2KOOA 5DCKA 2FACA 1ACPA 1KQSO 2Z45A 2FHSC 1X3OA 1YIJP 1T8KA 4GR2A 1VQ6P 1VQOP 1Q81Q 3B4QA 1VQ8P 1MZ8A 2OTLP 4UHPB 2CWOA 1YJ9P 2DGYA 1UJZA 1NQ4A 1L0IA 2FAEA 2BUOA 2N5IA 2VLPA 2ROQA 2EG5A 3RG6C 2K0DX 5F2KA 4COCA 5BS1A 2FQ0A 5HV8A 1D1DA 1IMQA 2GZGA 2PEKA 2KGDA 2GYKA 2JYGA 2LKIA 3G21A 1K30A 3G71P 1GPJA 2JO0A 5EW5E 5I4TG 3I56P 1K9MQ 1HY8A 2N50A 3HZQA 2MD9A 3LRYA 5KP8B 2L0QA 2LF4A 2KORA 2VLOA 2KG8A 3B5IA 2K2QA 2M8PA 2GDXA 2KG9A 3G1IA 2QNWA 3DS0A 1VHNA 2K92A 4H2WC 1VQ7P 4XFZA 3CCLP 3G1GA 2KWLA 1M90Q 2X2BA 4F37A 1Q86Q 2ONTA 1IMPA 2VLNA 2PENA 2N5HA 4XFYA 2K93A 4U0BA 2PNGA 3E2DA 1VKUA 1UNKA 2BHVA 3CCJP 2K0YA 5F2NA 1E6JP 3CCEP 2FQ1A 2MVUA 3LMOA 2Z46A 2GZEA 2XV6A 1AUMA 2GDYA 2KGAA 2N6ZA 1DNYA 1A8OA 5KP6B 2JGPA 1EIAA 2KW2A 2KOPA 4COPA 2QA4P 2PY8A 3P05A 3I55P 1ZMBA 3EJDA 1S72P 2KGCA 2N6YA 2MR7A 5HGLA 2M5RA 2VLQA 2MY5A
chains in the Genus database with same CATH topology
3CPWO 4U0AA 4IPYA 3DS1A 3G21A 4U0CA 1VQPP 1YITP 1K30A 3G71P 2P9XA 5F2OA 1Q7YQ 2JO0A 4U0DA 3CC7P 5I4TG 1A43A 1K73Q 2PEMA 2Z44A 3CCVP 3I56P 1YJNP 1K9MQ 2PEIA 3Q20A 1RNIA 3HZQA 2XXMA 3CXCO 1Q82Q 3DS4A 3LRYA 4QNBA 3CCSP 4XFXA 3CD6P 3CCQP 2LF4A 1IUQA 5HGMA 3WBHA 3B5IA 2M8LA 1KC8Q 3DPHA 1VQKP 2M8PA 3DS3A 1M74A 1QRJA 2XT1A 3G1IA 2PEJA 5BS2A 2OTJP 3DS0A 1K8AQ 1NJIQ 4M0IA 3CMEP 3HYBA 1YI2P 3G26A 1VQ7P 4U0FA 4XFZA 1VQLP 5HGOA 3CCLP 4PH1A 1VQ5P 3VRLC 3G1GA 1M90Q 1Q86Q 5DCKA 2ONTA 3G0VA 1KQSO 1QVFO 1BAJA 3H4EA 1RO0A 2Z45A 2PENA 3G6EP 1QVGO 1M6NA 1M1KQ 2E1MA 2QEXP 1JJ2O 1VQNP 2L6EA 1YIJP 4XFYA 1YJWP 4GR2A 4U0BA 3DS2A 1VQ6P 1VQOP 2M8NA 1Q81Q 2KODA 3E2DA 3H47A 5HGNA 3DS5A 1VQ8P 2OTLP 3CCMP 3DTJA 2EFJA 3M1MA 2OARA 2BHVA 2CWOA 2PEOA 3CCJP 5F2NA 4XRQA 1E6JP 3CCEP 1YJ9P 3G29A 2DGYA 5JPAA 3CCUP 4XROA 2Z46A 4U0EA 2XV6A 2BUOA 1VQ4P 1AUMA 1KD1Q 2EG5A 1EOQA 2JYLA 2PEQA 3RG6C 1YHQP 1A8OA 5F2KA 1RO2A 4COCA 2EIAA 3CC4P 5BS1A 1EIAA 3G28A 1N8RQ 1W2BO 4COPA 3CC2P 2QA4P 2PY8A 3P05A 3MGEA 4GR6A 3I55P 3CMAP 1VQ9P 1ZMBA 3G4SP 1D1DA 3OW2O 1S72P 3NTEA 3CCRP 4PH0A 2PEKA 5HGLA 1VQMP 1M6EX 3H0DA 2JYGA 4WYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUM A;  3DPH A;  2M8P A;  3DS1 A;  3G21 A;  3DS3 A;  4IPY A;  4U0A A;  4U0C A;  2L6E A;  4XFY A;  1QRJ A;  2XT1 A;  3G1I A;  4U0B A;  3DS2 A;  2JO0 A;  2JYL A;  1EOQ A;  4U0D A;  3DS0 A;  2M8N A;  1A8O A;  1A43 A;  2KOD A;  3H47 A;  5I4T G;  4COC A;  4M0I A;  5HGN A;  2EIA A;  3DS5 A;  1EIA A;  3G28 A;  3G26 A;  3DTJ A;  2BUO A;  4U0F A;  4XFZ A;  4COP A;  5HGO A;  4PH1 A;  4XRQ A;  3VRL C;  1E6J P;  3G1G A;  2XXM A;  3MGE A;  3P05 A;  1D1D A;  3DS4 A;  3G29 A;  3LRY A;  4QNB A;  2ONT A;  4XFX A;  3G0V A;  5DCK A;  5JPA A;  3NTE A;  4XRO A;  4U0E A;  2LF4 A;  1BAJ A;  3H4E A;  5HGM A;  4PH0 A;  5HGL A;  2XV6 A;  2M8L A;  2JYG A;  4WYM A; 
#chains in the Genus database with same CATH topology
 1HQB A;  4U0A A;  4IPY A;  1VQP P;  1YIT P;  2EHS A;  2JBG A;  4U0D A;  1K73 Q;  2FQ2 A;  2Z44 A;  2L4B A;  2N98 A;  4H2X C;  2PEI A;  1RNI A;  2XXM A;  1Q82 Q;  4XFX A;  2AF8 A;  2NO8 A;  2M8L A;  1L0H A;  3DPH A;  1M74 A;  2AVA A;  2XT1 A;  2LIU A;  5BS2 A;  2OTJ P;  2LTE A;  2KOS A;  3G26 A;  3EJE A;  2FVF A;  2L9F A;  4U0F A;  1VQL P;  5HGO A;  2LML A;  4PH1 A;  1VQ5 P;  3RG2 A;  2EHT A;  3G0V A;  4BPG A;  1QVF O;  1RO0 A;  3G6E P;  1M6N A;  1M1K Q;  1JJ2 O;  2L6E A;  2WPT A;  1YJW P;  3GZL A;  2GZI A;  5HVC A;  2FVA A;  2M8N A;  3H47 A;  5HGN A;  3DS5 A;  4XRQ A;  5KP7 B;  3G29 A;  7CEI A;  5JPA A;  2K0X A;  3CCU P;  4R0M A;  4XRO A;  1GXH A;  1F80 D;  2LPK A;  2XZ0 D;  1VQ4 P;  4BPF A;  2K5X A;  4HKG A;  3EJB A;  1EOQ A;  1YHQ P;  2KG6 A;  2VSQ A;  3CC4 P;  1N8R Q;  1AYI A;  4GR6 A;  3MGE A;  3G4S P;  3NTE A;  3CCR P;  4PH0 A;  4H2Y C;  1CEI A;  3CPW O;  3DS1 A;  2DNW A;  5F2O A;  1ZNV A;  2XZ1 C;  1A43 A;  2PEM A;  2JU2 A;  4PWV B;  3CCV P;  1YJN P;  1KLP A;  3Q20 A;  3CXC O;  5CZD B;  3DS4 A;  3CCS P;  2JU1 A;  3CCQ P;  1IUQ A;  4IZ6 A;  3WBH A;  2LL8 A;  1VQK P;  3DS3 A;  1EMV A;  2CG5 B;  1OR5 A;  2JB0 A;  1K8A Q;  4M0I A;  3NY7 B;  3VRL C;  2CNR A;  1BXI A;  2GZF A;  4CA3 A;  1BAJ A;  3H4E A;  2LOL A;  1GXG A;  1QVG O;  2CQ8 A;  2E1M A;  4MRT C;  2AFD A;  2QEX P;  1VQN P;  2MF4 A;  3DS2 A;  3GKL C;  2KOD A;  2KR5 A;  3GJN A;  2JQ4 A;  3CCM P;  3DTJ A;  2EFJ A;  3M1M A;  2OAR A;  2GDW A;  2PEO A;  2L22 A;  2LIW A;  4NEO A;  2MVV A;  2GZJ A;  4U0E A;  1FR2 A;  4QKO A;  1KD1 Q;  2JYL A;  2PEQ A;  2KOQ A;  1RO2 A;  2EIA A;  2AFE A;  3G28 A;  1W2B O;  3CC2 P;  4PXH B;  1VQ9 P;  1Z6M A;  3CMA P;  2ERH A;  3OW2 O;  3GZM A;  1VQM P;  1M6E X;  3H0D A;  4WYM A;  4U0C A;  2JAZ A;  2P9X A;  5EJD A;  1Q7Y Q;  2KGE A;  3CC7 P;  2CGQ A;  4BPH A;  2FVE A;  3U43 A;  4QNB A;  3CD6 P;  2K94 A;  5HGM A;  1E0H A;  1DV5 A;  2FAD A;  1KC8 Q;  1QRJ A;  2PEJ A;  4DG9 A;  1NJI Q;  3CME P;  3HYB A;  1YI2 P;  3CE7 A;  1AF8 A;  2MR8 A;  2KOO A;  5DCK A;  2FAC A;  1ACP A;  1KQS O;  2Z45 A;  2FHS C;  1X3O A;  1YIJ P;  1T8K A;  4GR2 A;  1VQ6 P;  1VQO P;  1Q81 Q;  3B4Q A;  1VQ8 P;  1MZ8 A;  2OTL P;  4UHP B;  2CWO A;  1YJ9 P;  2DGY A;  1UJZ A;  1NQ4 A;  1L0I A;  2FAE A;  2BUO A;  2N5I A;  2VLP A;  2ROQ A;  2EG5 A;  3RG6 C;  2K0D X;  5F2K A;  4COC A;  5BS1 A;  2FQ0 A;  5HV8 A;  1D1D A;  1IMQ A;  2GZG A;  2PEK A;  2KGD A;  2GYK A;  2JYG A;  2LKI A;  3G21 A;  1K30 A;  3G71 P;  1GPJ A;  2JO0 A;  5EW5 E;  5I4T G;  3I56 P;  1K9M Q;  1HY8 A;  2N50 A;  3HZQ A;  2MD9 A;  3LRY A;  5KP8 B;  2L0Q A;  2LF4 A;  2KOR A;  2VLO A;  2KG8 A;  3B5I A;  2K2Q A;  2M8P A;  2GDX A;  2KG9 A;  3G1I A;  2QNW A;  3DS0 A;  1VHN A;  2K92 A;  4H2W C;  1VQ7 P;  4XFZ A;  3CCL P;  3G1G A;  2KWL A;  1M90 Q;  2X2B A;  4F37 A;  1Q86 Q;  2ONT A;  1IMP A;  2VLN A;  2PEN A;  2N5H A;  4XFY A;  2K93 A;  4U0B A;  2PNG A;  3E2D A;  1VKU A;  1UNK A;  2BHV A;  3CCJ P;  2K0Y A;  5F2N A;  1E6J P;  3CCE P;  2FQ1 A;  2MVU A;  3LMO A;  2Z46 A;  2GZE A;  2XV6 A;  1AUM A;  2GDY A;  2KGA A;  2N6Z A;  1DNY A;  1A8O A;  5KP6 B;  2JGP A;  1EIA A;  2KW2 A;  2KOP A;  4COP A;  2QA4 P;  2PY8 A;  3P05 A;  3I55 P;  1ZMB A;  3EJD A;  1S72 P;  2KGC A;  2N6Y A;  2MR7 A;  5HGL A;  2M5R A;  2VLQ A;  2MY5 A; 
#chains in the Genus database with same CATH homology
 3CPW O;  4U0A A;  4IPY A;  3DS1 A;  3G21 A;  4U0C A;  1VQP P;  1YIT P;  1K30 A;  3G71 P;  2P9X A;  5F2O A;  1Q7Y Q;  2JO0 A;  4U0D A;  3CC7 P;  5I4T G;  1A43 A;  1K73 Q;  2PEM A;  2Z44 A;  3CCV P;  3I56 P;  1YJN P;  1K9M Q;  2PEI A;  3Q20 A;  1RNI A;  3HZQ A;  2XXM A;  3CXC O;  1Q82 Q;  3DS4 A;  3LRY A;  4QNB A;  3CCS P;  4XFX A;  3CD6 P;  3CCQ P;  2LF4 A;  1IUQ A;  5HGM A;  3WBH A;  3B5I A;  2M8L A;  1KC8 Q;  3DPH A;  1VQK P;  2M8P A;  3DS3 A;  1M74 A;  1QRJ A;  2XT1 A;  3G1I A;  2PEJ A;  5BS2 A;  2OTJ P;  3DS0 A;  1K8A Q;  1NJI Q;  4M0I A;  3CME P;  3HYB A;  1YI2 P;  3G26 A;  1VQ7 P;  4U0F A;  4XFZ A;  1VQL P;  5HGO A;  3CCL P;  4PH1 A;  1VQ5 P;  3VRL C;  3G1G A;  1M90 Q;  1Q86 Q;  5DCK A;  2ONT A;  3G0V A;  1KQS O;  1QVF O;  1BAJ A;  3H4E A;  1RO0 A;  2Z45 A;  2PEN A;  3G6E P;  1QVG O;  1M6N A;  1M1K Q;  2E1M A;  2QEX P;  1JJ2 O;  1VQN P;  2L6E A;  1YIJ P;  4XFY A;  1YJW P;  4GR2 A;  4U0B A;  3DS2 A;  1VQ6 P;  1VQO P;  2M8N A;  1Q81 Q;  2KOD A;  3E2D A;  3H47 A;  5HGN A;  3DS5 A;  1VQ8 P;  2OTL P;  3CCM P;  3DTJ A;  2EFJ A;  3M1M A;  2OAR A;  2BHV A;  2CWO A;  2PEO A;  3CCJ P;  5F2N A;  4XRQ A;  1E6J P;  3CCE P;  1YJ9 P;  3G29 A;  2DGY A;  5JPA A;  3CCU P;  4XRO A;  2Z46 A;  4U0E A;  2XV6 A;  2BUO A;  1VQ4 P;  1AUM A;  1KD1 Q;  2EG5 A;  1EOQ A;  2JYL A;  2PEQ A;  3RG6 C;  1YHQ P;  1A8O A;  5F2K A;  1RO2 A;  4COC A;  2EIA A;  3CC4 P;  5BS1 A;  1EIA A;  3G28 A;  1N8R Q;  1W2B O;  4COP A;  3CC2 P;  2QA4 P;  2PY8 A;  3P05 A;  3MGE A;  4GR6 A;  3I55 P;  3CMA P;  1VQ9 P;  1ZMB A;  3G4S P;  1D1D A;  3OW2 O;  1S72 P;  3NTE A;  3CCR P;  4PH0 A;  2PEK A;  5HGL A;  1VQM P;  1M6E X;  3H0D A;  2JYG A;  4WYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...