2FHSC

Structure of acyl carrier protein bound to fabi, the enoyl reductase from escherichia coli
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
76
structure length
57
Chain Sequence
STIEERVIIGVKQEEVTNNFVEDLGASLDTVELVMALEEEFDTTTVQAAIDYINGHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Acyl Carrier Protein Bound to FabI, the FASII Enoyl Reductase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/biosynthetic protein
molecule keywords enoyl-[acyl-carrier-protein] reductase, NADH-dependent
total genus 5
structure length 57
sequence length 76
ec nomenclature
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fhsC00
2AFDA 2KR5A 2EHTA 3EJDA 3GZLA 4MRTC 4R0MA 2FQ0A 5KP8B 4H2XC 2K2QA 1VKUA 2LL8A 2JU2A 4DG9A 4BPGA 1X3OA 2M5RA 2ROQA 2MD9A 2LTEA 1HQBA 2XZ0D 2FACA 2MF4A 2JGPA 1AF8A 2L9FA 4NEOA 2N6YA 2MY5A 2K0XA 2FQ2A 2CGQA 2KOOA 2MR7A 2KOQA 2CNRA 2AF8A 2K94A 2LIUA 1OR5A 2JU1A 1L0IA 3EJEA 4PWVB 1L0HA 2N50A 2KG9A 2LIWA 2XZ1C 3RG2A 2GDXA 2VSQA 2FVFA 2QNWA 2LPKA 2KGCA 2AFEA 2X2BA 2KWLA 3EJBA 2K0YA 1F80D 4PXHB 2CQ8A 2N5IA 4BPHA 3NY7B 4IZ6A 4BPFA 2JQ4A 2KGAA 2MR8A 5KP7B 3CE7A 2FVEA 1NQ4A 5HVCA 2N98A 2L0QA 2FQ1A 2KGEA 2PNGA 2KOSA 2KW2A 2AVAA 2LOLA 2FHSC 2LKIA 4H2WC 5KP6B 4H2YC 2LMLA 2MVUA 2KG6A 5EJDA 2N5HA 1DV5A 2FAEA 2FADA 4HKGA 2K92A 2L4BA 1KLPA 2CG5B 2FVAA 2MVVA 2K93A 3GZMA 2GDWA 2KGDA 5HV8A 2L22A 2DNWA 2EHSA 2N6ZA 2GDYA 2KG8A 1HY8A 1T8KA 2KORA 1ACPA 4CA3A 2KOPA 1DNYA 3LMOA 5CZDB
chains in the Genus database with same CATH superfamily
5JPAA 3CD6P 2EHTA 3EJDA 4MRTC 2P9XA 1EMVA 2DGYA 1VQKP 1JJ2O 3CCEP 4H2XC 4M0IA 1ZNVA 3DS2A 4BPGA 3CCVP 1VQMP 1X3OA 2ROQA 2MD9A 1Q86Q 1FR2A 4WYMA 2N6YA 5BS2A 1GPJA 2MY5A 3CMAP 2FQ2A 2MR7A 2CNRA 2LIUA 2JU1A 1M1KQ 1N8RQ 3DTJA 3RG2A 1K9MQ 2ERHA 2FVFA 2PEJA 2QNWA 1Q7YQ 5F2KA 2KGCA 3CCLP 2JYLA 2QEXP 2X2BA 2M8NA 2GZFA 1AYIA 4QNBA 3DS4A 1BAJA 5HVCA 4GR6A 3CCQP 2FQ1A 2KGEA 1KC8Q 2KW2A 4UHPB 2LOLA 3CMEP 2LKIA 2MVUA 5EJDA 2EIAA 1Z6MA 2E1MA 1Q81Q 1M90Q 2L4BA 2CG5B 2GZEA 3WBHA 2JAZA 2OTLP 1QRJA 2KGDA 2XV6A 3U43A 3MGEA 2DNWA 2GDYA 1T8KA 1K8AQ 3I56P 1YHQP 1ACPA 4CA3A 2GZJA 1CEIA 1DNYA 2JO0A 4U0CA 2XT1A 4R0MA 1K30A 2VLPA 1KD1Q 1M74A 4DG9A 3CCRP 1YJNP 2XZ0D 2MF4A 2JGPA 2WPTA 3B4QA 1VQLP 3CC4P 1D1DA 1GXGA 4U0AA 1K73Q 4NEOA 3HYBA 3CCUP 2CGQA 2KOOA 3RG6C 3DS3A 4COPA 2JYGA 5I4TG 1W2BO 1L0IA 4PWVB 1BXIA 4U0EA 3HZQA 2PEKA 2KG9A 2LIWA 3CCJP 3G4SP 2GDXA 2K0DX 2EG5A 2KWLA 3G0VA 2GYKA 1F80D 3Q20A 3LRYA 2CQ8A 2EFJA 2N5IA 4IZ6A 2OARA 2MR8A 1YI2P 3G21A 3GJNA 2GZIA 1VQ9P 2L0QA 1VQ5P 2AVAA 5HGMA 2FHSC 2LF4A 1M6NA 2N5HA 1VQPP 1DV5A 3E2DA 3I55P 2FVAA 2K93A 1VQ7P 3GZMA 1NJIQ 2M8PA 1QVFO 3DPHA 3CCMP 2EHSA 1A43A 3G1IA 1IMPA 3CC2P 3CPWO 3H4EA 2PEOA 5CZDB 2KR5A 2FQ0A 2OTJP 5F2NA 5KP8B 2GZGA 2LL8A 2M5RA 1EIAA 3H0DA 1HQBA 1QVGO 2L9FA 1UNKA 2Z46A 1RNIA 2K0XA 5HGOA 3M1MA 4XROA 2AF8A 3B5IA 1ZMBA 1YJWP 1YJ9P 3EJEA 4XFXA 1VHNA 4XFZA 1L0HA 4XRQA 2N50A 4F37A 7CEIA 5HGLA 1GXHA 3H47A 2LPKA 3DS5A 1VQNP 2AFEA 3EJBA 3CC7P 3NY7B 1IMQA 2ONTA 1MZ8A 2VLOA 2KGAA 1EOQA 3G6EP 5KP7B 3G1GA 3DS1A 2N98A 2PNGA 2KOSA 3GKLC 4GR2A 4H2YC 2LMLA 2KG6A 5BS1A 2FAEA 2FADA 4HKGA 2K92A 4U0BA 2L22A 2QA4P 2N6ZA 1HY8A 3G26A 1VQOP 1VQ4P 2KOPA 2VLNA 1S72P 3CCSP 2PEQA 2PEIA 3G29A 2AFDA 3GZLA 3CXCO 4XFYA 1E6JP 1VQ6P 2K2QA 2PEMA 1VKUA 2JU2A 3OW2O 1YIJP 2CWOA 2LTEA 1KQSO 2FACA 4QKOA 1AF8A 2PY8A 1A8OA 1IUQA 1M6EX 2JB0A 2NO8A 2KOQA 2K94A 1OR5A 3G28A 4PH0A 3G71P 1YITP 1RO2A 2Z44A 2XZ1C 2VLQA 2VSQA 5F2OA 3DS0A 1E0HA 1VQ8P 2Z45A 2K0YA 1RO0A 4PXHB 5EW5E 2KODA 4BPHA 3NTEA 2M8LA 4BPFA 2JQ4A 2PENA 3CE7A 2FVEA 1NQ4A 4U0DA 2K5XA 4IPYA 2JBGA 4H2WC 1UJZA 5KP6B 5DCKA 2XXMA 2BHVA 1KLPA 2BUOA 2MVVA 4U0FA 2GDWA 1AUMA 5HV8A 5HGNA 2KG8A 3VRLC 2KORA 4PH1A 1Q82Q 3P05A 4COCA 2L6EA 3LMOA
chains in the Genus database with same CATH topology
2AFDA 2KR5A 2EHTA 3EJDA 3GZLA 4MRTC 4R0MA 2FQ0A 5KP8B 4H2XC 2K2QA 1VKUA 2LL8A 2JU2A 4DG9A 4BPGA 1X3OA 2M5RA 2ROQA 2MD9A 2LTEA 1HQBA 2XZ0D 2FACA 2MF4A 2JGPA 1AF8A 2L9FA 4NEOA 2N6YA 2MY5A 2K0XA 2FQ2A 2CGQA 2KOOA 2MR7A 2KOQA 2CNRA 2AF8A 2K94A 2LIUA 1OR5A 2JU1A 1L0IA 3EJEA 4PWVB 1L0HA 2N50A 2KG9A 2LIWA 2XZ1C 3RG2A 2GDXA 2VSQA 2FVFA 2QNWA 2LPKA 2KGCA 2AFEA 2X2BA 2KWLA 3EJBA 2K0YA 1F80D 4PXHB 2CQ8A 2N5IA 4BPHA 3NY7B 4IZ6A 4BPFA 2JQ4A 2KGAA 2MR8A 5KP7B 3CE7A 2FVEA 1NQ4A 5HVCA 2N98A 2L0QA 2FQ1A 2KGEA 2PNGA 2KOSA 2KW2A 2AVAA 2LOLA 2FHSC 2LKIA 4H2WC 5KP6B 4H2YC 2LMLA 2MVUA 2KG6A 5EJDA 2N5HA 1DV5A 2FAEA 2FADA 4HKGA 2K92A 2L4BA 1KLPA 2CG5B 2FVAA 2MVVA 2K93A 3GZMA 2GDWA 2KGDA 5HV8A 2L22A 2DNWA 2EHSA 2N6ZA 2GDYA 2KG8A 1HY8A 1T8KA 2KORA 1ACPA 4CA3A 2KOPA 1DNYA 3LMOA 5CZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFD A;  2KR5 A;  2EHT A;  3EJD A;  3GZL A;  4MRT C;  4R0M A;  2FQ0 A;  5KP8 B;  4H2X C;  2K2Q A;  1VKU A;  2LL8 A;  2JU2 A;  4DG9 A;  4BPG A;  1X3O A;  2M5R A;  2ROQ A;  2MD9 A;  2LTE A;  1HQB A;  2XZ0 D;  2FAC A;  2MF4 A;  2JGP A;  1AF8 A;  2L9F A;  4NEO A;  2N6Y A;  2MY5 A;  2K0X A;  2FQ2 A;  2CGQ A;  2KOO A;  2MR7 A;  2KOQ A;  2CNR A;  2AF8 A;  2K94 A;  2LIU A;  1OR5 A;  2JU1 A;  1L0I A;  3EJE A;  4PWV B;  1L0H A;  2N50 A;  2KG9 A;  2LIW A;  2XZ1 C;  3RG2 A;  2GDX A;  2VSQ A;  2FVF A;  2QNW A;  2LPK A;  2KGC A;  2AFE A;  2X2B A;  2KWL A;  3EJB A;  2K0Y A;  1F80 D;  4PXH B;  2CQ8 A;  2N5I A;  4BPH A;  3NY7 B;  4IZ6 A;  4BPF A;  2JQ4 A;  2KGA A;  2MR8 A;  5KP7 B;  3CE7 A;  2FVE A;  1NQ4 A;  5HVC A;  2N98 A;  2L0Q A;  2FQ1 A;  2KGE A;  2PNG A;  2KOS A;  2KW2 A;  2AVA A;  2LOL A;  2FHS C;  2LKI A;  4H2W C;  5KP6 B;  4H2Y C;  2LML A;  2MVU A;  2KG6 A;  5EJD A;  2N5H A;  1DV5 A;  2FAE A;  2FAD A;  4HKG A;  2K92 A;  2L4B A;  1KLP A;  2CG5 B;  2FVA A;  2MVV A;  2K93 A;  3GZM A;  2GDW A;  2KGD A;  5HV8 A;  2L22 A;  2DNW A;  2EHS A;  2N6Z A;  2GDY A;  2KG8 A;  1HY8 A;  1T8K A;  2KOR A;  1ACP A;  4CA3 A;  2KOP A;  1DNY A;  3LMO A;  5CZD B; 
#chains in the Genus database with same CATH topology
 5JPA A;  3CD6 P;  2EHT A;  3EJD A;  4MRT C;  2P9X A;  1EMV A;  2DGY A;  1VQK P;  1JJ2 O;  3CCE P;  4H2X C;  4M0I A;  1ZNV A;  3DS2 A;  4BPG A;  3CCV P;  1VQM P;  1X3O A;  2ROQ A;  2MD9 A;  1Q86 Q;  1FR2 A;  4WYM A;  2N6Y A;  5BS2 A;  1GPJ A;  2MY5 A;  3CMA P;  2FQ2 A;  2MR7 A;  2CNR A;  2LIU A;  2JU1 A;  1M1K Q;  1N8R Q;  3DTJ A;  3RG2 A;  1K9M Q;  2ERH A;  2FVF A;  2PEJ A;  2QNW A;  1Q7Y Q;  5F2K A;  2KGC A;  3CCL P;  2JYL A;  2QEX P;  2X2B A;  2M8N A;  2GZF A;  1AYI A;  4QNB A;  3DS4 A;  1BAJ A;  5HVC A;  4GR6 A;  3CCQ P;  2FQ1 A;  2KGE A;  1KC8 Q;  2KW2 A;  4UHP B;  2LOL A;  3CME P;  2LKI A;  2MVU A;  5EJD A;  2EIA A;  1Z6M A;  2E1M A;  1Q81 Q;  1M90 Q;  2L4B A;  2CG5 B;  2GZE A;  3WBH A;  2JAZ A;  2OTL P;  1QRJ A;  2KGD A;  2XV6 A;  3U43 A;  3MGE A;  2DNW A;  2GDY A;  1T8K A;  1K8A Q;  3I56 P;  1YHQ P;  1ACP A;  4CA3 A;  2GZJ A;  1CEI A;  1DNY A;  2JO0 A;  4U0C A;  2XT1 A;  4R0M A;  1K30 A;  2VLP A;  1KD1 Q;  1M74 A;  4DG9 A;  3CCR P;  1YJN P;  2XZ0 D;  2MF4 A;  2JGP A;  2WPT A;  3B4Q A;  1VQL P;  3CC4 P;  1D1D A;  1GXG A;  4U0A A;  1K73 Q;  4NEO A;  3HYB A;  3CCU P;  2CGQ A;  2KOO A;  3RG6 C;  3DS3 A;  4COP A;  2JYG A;  5I4T G;  1W2B O;  1L0I A;  4PWV B;  1BXI A;  4U0E A;  3HZQ A;  2PEK A;  2KG9 A;  2LIW A;  3CCJ P;  3G4S P;  2GDX A;  2K0D X;  2EG5 A;  2KWL A;  3G0V A;  2GYK A;  1F80 D;  3Q20 A;  3LRY A;  2CQ8 A;  2EFJ A;  2N5I A;  4IZ6 A;  2OAR A;  2MR8 A;  1YI2 P;  3G21 A;  3GJN A;  2GZI A;  1VQ9 P;  2L0Q A;  1VQ5 P;  2AVA A;  5HGM A;  2FHS C;  2LF4 A;  1M6N A;  2N5H A;  1VQP P;  1DV5 A;  3E2D A;  3I55 P;  2FVA A;  2K93 A;  1VQ7 P;  3GZM A;  1NJI Q;  2M8P A;  1QVF O;  3DPH A;  3CCM P;  2EHS A;  1A43 A;  3G1I A;  1IMP A;  3CC2 P;  3CPW O;  3H4E A;  2PEO A;  5CZD B;  2KR5 A;  2FQ0 A;  2OTJ P;  5F2N A;  5KP8 B;  2GZG A;  2LL8 A;  2M5R A;  1EIA A;  3H0D A;  1HQB A;  1QVG O;  2L9F A;  1UNK A;  2Z46 A;  1RNI A;  2K0X A;  5HGO A;  3M1M A;  4XRO A;  2AF8 A;  3B5I A;  1ZMB A;  1YJW P;  1YJ9 P;  3EJE A;  4XFX A;  1VHN A;  4XFZ A;  1L0H A;  4XRQ A;  2N50 A;  4F37 A;  7CEI A;  5HGL A;  1GXH A;  3H47 A;  2LPK A;  3DS5 A;  1VQN P;  2AFE A;  3EJB A;  3CC7 P;  3NY7 B;  1IMQ A;  2ONT A;  1MZ8 A;  2VLO A;  2KGA A;  1EOQ A;  3G6E P;  5KP7 B;  3G1G A;  3DS1 A;  2N98 A;  2PNG A;  2KOS A;  3GKL C;  4GR2 A;  4H2Y C;  2LML A;  2KG6 A;  5BS1 A;  2FAE A;  2FAD A;  4HKG A;  2K92 A;  4U0B A;  2L22 A;  2QA4 P;  2N6Z A;  1HY8 A;  3G26 A;  1VQO P;  1VQ4 P;  2KOP A;  2VLN A;  1S72 P;  3CCS P;  2PEQ A;  2PEI A;  3G29 A;  2AFD A;  3GZL A;  3CXC O;  4XFY A;  1E6J P;  1VQ6 P;  2K2Q A;  2PEM A;  1VKU A;  2JU2 A;  3OW2 O;  1YIJ P;  2CWO A;  2LTE A;  1KQS O;  2FAC A;  4QKO A;  1AF8 A;  2PY8 A;  1A8O A;  1IUQ A;  1M6E X;  2JB0 A;  2NO8 A;  2KOQ A;  2K94 A;  1OR5 A;  3G28 A;  4PH0 A;  3G71 P;  1YIT P;  1RO2 A;  2Z44 A;  2XZ1 C;  2VLQ A;  2VSQ A;  5F2O A;  3DS0 A;  1E0H A;  1VQ8 P;  2Z45 A;  2K0Y A;  1RO0 A;  4PXH B;  5EW5 E;  2KOD A;  4BPH A;  3NTE A;  2M8L A;  4BPF A;  2JQ4 A;  2PEN A;  3CE7 A;  2FVE A;  1NQ4 A;  4U0D A;  2K5X A;  4IPY A;  2JBG A;  4H2W C;  1UJZ A;  5KP6 B;  5DCK A;  2XXM A;  2BHV A;  1KLP A;  2BUO A;  2MVV A;  4U0F A;  2GDW A;  1AUM A;  5HV8 A;  5HGN A;  2KG8 A;  3VRL C;  2KOR A;  4PH1 A;  1Q82 Q;  3P05 A;  4COC A;  2L6E A;  3LMO A; 
#chains in the Genus database with same CATH homology
 2AFD A;  2KR5 A;  2EHT A;  3EJD A;  3GZL A;  4MRT C;  4R0M A;  2FQ0 A;  5KP8 B;  4H2X C;  2K2Q A;  1VKU A;  2LL8 A;  2JU2 A;  4DG9 A;  4BPG A;  1X3O A;  2M5R A;  2ROQ A;  2MD9 A;  2LTE A;  1HQB A;  2XZ0 D;  2FAC A;  2MF4 A;  2JGP A;  1AF8 A;  2L9F A;  4NEO A;  2N6Y A;  2MY5 A;  2K0X A;  2FQ2 A;  2CGQ A;  2KOO A;  2MR7 A;  2KOQ A;  2CNR A;  2AF8 A;  2K94 A;  2LIU A;  1OR5 A;  2JU1 A;  1L0I A;  3EJE A;  4PWV B;  1L0H A;  2N50 A;  2KG9 A;  2LIW A;  2XZ1 C;  3RG2 A;  2GDX A;  2VSQ A;  2FVF A;  2QNW A;  2LPK A;  2KGC A;  2AFE A;  2X2B A;  2KWL A;  3EJB A;  2K0Y A;  1F80 D;  4PXH B;  2CQ8 A;  2N5I A;  4BPH A;  3NY7 B;  4IZ6 A;  4BPF A;  2JQ4 A;  2KGA A;  2MR8 A;  5KP7 B;  3CE7 A;  2FVE A;  1NQ4 A;  5HVC A;  2N98 A;  2L0Q A;  2FQ1 A;  2KGE A;  2PNG A;  2KOS A;  2KW2 A;  2AVA A;  2LOL A;  2FHS C;  2LKI A;  4H2W C;  5KP6 B;  4H2Y C;  2LML A;  2MVU A;  2KG6 A;  5EJD A;  2N5H A;  1DV5 A;  2FAE A;  2FAD A;  4HKG A;  2K92 A;  2L4B A;  1KLP A;  2CG5 B;  2FVA A;  2MVV A;  2K93 A;  3GZM A;  2GDW A;  2KGD A;  5HV8 A;  2L22 A;  2DNW A;  2EHS A;  2N6Z A;  2GDY A;  2KG8 A;  1HY8 A;  1T8K A;  2KOR A;  1ACP A;  4CA3 A;  2KOP A;  1DNY A;  3LMO A;  5CZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...