3DS0A

Hiv-1 capsid c-terminal domain mutant (n183a) in complex with an inhibitor of particle assembly (cai)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKAWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 26
structure length 82
sequence length 82
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds0A00
2EIAA 3G0VA 2JO0A 3DPHA 3DS1A 3DTJA 2XV6A 2M8NA 3G29A 3H4EA 4XFZA 1EOQA 3G28A 3DS3A 1D1DA 1BAJA 3G21A 4WYMA 2XXMA 4U0CA 1A8OA 5HGMA 3DS2A 2L6EA 3G1GA 4XROA 3P05A 4COPA 5DCKA 1AUMA 2JYLA 4QNBA 3LRYA 3DS5A 3DS0A 5I4TG 5HGLA 2LF4A 3H47A 1E6JP 5JPAA 4M0IA 2JYGA 4COCA 3MGEA 2XT1A 1EIAA 1A43A 4U0DA 4U0BA 2M8LA 5HGNA 4PH1A 4U0EA 4XFXA 4U0FA 3G1IA 2BUOA 3VRLC 3DS4A 1QRJA 2M8PA 2ONTA 4U0AA 2KODA 3G26A 4XRQA 4PH0A 3NTEA 5HGOA 4IPYA 4XFYA
chains in the Genus database with same CATH superfamily
2PEMA 1OR5A 2OTJP 3DS3A 3EJDA 1HQBA 2K94A 4U0CA 2PEOA 2GZGA 2VLOA 2XZ0D 1GPJA 3M1MA 5HGLA 1X3OA 1AF8A 4BPHA 2AFEA 1DV5A 2M8LA 2AVAA 4U0EA 2FVEA 2KGEA 4U0AA 1GXHA 4R0MA 4XROA 3CPWO 2AFDA 2PEKA 1M90Q 1L0IA 3G1GA 1VQ7P 4QKOA 4CA3A 1QVGO 3LRYA 5I4TG 3EJBA 4M0IA 2KWLA 2K2QA 3CMAP 4PWVB 3G0VA 2KGAA 1KQSO 2XV6A 1ACPA 2JU1A 4BPGA 2CG5B 2MR7A 2XXMA 3CCMP 2DNWA 2JYLA 2N98A 1YI2P 2QEXP 2ONTA 2LKIA 3CXCO 2VLPA 1VKUA 1W2BO 1K30A 3B4QA 1IUQA 2VLNA 3GKLC 1IMPA 2KR5A 2L0QA 4F37A 2JQ4A 1CEIA 1E0HA 2PY8A 2KORA 2KG8A 4UHPB 1EIAA 3CE7A 2GDXA 2GDWA 3G1IA 1VQMP 3G6EP 1VQLP 1VQ9P 3HZQA 3NTEA 3I55P 4XFZA 1AYIA 2N50A 3RG2A 5DCKA 2FQ1A 1RO2A 2MVUA 3EJEA 4U0BA 2N5HA 1K73Q 2P9XA 2KOOA 2ERHA 1DNYA 3G26A 2FQ0A 3CD6P 2JO0A 3B5IA 3G29A 2XZ1C 3G71P 1Q86Q 2PEIA 3RG6C 1S72P 1N8RQ 2Z44A 1Q81Q 3DS0A 2LF4A 1E6JP 3I56P 2KG9A 4HKGA 1ZNVA 2QNWA 3CCVP 3U43A 2L9FA 2LIUA 2LOLA 4H2YC 2FHSC 2L4BA 3NY7B 1ZMBA 1A8OA 2FADA 5EW5E 2QA4P 2EFJA 4COCA 2K92A 1L0HA 1Z6MA 2GZJA 1VQPP 1YHQP 1EMVA 1M1KQ 2K5XA 1QVFO 2FQ2A 2BHVA 5F2NA 5F2KA 2FACA 2KW2A 2OARA 2LMLA 1YJNP 3HYBA 1KD1Q 1VQ6P 5JPAA 1F80D 2EHSA 4PH1A 2BUOA 3DS4A 1VQ4P 3WBHA 2GDYA 1NQ4A 1T8KA 1VQKP 1D1DA 4WYMA 3DS2A 1FR2A 3CC4P 2MY5A 3CCSP 5EJDA 4IZ6A 3H47A 1YJ9P 2CGQA 1K8AQ 4XFXA 1YJWP 2FVAA 2X2BA 3GZMA 4IPYA 1YITP 2VLQA 2M8NA 2FVFA 2JAZA 2CQ8A 2CWOA 1VHNA 5KP6B 2KG6A 2EHTA 3CCQP 4COPA 5KP7B 2KOQA 2K0XA 1NJIQ 2XT1A 2GZIA 5CZDB 5KP8B 1MZ8A 2MF4A 5BS2A 3OW2O 1Q82Q 1EOQA 2JB0A 1GXGA 3G21A 2MVVA 3CMEP 5HGMA 2LL8A 2L6EA 3DS5A 3GJNA 2GZFA 2Z46A 2MR8A 4U0DA 1KLPA 3VRLC 4GR2A 1QRJA 3DPHA 5HVCA 1YIJP 2DGYA 3CCJP 2K93A 3Q20A 1UJZA 3CC7P 4PXHB 3MGEA 5HGNA 2PEQA 2FAEA 2ROQA 2EG5A 2LTEA 2GYKA 2KODA 2KGCA 4XRQA 1KC8Q 5HGOA 1VQ5P 2EIAA 1HY8A 1M74A 2LPKA 2PENA 3DS1A 2OTLP 1M6NA 3H4EA 3CCLP 1M6EX 3P05A 2JGPA 5F2OA 2CNRA 3E2DA 1A43A 3GZLA 2N6ZA 2M5RA 4PH0A 2K0DX 1RO0A 2N6YA 1IMQA 3H0DA 2KGDA 2WPTA 1VQ8P 1AUMA 2PEJA 2LIWA 2E1MA 3G4SP 1UNKA 1VQOP 4U0FA 3LMOA 2JU2A 2M8PA 7CEIA 4XFYA 1VQNP 4DG9A 2GZEA 3G28A 2JBGA 1BAJA 2PNGA 4NEOA 5HV8A 4H2XC 2KOSA 2N5IA 1RNIA 2K0YA 2Z45A 4H2WC 2NO8A 3CC2P 3CCUP 3CCEP 1BXIA 2VSQA 3DTJA 4GR6A 1JJ2O 5BS1A 1Q7YQ 4MRTC 1K9MQ 4BPFA 4QNBA 2MD9A 2AF8A 2JYGA 2L22A 2KOPA 3CCRP
chains in the Genus database with same CATH topology
2PEMA 2EIAA 1M74A 2PENA 3DS1A 3I55P 2OTLP 1M6NA 3H4EA 4XFZA 3CCLP 1M6EX 3DS3A 2OTJP 1D1DA 4WYMA 4U0CA 2PEOA 3DS2A 3P05A 3CC4P 5DCKA 3CCSP 1RO2A 3M1MA 5HGLA 5F2OA 3H47A 1YJ9P 3E2DA 1A43A 4U0BA 1K8AQ 2M8LA 4U0EA 4XFXA 1YJWP 1K73Q 2P9XA 4U0AA 3G26A 4PH0A 4XROA 4IPYA 3CD6P 1YITP 2JO0A 3B5IA 2M8NA 3G29A 1RO0A 3G71P 1Q86Q 2CWOA 3H0DA 2PEKA 3CPWO 2PEIA 3RG6C 1M90Q 1S72P 3G1GA 3CCQP 4COPA 1VQ7P 1N8RQ 1VQ8P 1QVGO 2Z44A 1AUMA 2PEJA 1Q81Q 3LRYA 1NJIQ 3DS0A 5I4TG 2LF4A 2E1MA 1E6JP 3G4SP 4M0IA 3I56P 2XT1A 1VQOP 4U0FA 3CMAP 2M8PA 5BS2A 3CCVP 3OW2O 1Q82Q 4XFYA 1VQNP 3G0VA 1KQSO 2XV6A 1EOQA 3G28A 1BAJA 3G21A 1ZMBA 2XXMA 3CMEP 1A8OA 5HGMA 3CCMP 2L6EA 2QA4P 1RNIA 2JYLA 3DS5A 2Z45A 2EFJA 2Z46A 4COCA 3CC2P 4U0DA 3VRLC 4GR2A 1VQPP 3CCUP 1YI2P 1QRJA 2QEXP 2ONTA 3CCRP 1YHQP 3CCEP 1M1KQ 3DPHA 1QVFO 3DTJA 3CXCO 4GR6A 1YIJP 1W2BO 1VQKP 2DGYA 1K30A 3CCJP 1JJ2O 2BHVA 5BS1A 1Q7YQ 3Q20A 3CC7P 5F2NA 5F2KA 1IUQA 1K9MQ 4QNBA 2OARA 1YJNP 3HYBA 1KD1Q 1VQ6P 5JPAA 2PY8A 2JYGA 3MGEA 1EIAA 5HGNA 2PEQA 4PH1A 3G1IA 2BUOA 1VQMP 3DS4A 3G6EP 2EG5A 1VQLP 1VQ9P 1VQ4P 2KODA 3HZQA 4XRQA 1KC8Q 3WBHA 3NTEA 5HGOA 1VQ5P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIA A;  3G0V A;  2JO0 A;  3DPH A;  3DS1 A;  3DTJ A;  2XV6 A;  2M8N A;  3G29 A;  3H4E A;  4XFZ A;  1EOQ A;  3G28 A;  3DS3 A;  1D1D A;  1BAJ A;  3G21 A;  4WYM A;  2XXM A;  4U0C A;  1A8O A;  5HGM A;  3DS2 A;  2L6E A;  3G1G A;  4XRO A;  3P05 A;  4COP A;  5DCK A;  1AUM A;  2JYL A;  4QNB A;  3LRY A;  3DS5 A;  3DS0 A;  5I4T G;  5HGL A;  2LF4 A;  3H47 A;  1E6J P;  5JPA A;  4M0I A;  2JYG A;  4COC A;  3MGE A;  2XT1 A;  1EIA A;  1A43 A;  4U0D A;  4U0B A;  2M8L A;  5HGN A;  4PH1 A;  4U0E A;  4XFX A;  4U0F A;  3G1I A;  2BUO A;  3VRL C;  3DS4 A;  1QRJ A;  2M8P A;  2ONT A;  4U0A A;  2KOD A;  3G26 A;  4XRQ A;  4PH0 A;  3NTE A;  5HGO A;  4IPY A;  4XFY A; 
#chains in the Genus database with same CATH topology
 2PEM A;  1OR5 A;  2OTJ P;  3DS3 A;  3EJD A;  1HQB A;  2K94 A;  4U0C A;  2PEO A;  2GZG A;  2VLO A;  2XZ0 D;  1GPJ A;  3M1M A;  5HGL A;  1X3O A;  1AF8 A;  4BPH A;  2AFE A;  1DV5 A;  2M8L A;  2AVA A;  4U0E A;  2FVE A;  2KGE A;  4U0A A;  1GXH A;  4R0M A;  4XRO A;  3CPW O;  2AFD A;  2PEK A;  1M90 Q;  1L0I A;  3G1G A;  1VQ7 P;  4QKO A;  4CA3 A;  1QVG O;  3LRY A;  5I4T G;  3EJB A;  4M0I A;  2KWL A;  2K2Q A;  3CMA P;  4PWV B;  3G0V A;  2KGA A;  1KQS O;  2XV6 A;  1ACP A;  2JU1 A;  4BPG A;  2CG5 B;  2MR7 A;  2XXM A;  3CCM P;  2DNW A;  2JYL A;  2N98 A;  1YI2 P;  2QEX P;  2ONT A;  2LKI A;  3CXC O;  2VLP A;  1VKU A;  1W2B O;  1K30 A;  3B4Q A;  1IUQ A;  2VLN A;  3GKL C;  1IMP A;  2KR5 A;  2L0Q A;  4F37 A;  2JQ4 A;  1CEI A;  1E0H A;  2PY8 A;  2KOR A;  2KG8 A;  4UHP B;  1EIA A;  3CE7 A;  2GDX A;  2GDW A;  3G1I A;  1VQM P;  3G6E P;  1VQL P;  1VQ9 P;  3HZQ A;  3NTE A;  3I55 P;  4XFZ A;  1AYI A;  2N50 A;  3RG2 A;  5DCK A;  2FQ1 A;  1RO2 A;  2MVU A;  3EJE A;  4U0B A;  2N5H A;  1K73 Q;  2P9X A;  2KOO A;  2ERH A;  1DNY A;  3G26 A;  2FQ0 A;  3CD6 P;  2JO0 A;  3B5I A;  3G29 A;  2XZ1 C;  3G71 P;  1Q86 Q;  2PEI A;  3RG6 C;  1S72 P;  1N8R Q;  2Z44 A;  1Q81 Q;  3DS0 A;  2LF4 A;  1E6J P;  3I56 P;  2KG9 A;  4HKG A;  1ZNV A;  2QNW A;  3CCV P;  3U43 A;  2L9F A;  2LIU A;  2LOL A;  4H2Y C;  2FHS C;  2L4B A;  3NY7 B;  1ZMB A;  1A8O A;  2FAD A;  5EW5 E;  2QA4 P;  2EFJ A;  4COC A;  2K92 A;  1L0H A;  1Z6M A;  2GZJ A;  1VQP P;  1YHQ P;  1EMV A;  1M1K Q;  2K5X A;  1QVF O;  2FQ2 A;  2BHV A;  5F2N A;  5F2K A;  2FAC A;  2KW2 A;  2OAR A;  2LML A;  1YJN P;  3HYB A;  1KD1 Q;  1VQ6 P;  5JPA A;  1F80 D;  2EHS A;  4PH1 A;  2BUO A;  3DS4 A;  1VQ4 P;  3WBH A;  2GDY A;  1NQ4 A;  1T8K A;  1VQK P;  1D1D A;  4WYM A;  3DS2 A;  1FR2 A;  3CC4 P;  2MY5 A;  3CCS P;  5EJD A;  4IZ6 A;  3H47 A;  1YJ9 P;  2CGQ A;  1K8A Q;  4XFX A;  1YJW P;  2FVA A;  2X2B A;  3GZM A;  4IPY A;  1YIT P;  2VLQ A;  2M8N A;  2FVF A;  2JAZ A;  2CQ8 A;  2CWO A;  1VHN A;  5KP6 B;  2KG6 A;  2EHT A;  3CCQ P;  4COP A;  5KP7 B;  2KOQ A;  2K0X A;  1NJI Q;  2XT1 A;  2GZI A;  5CZD B;  5KP8 B;  1MZ8 A;  2MF4 A;  5BS2 A;  3OW2 O;  1Q82 Q;  1EOQ A;  2JB0 A;  1GXG A;  3G21 A;  2MVV A;  3CME P;  5HGM A;  2LL8 A;  2L6E A;  3DS5 A;  3GJN A;  2GZF A;  2Z46 A;  2MR8 A;  4U0D A;  1KLP A;  3VRL C;  4GR2 A;  1QRJ A;  3DPH A;  5HVC A;  1YIJ P;  2DGY A;  3CCJ P;  2K93 A;  3Q20 A;  1UJZ A;  3CC7 P;  4PXH B;  3MGE A;  5HGN A;  2PEQ A;  2FAE A;  2ROQ A;  2EG5 A;  2LTE A;  2GYK A;  2KOD A;  2KGC A;  4XRQ A;  1KC8 Q;  5HGO A;  1VQ5 P;  2EIA A;  1HY8 A;  1M74 A;  2LPK A;  2PEN A;  3DS1 A;  2OTL P;  1M6N A;  3H4E A;  3CCL P;  1M6E X;  3P05 A;  2JGP A;  5F2O A;  2CNR A;  3E2D A;  1A43 A;  3GZL A;  2N6Z A;  2M5R A;  4PH0 A;  2K0D X;  1RO0 A;  2N6Y A;  1IMQ A;  3H0D A;  2KGD A;  2WPT A;  1VQ8 P;  1AUM A;  2PEJ A;  2LIW A;  2E1M A;  3G4S P;  1UNK A;  1VQO P;  4U0F A;  3LMO A;  2JU2 A;  2M8P A;  7CEI A;  4XFY A;  1VQN P;  4DG9 A;  2GZE A;  3G28 A;  2JBG A;  1BAJ A;  2PNG A;  4NEO A;  5HV8 A;  4H2X C;  2KOS A;  2N5I A;  1RNI A;  2K0Y A;  2Z45 A;  4H2W C;  2NO8 A;  3CC2 P;  3CCU P;  3CCE P;  1BXI A;  2VSQ A;  3DTJ A;  4GR6 A;  1JJ2 O;  5BS1 A;  1Q7Y Q;  4MRT C;  1K9M Q;  4BPF A;  4QNB A;  2MD9 A;  2AF8 A;  2JYG A;  2L22 A;  2KOP A;  3CCR P; 
#chains in the Genus database with same CATH homology
 2PEM A;  2EIA A;  1M74 A;  2PEN A;  3DS1 A;  3I55 P;  2OTL P;  1M6N A;  3H4E A;  4XFZ A;  3CCL P;  1M6E X;  3DS3 A;  2OTJ P;  1D1D A;  4WYM A;  4U0C A;  2PEO A;  3DS2 A;  3P05 A;  3CC4 P;  5DCK A;  3CCS P;  1RO2 A;  3M1M A;  5HGL A;  5F2O A;  3H47 A;  1YJ9 P;  3E2D A;  1A43 A;  4U0B A;  1K8A Q;  2M8L A;  4U0E A;  4XFX A;  1YJW P;  1K73 Q;  2P9X A;  4U0A A;  3G26 A;  4PH0 A;  4XRO A;  4IPY A;  3CD6 P;  1YIT P;  2JO0 A;  3B5I A;  2M8N A;  3G29 A;  1RO0 A;  3G71 P;  1Q86 Q;  2CWO A;  3H0D A;  2PEK A;  3CPW O;  2PEI A;  3RG6 C;  1M90 Q;  1S72 P;  3G1G A;  3CCQ P;  4COP A;  1VQ7 P;  1N8R Q;  1VQ8 P;  1QVG O;  2Z44 A;  1AUM A;  2PEJ A;  1Q81 Q;  3LRY A;  1NJI Q;  3DS0 A;  5I4T G;  2LF4 A;  2E1M A;  1E6J P;  3G4S P;  4M0I A;  3I56 P;  2XT1 A;  1VQO P;  4U0F A;  3CMA P;  2M8P A;  5BS2 A;  3CCV P;  3OW2 O;  1Q82 Q;  4XFY A;  1VQN P;  3G0V A;  1KQS O;  2XV6 A;  1EOQ A;  3G28 A;  1BAJ A;  3G21 A;  1ZMB A;  2XXM A;  3CME P;  1A8O A;  5HGM A;  3CCM P;  2L6E A;  2QA4 P;  1RNI A;  2JYL A;  3DS5 A;  2Z45 A;  2EFJ A;  2Z46 A;  4COC A;  3CC2 P;  4U0D A;  3VRL C;  4GR2 A;  1VQP P;  3CCU P;  1YI2 P;  1QRJ A;  2QEX P;  2ONT A;  3CCR P;  1YHQ P;  3CCE P;  1M1K Q;  3DPH A;  1QVF O;  3DTJ A;  3CXC O;  4GR6 A;  1YIJ P;  1W2B O;  1VQK P;  2DGY A;  1K30 A;  3CCJ P;  1JJ2 O;  2BHV A;  5BS1 A;  1Q7Y Q;  3Q20 A;  3CC7 P;  5F2N A;  5F2K A;  1IUQ A;  1K9M Q;  4QNB A;  2OAR A;  1YJN P;  3HYB A;  1KD1 Q;  1VQ6 P;  5JPA A;  2PY8 A;  2JYG A;  3MGE A;  1EIA A;  5HGN A;  2PEQ A;  4PH1 A;  3G1I A;  2BUO A;  1VQM P;  3DS4 A;  3G6E P;  2EG5 A;  1VQL P;  1VQ9 P;  1VQ4 P;  2KOD A;  3HZQ A;  4XRQ A;  1KC8 Q;  3WBH A;  3NTE A;  5HGO A;  1VQ5 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...