3DS0A

Hiv-1 capsid c-terminal domain mutant (n183a) in complex with an inhibitor of particle assembly (cai)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
PTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKAWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 26
structure length 82
sequence length 82
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds0A00
5HGMA 2BUOA 5HGNA 5HGOA 3NTEA 3G26A 2LF4A 4M0IA 4U0EA 4U0AA 4U0BA 3G21A 4XROA 3H47A 2M8PA 3P05A 1E6JP 4WYMA 4XFZA 2JYGA 1QRJA 3DPHA 4XRQA 3G1IA 3G28A 2JO0A 4XFYA 3DS2A 2XXMA 4PH0A 1D1DA 4PH1A 3G0VA 4IPYA 2M8LA 3G29A 1AUMA 3DTJA 5DCKA 2XV6A 1EIAA 5HGLA 5JPAA 3DS0A 4QNBA 3DS3A 2M8NA 2JYLA 3G1GA 3DS1A 3H4EA 2L6EA 1BAJA 3DS5A 5I4TG 4COCA 2ONTA 1EOQA 4U0DA 4COPA 3LRYA 3DS4A 2EIAA 4U0FA 1A43A 2KODA 2XT1A 3MGEA 4U0CA 1A8OA 4XFXA 3VRLC
chains in the Genus database with same CATH superfamily
2JGPA 1Q82Q 1FR2A 2N5HA 4XFZA 1VQ4P 2AVAA 1GXHA 1AYIA 4XFYA 4PXHB 3DS3A 4BPFA 1VQLP 2K93A 3CC2P 3EJEA 1YJWP 2ROQA 2OARA 1CEIA 2KG8A 2K0YA 2L4BA 3CCEP 2LIUA 2K2QA 4PH1A 3G0VA 1K8AQ 4H2XC 2FQ2A 1VQ5P 1L0HA 1VQPP 2DNWA 2LF4A 4U0AA 1T8KA 2AF8A 1KC8Q 2K92A 1OR5A 3DPHA 1YI2P 4IPYA 5EW5E 4H2YC 1M6EX 2EHSA 2L0QA 1RO0A 1ZNVA 2KOOA 2ONTA 5HV8A 2EIAA 1RNIA 2LIWA 1RO2A 4H2WC 1VQKP 2MVUA 1JJ2O 1VQ8P 2AFEA 3CC7P 5CZDB 2CGQA 3RG2A 2KW2A 2JQ4A 2GDYA 3CPWO 2K94A 3CXCO 1ZMBA 4U0BA 2KOSA 3CCLP 2JBGA 1QRJA 2JO0A 1D1DA 2K0DX 2XZ1C 2FVEA 2Z45A 3GZMA 2K5XA 5I4TG 2KG9A 2N6ZA 1NJIQ 1QVGO 2N98A 3CE7A 2JU1A 3G21A 1M6NA 2MR7A 1M1KQ 2CG5B 2BHVA 2L22A 2XV6A 5JPAA 3DS1A 5KP6B 3CCUP 1Q86Q 2KODA 1DNYA 1VQ6P 4DG9A 3G4SP 2FADA 5BS2A 2KGCA 1AUMA 2KGDA 2FACA 3H4EA 5EJDA 4U0DA 1UNKA 2VLOA 5KP8B 1YJ9P 4XFXA 4PWVB 1VQNP 2CNRA 2MY5A 2FQ0A 1VKUA 3CC4P 4NEOA 2JYGA 2EHTA 2LOLA 3CCMP 2GZIA 3GJNA 3CCJP 1YHQP 2LTEA 1IMPA 7CEIA 2FVAA 4COCA 2NO8A 3G6EP 1IUQA 2GZEA 5F2OA 4WYMA 1KLPA 3B4QA 3B5IA 2OTJP 3CCRP 2XZ0D 3Q20A 1Q81Q 1YJNP 1W2BO 3DS4A 2KG6A 4GR2A 4U0EA 1Q7YQ 4GR6A 1E6JP 2VLQA 2DGYA 4QKOA 2E1MA 2Z44A 2MVVA 1IMQA 1UJZA 1K73Q 1GPJA 3DTJA 2L9FA 2M8NA 2JYLA 1QVFO 1M90Q 3U43A 2BUOA 5HGOA 2LL8A 2LMLA 1N8RQ 2KGAA 2K0XA 3OW2O 2VLNA 3G29A 5HGLA 2LPKA 1EOQA 4COPA 3WBHA 2N5IA 2PEOA 2XT1A 1A8OA 1F80D 3NTEA 2QNWA 2WPTA 4XROA 1MZ8A 2PEIA 3P05A 2Z46A 3I55P 2VSQA 2JU2A 4IZ6A 1X3OA 3EJBA 2EG5A 3I56P 2KOPA 1E0HA 4QNBA 2VLPA 5F2KA 4BPHA 3LRYA 5HVCA 1VQ7P 2N50A 1Z6MA 2OTLP 3G71P 5HGMA 4CA3A 5HGNA 3G26A 4M0IA 2JB0A 2KOQA 1AF8A 1L0IA 2MF4A 2ERHA 2GZJA 1GXGA 1K9MQ 3EJDA 1S72P 3RG6C 2FVFA 3H0DA 1KQSO 1A43A 3VRLC 4MRTC 2PEJA 2CWOA 3NY7B 1YITP 2KORA 2PEQA 2PNGA 5KP7B 1EMVA 2PEMA 4HKGA 4F37A 2MR8A 1VQ9P 3CCVP 4XRQA 3G28A 2XXMA 2X2BA 1YIJP 1VQOP 2GYKA 1DV5A 2KGEA 2GZFA 1VHNA 2P9XA 3M1MA 2EFJA 2L6EA 3E2DA 2FAEA 4U0FA 2PEKA 1KD1Q 1HY8A 4R0MA 2MD9A 3H47A 2M8PA 2QEXP 2FQ1A 3G1IA 1BXIA 3CMAP 3CMEP 2CQ8A 2M8LA 2FHSC 2PENA 1EIAA 3DS5A 2GDWA 1NQ4A 1ACPA 2GDXA 3CCQP 3MGEA 4U0CA 2QA4P 2N6YA 1M74A 1K30A 2AFDA 5F2NA 1HQBA 3GKLC 3HZQA 2PY8A 4BPGA 3DS2A 4PH0A 3LMOA 3CD6P 5DCKA 3DS0A 2GZGA 3GZLA 3G1GA 2KWLA 1VQMP 1BAJA 4UHPB 2LKIA 2JAZA 2M5RA 3HYBA 3CCSP 5BS1A 2KR5A
chains in the Genus database with same CATH topology
5HGMA 5HGNA 1Q82Q 1ZMBA 3G26A 5F2OA 4M0IA 4U0BA 3CCLP 4XFZA 4WYMA 1VQ4P 1QRJA 2JO0A 4XFYA 3B5IA 1D1DA 2OTJP 1K9MQ 3CCRP 2Z45A 3DS3A 1S72P 3RG6C 1VQLP 3Q20A 5I4TG 1Q81Q 1YJNP 1W2BO 3CC2P 3DS4A 1YJWP 3H0DA 1NJIQ 1KQSO 1QVGO 1A43A 3VRLC 2OARA 2PEJA 2CWOA 4GR2A 1YITP 2PEQA 2PEMA 4U0EA 3G21A 1Q7YQ 1M6NA 4GR6A 1E6JP 2DGYA 3CCEP 1VQ9P 3CCVP 1M1KQ 4XRQA 2E1MA 2Z44A 3G28A 2XXMA 1YIJP 1K73Q 1VQOP 4PH1A 3G0VA 2BHVA 3DTJA 2XV6A 5JPAA 2M8NA 2P9XA 3M1MA 2JYLA 2EFJA 3DS1A 2L6EA 3CCUP 3E2DA 1QVFO 1K8AQ 1Q86Q 4U0FA 2PEKA 2KODA 1M90Q 1KD1Q 1VQ5P 1VQ6P 2BUOA 5HGOA 1VQPP 2LF4A 4U0AA 3H47A 2M8PA 3G4SP 1N8RQ 1KC8Q 2QEXP 3DPHA 3CXCO 1YI2P 3G1IA 3OW2O 5BS2A 4IPYA 3CMAP 3CMEP 2M8LA 2PENA 3G29A 1AUMA 5HGLA 1EIAA 3H4EA 1M6EX 3DS5A 1RO0A 2ONTA 1EOQA 4U0DA 4COPA 3WBHA 2EIAA 1YJ9P 3CCQP 3MGEA 1RNIA 2PEOA 2XT1A 4U0CA 1A8OA 4XFXA 1RO2A 1VQKP 2QA4P 1VQNP 3NTEA 1M74A 4XROA 1K30A 2PEIA 3P05A 5F2NA 3CC4P 2Z46A 1JJ2O 2JYGA 3HZQA 3I55P 2PY8A 3CCMP 3DS2A 1VQ8P 4PH0A 3CC7P 3CD6P 5DCKA 3CCJP 2EG5A 3I56P 1YHQP 3DS0A 4QNBA 3G1GA 5F2KA 1BAJA 3CPWO 1VQMP 4COCA 3G6EP 1IUQA 3LRYA 1VQ7P 2OTLP 3HYBA 3CCSP 5BS1A 3G71P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGM A;  2BUO A;  5HGN A;  5HGO A;  3NTE A;  3G26 A;  2LF4 A;  4M0I A;  4U0E A;  4U0A A;  4U0B A;  3G21 A;  4XRO A;  3H47 A;  2M8P A;  3P05 A;  1E6J P;  4WYM A;  4XFZ A;  2JYG A;  1QRJ A;  3DPH A;  4XRQ A;  3G1I A;  3G28 A;  2JO0 A;  4XFY A;  3DS2 A;  2XXM A;  4PH0 A;  1D1D A;  4PH1 A;  3G0V A;  4IPY A;  2M8L A;  3G29 A;  1AUM A;  3DTJ A;  5DCK A;  2XV6 A;  1EIA A;  5HGL A;  5JPA A;  3DS0 A;  4QNB A;  3DS3 A;  2M8N A;  2JYL A;  3G1G A;  3DS1 A;  3H4E A;  2L6E A;  1BAJ A;  3DS5 A;  5I4T G;  4COC A;  2ONT A;  1EOQ A;  4U0D A;  4COP A;  3LRY A;  3DS4 A;  2EIA A;  4U0F A;  1A43 A;  2KOD A;  2XT1 A;  3MGE A;  4U0C A;  1A8O A;  4XFX A;  3VRL C; 
#chains in the Genus database with same CATH topology
 2JGP A;  1Q82 Q;  1FR2 A;  2N5H A;  4XFZ A;  1VQ4 P;  2AVA A;  1GXH A;  1AYI A;  4XFY A;  4PXH B;  3DS3 A;  4BPF A;  1VQL P;  2K93 A;  3CC2 P;  3EJE A;  1YJW P;  2ROQ A;  2OAR A;  1CEI A;  2KG8 A;  2K0Y A;  2L4B A;  3CCE P;  2LIU A;  2K2Q A;  4PH1 A;  3G0V A;  1K8A Q;  4H2X C;  2FQ2 A;  1VQ5 P;  1L0H A;  1VQP P;  2DNW A;  2LF4 A;  4U0A A;  1T8K A;  2AF8 A;  1KC8 Q;  2K92 A;  1OR5 A;  3DPH A;  1YI2 P;  4IPY A;  5EW5 E;  4H2Y C;  1M6E X;  2EHS A;  2L0Q A;  1RO0 A;  1ZNV A;  2KOO A;  2ONT A;  5HV8 A;  2EIA A;  1RNI A;  2LIW A;  1RO2 A;  4H2W C;  1VQK P;  2MVU A;  1JJ2 O;  1VQ8 P;  2AFE A;  3CC7 P;  5CZD B;  2CGQ A;  3RG2 A;  2KW2 A;  2JQ4 A;  2GDY A;  3CPW O;  2K94 A;  3CXC O;  1ZMB A;  4U0B A;  2KOS A;  3CCL P;  2JBG A;  1QRJ A;  2JO0 A;  1D1D A;  2K0D X;  2XZ1 C;  2FVE A;  2Z45 A;  3GZM A;  2K5X A;  5I4T G;  2KG9 A;  2N6Z A;  1NJI Q;  1QVG O;  2N98 A;  3CE7 A;  2JU1 A;  3G21 A;  1M6N A;  2MR7 A;  1M1K Q;  2CG5 B;  2BHV A;  2L22 A;  2XV6 A;  5JPA A;  3DS1 A;  5KP6 B;  3CCU P;  1Q86 Q;  2KOD A;  1DNY A;  1VQ6 P;  4DG9 A;  3G4S P;  2FAD A;  5BS2 A;  2KGC A;  1AUM A;  2KGD A;  2FAC A;  3H4E A;  5EJD A;  4U0D A;  1UNK A;  2VLO A;  5KP8 B;  1YJ9 P;  4XFX A;  4PWV B;  1VQN P;  2CNR A;  2MY5 A;  2FQ0 A;  1VKU A;  3CC4 P;  4NEO A;  2JYG A;  2EHT A;  2LOL A;  3CCM P;  2GZI A;  3GJN A;  3CCJ P;  1YHQ P;  2LTE A;  1IMP A;  7CEI A;  2FVA A;  4COC A;  2NO8 A;  3G6E P;  1IUQ A;  2GZE A;  5F2O A;  4WYM A;  1KLP A;  3B4Q A;  3B5I A;  2OTJ P;  3CCR P;  2XZ0 D;  3Q20 A;  1Q81 Q;  1YJN P;  1W2B O;  3DS4 A;  2KG6 A;  4GR2 A;  4U0E A;  1Q7Y Q;  4GR6 A;  1E6J P;  2VLQ A;  2DGY A;  4QKO A;  2E1M A;  2Z44 A;  2MVV A;  1IMQ A;  1UJZ A;  1K73 Q;  1GPJ A;  3DTJ A;  2L9F A;  2M8N A;  2JYL A;  1QVF O;  1M90 Q;  3U43 A;  2BUO A;  5HGO A;  2LL8 A;  2LML A;  1N8R Q;  2KGA A;  2K0X A;  3OW2 O;  2VLN A;  3G29 A;  5HGL A;  2LPK A;  1EOQ A;  4COP A;  3WBH A;  2N5I A;  2PEO A;  2XT1 A;  1A8O A;  1F80 D;  3NTE A;  2QNW A;  2WPT A;  4XRO A;  1MZ8 A;  2PEI A;  3P05 A;  2Z46 A;  3I55 P;  2VSQ A;  2JU2 A;  4IZ6 A;  1X3O A;  3EJB A;  2EG5 A;  3I56 P;  2KOP A;  1E0H A;  4QNB A;  2VLP A;  5F2K A;  4BPH A;  3LRY A;  5HVC A;  1VQ7 P;  2N50 A;  1Z6M A;  2OTL P;  3G71 P;  5HGM A;  4CA3 A;  5HGN A;  3G26 A;  4M0I A;  2JB0 A;  2KOQ A;  1AF8 A;  1L0I A;  2MF4 A;  2ERH A;  2GZJ A;  1GXG A;  1K9M Q;  3EJD A;  1S72 P;  3RG6 C;  2FVF A;  3H0D A;  1KQS O;  1A43 A;  3VRL C;  4MRT C;  2PEJ A;  2CWO A;  3NY7 B;  1YIT P;  2KOR A;  2PEQ A;  2PNG A;  5KP7 B;  1EMV A;  2PEM A;  4HKG A;  4F37 A;  2MR8 A;  1VQ9 P;  3CCV P;  4XRQ A;  3G28 A;  2XXM A;  2X2B A;  1YIJ P;  1VQO P;  2GYK A;  1DV5 A;  2KGE A;  2GZF A;  1VHN A;  2P9X A;  3M1M A;  2EFJ A;  2L6E A;  3E2D A;  2FAE A;  4U0F A;  2PEK A;  1KD1 Q;  1HY8 A;  4R0M A;  2MD9 A;  3H47 A;  2M8P A;  2QEX P;  2FQ1 A;  3G1I A;  1BXI A;  3CMA P;  3CME P;  2CQ8 A;  2M8L A;  2FHS C;  2PEN A;  1EIA A;  3DS5 A;  2GDW A;  1NQ4 A;  1ACP A;  2GDX A;  3CCQ P;  3MGE A;  4U0C A;  2QA4 P;  2N6Y A;  1M74 A;  1K30 A;  2AFD A;  5F2N A;  1HQB A;  3GKL C;  3HZQ A;  2PY8 A;  4BPG A;  3DS2 A;  4PH0 A;  3LMO A;  3CD6 P;  5DCK A;  3DS0 A;  2GZG A;  3GZL A;  3G1G A;  2KWL A;  1VQM P;  1BAJ A;  4UHP B;  2LKI A;  2JAZ A;  2M5R A;  3HYB A;  3CCS P;  5BS1 A;  2KR5 A; 
#chains in the Genus database with same CATH homology
 5HGM A;  5HGN A;  1Q82 Q;  1ZMB A;  3G26 A;  5F2O A;  4M0I A;  4U0B A;  3CCL P;  4XFZ A;  4WYM A;  1VQ4 P;  1QRJ A;  2JO0 A;  4XFY A;  3B5I A;  1D1D A;  2OTJ P;  1K9M Q;  3CCR P;  2Z45 A;  3DS3 A;  1S72 P;  3RG6 C;  1VQL P;  3Q20 A;  5I4T G;  1Q81 Q;  1YJN P;  1W2B O;  3CC2 P;  3DS4 A;  1YJW P;  3H0D A;  1NJI Q;  1KQS O;  1QVG O;  1A43 A;  3VRL C;  2OAR A;  2PEJ A;  2CWO A;  4GR2 A;  1YIT P;  2PEQ A;  2PEM A;  4U0E A;  3G21 A;  1Q7Y Q;  1M6N A;  4GR6 A;  1E6J P;  2DGY A;  3CCE P;  1VQ9 P;  3CCV P;  1M1K Q;  4XRQ A;  2E1M A;  2Z44 A;  3G28 A;  2XXM A;  1YIJ P;  1K73 Q;  1VQO P;  4PH1 A;  3G0V A;  2BHV A;  3DTJ A;  2XV6 A;  5JPA A;  2M8N A;  2P9X A;  3M1M A;  2JYL A;  2EFJ A;  3DS1 A;  2L6E A;  3CCU P;  3E2D A;  1QVF O;  1K8A Q;  1Q86 Q;  4U0F A;  2PEK A;  2KOD A;  1M90 Q;  1KD1 Q;  1VQ5 P;  1VQ6 P;  2BUO A;  5HGO A;  1VQP P;  2LF4 A;  4U0A A;  3H47 A;  2M8P A;  3G4S P;  1N8R Q;  1KC8 Q;  2QEX P;  3DPH A;  3CXC O;  1YI2 P;  3G1I A;  3OW2 O;  5BS2 A;  4IPY A;  3CMA P;  3CME P;  2M8L A;  2PEN A;  3G29 A;  1AUM A;  5HGL A;  1EIA A;  3H4E A;  1M6E X;  3DS5 A;  1RO0 A;  2ONT A;  1EOQ A;  4U0D A;  4COP A;  3WBH A;  2EIA A;  1YJ9 P;  3CCQ P;  3MGE A;  1RNI A;  2PEO A;  2XT1 A;  4U0C A;  1A8O A;  4XFX A;  1RO2 A;  1VQK P;  2QA4 P;  1VQN P;  3NTE A;  1M74 A;  4XRO A;  1K30 A;  2PEI A;  3P05 A;  5F2N A;  3CC4 P;  2Z46 A;  1JJ2 O;  2JYG A;  3HZQ A;  3I55 P;  2PY8 A;  3CCM P;  3DS2 A;  1VQ8 P;  4PH0 A;  3CC7 P;  3CD6 P;  5DCK A;  3CCJ P;  2EG5 A;  3I56 P;  1YHQ P;  3DS0 A;  4QNB A;  3G1G A;  5F2K A;  1BAJ A;  3CPW O;  1VQM P;  4COC A;  3G6E P;  1IUQ A;  3LRY A;  1VQ7 P;  2OTL P;  3HYB A;  3CCS P;  5BS1 A;  3G71 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...