2FHSC

Structure of acyl carrier protein bound to fabi, the enoyl reductase from escherichia coli
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
76
structure length
57
Chain Sequence
STIEERVIIGVKQEEVTNNFVEDLGASLDTVELVMALEEEFDTTTVQAAIDYINGHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/biosynthetic protein
molecule keywords enoyl-[acyl-carrier-protein] reductase, NADH-dependent
publication title Structure of Acyl Carrier Protein Bound to FabI, the FASII Enoyl Reductase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 5
structure length 57
sequence length 76
ec nomenclature
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fhsC00
2FQ0A 5KP8B 2GDWA 2KGCA 2K2QA 2KG8A 2LIWA 5HVCA 4H2WC 2LMLA 4DG9A 2L0QA 2KGAA 2LL8A 3RG2A 2KORA 3GZMA 3EJBA 5KP6B 2FQ2A 2LPKA 3EJDA 1KLPA 1F80D 2XZ0D 2KWLA 2MR7A 2VSQA 2K0XA 4BPFA 2CQ8A 2N5HA 2K92A 2DNWA 2KOPA 2MD9A 1DNYA 3GZLA 1NQ4A 2FAEA 4H2YC 2KOSA 2L4BA 2EHSA 2FVAA 1VKUA 2EHTA 5EJDA 2LTEA 2FHSC 2AVAA 4HKGA 1OR5A 2KG9A 2FACA 2KOQA 2GDYA 4BPHA 5HV8A 4BPGA 2KW2A 2MR8A 3NY7B 2L9FA 1X3OA 2FVEA 2M5RA 2JQ4A 2K0YA 2N50A 5CZDB 5KP7B 2FQ1A 1L0HA 2MY5A 2AFEA 2FADA 2PNGA 1T8KA 2MF4A 2KOOA 2N6ZA 2N5IA 2L22A 1ACPA 2KG6A 3LMOA 1L0IA 2CGQA 2QNWA 4CA3A 4H2XC 2K93A 2N98A 1HY8A 1DV5A 4MRTC 2CNRA 4NEOA 2LIUA 2LKIA 2KGDA 2JGPA 2GDXA 2K94A 2ROQA 4PXHB 2AF8A 2MVVA 2CG5B 2KGEA 2LOLA 4PWVB 2X2BA 1AF8A 2FVFA 3CE7A 4R0MA 4IZ6A 2JU2A 2AFDA 2XZ1C 2N6YA 1HQBA 2KR5A 2MVUA 2JU1A 3EJEA
chains in the Genus database with same CATH superfamily
2FQ0A 5KP8B 2Z44A 2K2QA 2LMLA 1Z6MA 2JAZA 2GZEA 2LPKA 3E2DA 3G1GA 2ONTA 2KWLA 2MR7A 2VSQA 2K0XA 1K8AQ 2BHVA 1DNYA 3GZLA 2FAEA 2KOSA 5HGMA 2FVAA 5EJDA 1M1KQ 1OR5A 2GZFA 2GDYA 4U0BA 1YHQP 1EMVA 1D1DA 3NTEA 3NY7B 2L9FA 4COCA 5BS1A 2M5RA 1M6NA 1IUQA 2WPTA 2N50A 2PEKA 2FQ1A 1GPJA 2PENA 3B5IA 3LMOA 1GXGA 2K93A 1YIJP 3G71P 2EFJA 4NEOA 2Z45A 7CEIA 1MZ8A 2PEMA 4PH0A 1NJIQ 1Q7YQ 4COPA 3CCSP 3G28A 2FVFA 4XFYA 4IZ6A 3CCLP 3I55P 1KD1Q 2BUOA 5JPAA 2PEQA 3CCJP 3CCQP 2NO8A 3CPWO 1HQBA 4UHPB 2MVUA 4U0DA 2JU1A 2JBGA 2GDWA 2KGCA 3HYBA 1Q86Q 3CCEP 2KG8A 4H2WC 1VQPP 4DG9A 2L0QA 3RG2A 3GZMA 2JYGA 3EJBA 3EJDA 1AUMA 1F80D 2K0DX 1UNKA 3B4QA 4BPFA 4U0AA 2K92A 2DNWA 2Z46A 1CEIA 3G1IA 1AYIA 1VKUA 2M8PA 5EW5E 2KOQA 4BPHA 1VQLP 4BPGA 2KW2A 3M1MA 3G29A 4QNBA 1S72P 2K0YA 5CZDB 2M8LA 4GR2A 4GR6A 2AFEA 2FADA 1IMPA 2N5IA 2QNWA 2CGQA 4CA3A 3DS0A 2JYLA 1W2BO 2OARA 2GZJA 3WBHA 2K94A 1VQKP 1Q82Q 3P05A 2X2BA 3CCUP 2L6EA 4R0MA 5HGNA 1M74A 2AFDA 2XZ1C 4XFZA 5F2OA 4U0CA 3CCRP 3G4SP 2KR5A 3CD6P 4F37A 5HGLA 1GXHA 2JB0A 4QKOA 2VLPA 1YJWP 3CC7P 2XV6A 2KGAA 5KP6B 1KLPA 3DS5A 2XZ0D 2P9XA 2KOPA 2PEJA 2L4BA 3G21A 1EIAA 2EHTA 2LTEA 1QRJA 2FHSC 2AVAA 4HKGA 1RNIA 1KC8Q 3LRYA 5HV8A 1K9MQ 3MGEA 2EIAA 2MR8A 1X3OA 3CCVP 2FVEA 2PY8A 2JQ4A 1YJNP 4M0IA 3RG6C 2OTJP 1FR2A 1VQ5P 1E0HA 2LF4A 4XROA 2GYKA 1ZNVA 3CMAP 1BXIA 2QA4P 3H47A 1VQNP 2GZIA 2MY5A 1T8KA 2MF4A 2KOOA 5DCKA 1ACPA 2KG6A 1VQ6P 1VQ4P 1YI2P 2PEOA 2N98A 1HY8A 1DV5A 2CNRA 4U0EA 2LKIA 2JGPA 2ROQA 4PXHB 2AF8A 3G0VA 2KGEA 2LOLA 1Q81Q 1AF8A 2VLNA 2E1MA 1VQ7P 1KQSO 1QVFO 2QEXP 3Q20A 3CC4P 4WYMA 4U0FA 3DS1A 1A8OA 2N6YA 1RO0A 3GKLC 3H4EA 3CMEP 1RO2A 2KODA 1E6JP 1YJ9P 3DTJA 3G6EP 5F2NA 2LIWA 5HVCA 4IPYA 3DPHA 1JJ2O 3U43A 1N8RQ 1EOQA 2LL8A 2KORA 3CC2P 4PH1A 2FQ2A 2CWOA 2CQ8A 2N5HA 2MD9A 1NQ4A 4H2YC 2EHSA 4XRQA 1VQMP 2KG9A 2FACA 2XT1A 2EG5A 4XFXA 1VQ8P 3DS3A 2PEIA 3VRLC 3DS2A 2XXMA 3H0DA 1YITP 1IMQA 2K5XA 1VHNA 1M90Q 3G26A 5KP7B 1L0HA 2PNGA 1K30A 2N6ZA 2L22A 3HZQA 1ZMBA 1L0IA 4H2XC 2JO0A 5F2KA 1A43A 4MRTC 1VQ9P 2LIUA 5BS2A 2KGDA 2ERHA 2DGYA 2GDXA 2MVVA 2OTLP 2CG5B 1UJZA 3I56P 4PWVB 5I4TG 2VLOA 5HGOA 3CE7A 1K73Q 3CXCO 1VQOP 3GJNA 2JU2A 3CCMP 2M8NA 3OW2O 1M6EX 2GZGA 1BAJA 3DS4A 1QVGO 3EJEA 2VLQA
chains in the Genus database with same CATH topology
2FQ0A 5KP8B 2GDWA 2KGCA 2K2QA 2KG8A 2LIWA 5HVCA 4H2WC 2LMLA 4DG9A 2L0QA 2KGAA 2LL8A 3RG2A 2KORA 3GZMA 3EJBA 5KP6B 2FQ2A 2LPKA 3EJDA 1KLPA 1F80D 2XZ0D 2KWLA 2MR7A 2VSQA 2K0XA 4BPFA 2CQ8A 2N5HA 2K92A 2DNWA 2KOPA 2MD9A 1DNYA 3GZLA 1NQ4A 2FAEA 4H2YC 2KOSA 2L4BA 2EHSA 2FVAA 1VKUA 2EHTA 5EJDA 2LTEA 2FHSC 2AVAA 4HKGA 1OR5A 2KG9A 2FACA 2KOQA 2GDYA 4BPHA 5HV8A 4BPGA 2KW2A 2MR8A 3NY7B 2L9FA 1X3OA 2FVEA 2M5RA 2JQ4A 2K0YA 2N50A 5CZDB 5KP7B 2FQ1A 1L0HA 2MY5A 2AFEA 2FADA 2PNGA 1T8KA 2MF4A 2KOOA 2N6ZA 2N5IA 2L22A 1ACPA 2KG6A 3LMOA 1L0IA 2CGQA 2QNWA 4CA3A 4H2XC 2K93A 2N98A 1HY8A 1DV5A 4MRTC 2CNRA 4NEOA 2LIUA 2LKIA 2KGDA 2JGPA 2GDXA 2K94A 2ROQA 4PXHB 2AF8A 2MVVA 2CG5B 2KGEA 2LOLA 4PWVB 2X2BA 1AF8A 2FVFA 3CE7A 4R0MA 4IZ6A 2JU2A 2AFDA 2XZ1C 2N6YA 1HQBA 2KR5A 2MVUA 2JU1A 3EJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQ0 A;  5KP8 B;  2GDW A;  2KGC A;  2K2Q A;  2KG8 A;  2LIW A;  5HVC A;  4H2W C;  2LML A;  4DG9 A;  2L0Q A;  2KGA A;  2LL8 A;  3RG2 A;  2KOR A;  3GZM A;  3EJB A;  5KP6 B;  2FQ2 A;  2LPK A;  3EJD A;  1KLP A;  1F80 D;  2XZ0 D;  2KWL A;  2MR7 A;  2VSQ A;  2K0X A;  4BPF A;  2CQ8 A;  2N5H A;  2K92 A;  2DNW A;  2KOP A;  2MD9 A;  1DNY A;  3GZL A;  1NQ4 A;  2FAE A;  4H2Y C;  2KOS A;  2L4B A;  2EHS A;  2FVA A;  1VKU A;  2EHT A;  5EJD A;  2LTE A;  2FHS C;  2AVA A;  4HKG A;  1OR5 A;  2KG9 A;  2FAC A;  2KOQ A;  2GDY A;  4BPH A;  5HV8 A;  4BPG A;  2KW2 A;  2MR8 A;  3NY7 B;  2L9F A;  1X3O A;  2FVE A;  2M5R A;  2JQ4 A;  2K0Y A;  2N50 A;  5CZD B;  5KP7 B;  2FQ1 A;  1L0H A;  2MY5 A;  2AFE A;  2FAD A;  2PNG A;  1T8K A;  2MF4 A;  2KOO A;  2N6Z A;  2N5I A;  2L22 A;  1ACP A;  2KG6 A;  3LMO A;  1L0I A;  2CGQ A;  2QNW A;  4CA3 A;  4H2X C;  2K93 A;  2N98 A;  1HY8 A;  1DV5 A;  4MRT C;  2CNR A;  4NEO A;  2LIU A;  2LKI A;  2KGD A;  2JGP A;  2GDX A;  2K94 A;  2ROQ A;  4PXH B;  2AF8 A;  2MVV A;  2CG5 B;  2KGE A;  2LOL A;  4PWV B;  2X2B A;  1AF8 A;  2FVF A;  3CE7 A;  4R0M A;  4IZ6 A;  2JU2 A;  2AFD A;  2XZ1 C;  2N6Y A;  1HQB A;  2KR5 A;  2MVU A;  2JU1 A;  3EJE A; 
#chains in the Genus database with same CATH topology
 2FQ0 A;  5KP8 B;  2Z44 A;  2K2Q A;  2LML A;  1Z6M A;  2JAZ A;  2GZE A;  2LPK A;  3E2D A;  3G1G A;  2ONT A;  2KWL A;  2MR7 A;  2VSQ A;  2K0X A;  1K8A Q;  2BHV A;  1DNY A;  3GZL A;  2FAE A;  2KOS A;  5HGM A;  2FVA A;  5EJD A;  1M1K Q;  1OR5 A;  2GZF A;  2GDY A;  4U0B A;  1YHQ P;  1EMV A;  1D1D A;  3NTE A;  3NY7 B;  2L9F A;  4COC A;  5BS1 A;  2M5R A;  1M6N A;  1IUQ A;  2WPT A;  2N50 A;  2PEK A;  2FQ1 A;  1GPJ A;  2PEN A;  3B5I A;  3LMO A;  1GXG A;  2K93 A;  1YIJ P;  3G71 P;  2EFJ A;  4NEO A;  2Z45 A;  7CEI A;  1MZ8 A;  2PEM A;  4PH0 A;  1NJI Q;  1Q7Y Q;  4COP A;  3CCS P;  3G28 A;  2FVF A;  4XFY A;  4IZ6 A;  3CCL P;  3I55 P;  1KD1 Q;  2BUO A;  5JPA A;  2PEQ A;  3CCJ P;  3CCQ P;  2NO8 A;  3CPW O;  1HQB A;  4UHP B;  2MVU A;  4U0D A;  2JU1 A;  2JBG A;  2GDW A;  2KGC A;  3HYB A;  1Q86 Q;  3CCE P;  2KG8 A;  4H2W C;  1VQP P;  4DG9 A;  2L0Q A;  3RG2 A;  3GZM A;  2JYG A;  3EJB A;  3EJD A;  1AUM A;  1F80 D;  2K0D X;  1UNK A;  3B4Q A;  4BPF A;  4U0A A;  2K92 A;  2DNW A;  2Z46 A;  1CEI A;  3G1I A;  1AYI A;  1VKU A;  2M8P A;  5EW5 E;  2KOQ A;  4BPH A;  1VQL P;  4BPG A;  2KW2 A;  3M1M A;  3G29 A;  4QNB A;  1S72 P;  2K0Y A;  5CZD B;  2M8L A;  4GR2 A;  4GR6 A;  2AFE A;  2FAD A;  1IMP A;  2N5I A;  2QNW A;  2CGQ A;  4CA3 A;  3DS0 A;  2JYL A;  1W2B O;  2OAR A;  2GZJ A;  3WBH A;  2K94 A;  1VQK P;  1Q82 Q;  3P05 A;  2X2B A;  3CCU P;  2L6E A;  4R0M A;  5HGN A;  1M74 A;  2AFD A;  2XZ1 C;  4XFZ A;  5F2O A;  4U0C A;  3CCR P;  3G4S P;  2KR5 A;  3CD6 P;  4F37 A;  5HGL A;  1GXH A;  2JB0 A;  4QKO A;  2VLP A;  1YJW P;  3CC7 P;  2XV6 A;  2KGA A;  5KP6 B;  1KLP A;  3DS5 A;  2XZ0 D;  2P9X A;  2KOP A;  2PEJ A;  2L4B A;  3G21 A;  1EIA A;  2EHT A;  2LTE A;  1QRJ A;  2FHS C;  2AVA A;  4HKG A;  1RNI A;  1KC8 Q;  3LRY A;  5HV8 A;  1K9M Q;  3MGE A;  2EIA A;  2MR8 A;  1X3O A;  3CCV P;  2FVE A;  2PY8 A;  2JQ4 A;  1YJN P;  4M0I A;  3RG6 C;  2OTJ P;  1FR2 A;  1VQ5 P;  1E0H A;  2LF4 A;  4XRO A;  2GYK A;  1ZNV A;  3CMA P;  1BXI A;  2QA4 P;  3H47 A;  1VQN P;  2GZI A;  2MY5 A;  1T8K A;  2MF4 A;  2KOO A;  5DCK A;  1ACP A;  2KG6 A;  1VQ6 P;  1VQ4 P;  1YI2 P;  2PEO A;  2N98 A;  1HY8 A;  1DV5 A;  2CNR A;  4U0E A;  2LKI A;  2JGP A;  2ROQ A;  4PXH B;  2AF8 A;  3G0V A;  2KGE A;  2LOL A;  1Q81 Q;  1AF8 A;  2VLN A;  2E1M A;  1VQ7 P;  1KQS O;  1QVF O;  2QEX P;  3Q20 A;  3CC4 P;  4WYM A;  4U0F A;  3DS1 A;  1A8O A;  2N6Y A;  1RO0 A;  3GKL C;  3H4E A;  3CME P;  1RO2 A;  2KOD A;  1E6J P;  1YJ9 P;  3DTJ A;  3G6E P;  5F2N A;  2LIW A;  5HVC A;  4IPY A;  3DPH A;  1JJ2 O;  3U43 A;  1N8R Q;  1EOQ A;  2LL8 A;  2KOR A;  3CC2 P;  4PH1 A;  2FQ2 A;  2CWO A;  2CQ8 A;  2N5H A;  2MD9 A;  1NQ4 A;  4H2Y C;  2EHS A;  4XRQ A;  1VQM P;  2KG9 A;  2FAC A;  2XT1 A;  2EG5 A;  4XFX A;  1VQ8 P;  3DS3 A;  2PEI A;  3VRL C;  3DS2 A;  2XXM A;  3H0D A;  1YIT P;  1IMQ A;  2K5X A;  1VHN A;  1M90 Q;  3G26 A;  5KP7 B;  1L0H A;  2PNG A;  1K30 A;  2N6Z A;  2L22 A;  3HZQ A;  1ZMB A;  1L0I A;  4H2X C;  2JO0 A;  5F2K A;  1A43 A;  4MRT C;  1VQ9 P;  2LIU A;  5BS2 A;  2KGD A;  2ERH A;  2DGY A;  2GDX A;  2MVV A;  2OTL P;  2CG5 B;  1UJZ A;  3I56 P;  4PWV B;  5I4T G;  2VLO A;  5HGO A;  3CE7 A;  1K73 Q;  3CXC O;  1VQO P;  3GJN A;  2JU2 A;  3CCM P;  2M8N A;  3OW2 O;  1M6E X;  2GZG A;  1BAJ A;  3DS4 A;  1QVG O;  3EJE A;  2VLQ A; 
#chains in the Genus database with same CATH homology
 2FQ0 A;  5KP8 B;  2GDW A;  2KGC A;  2K2Q A;  2KG8 A;  2LIW A;  5HVC A;  4H2W C;  2LML A;  4DG9 A;  2L0Q A;  2KGA A;  2LL8 A;  3RG2 A;  2KOR A;  3GZM A;  3EJB A;  5KP6 B;  2FQ2 A;  2LPK A;  3EJD A;  1KLP A;  1F80 D;  2XZ0 D;  2KWL A;  2MR7 A;  2VSQ A;  2K0X A;  4BPF A;  2CQ8 A;  2N5H A;  2K92 A;  2DNW A;  2KOP A;  2MD9 A;  1DNY A;  3GZL A;  1NQ4 A;  2FAE A;  4H2Y C;  2KOS A;  2L4B A;  2EHS A;  2FVA A;  1VKU A;  2EHT A;  5EJD A;  2LTE A;  2FHS C;  2AVA A;  4HKG A;  1OR5 A;  2KG9 A;  2FAC A;  2KOQ A;  2GDY A;  4BPH A;  5HV8 A;  4BPG A;  2KW2 A;  2MR8 A;  3NY7 B;  2L9F A;  1X3O A;  2FVE A;  2M5R A;  2JQ4 A;  2K0Y A;  2N50 A;  5CZD B;  5KP7 B;  2FQ1 A;  1L0H A;  2MY5 A;  2AFE A;  2FAD A;  2PNG A;  1T8K A;  2MF4 A;  2KOO A;  2N6Z A;  2N5I A;  2L22 A;  1ACP A;  2KG6 A;  3LMO A;  1L0I A;  2CGQ A;  2QNW A;  4CA3 A;  4H2X C;  2K93 A;  2N98 A;  1HY8 A;  1DV5 A;  4MRT C;  2CNR A;  4NEO A;  2LIU A;  2LKI A;  2KGD A;  2JGP A;  2GDX A;  2K94 A;  2ROQ A;  4PXH B;  2AF8 A;  2MVV A;  2CG5 B;  2KGE A;  2LOL A;  4PWV B;  2X2B A;  1AF8 A;  2FVF A;  3CE7 A;  4R0M A;  4IZ6 A;  2JU2 A;  2AFD A;  2XZ1 C;  2N6Y A;  1HQB A;  2KR5 A;  2MVU A;  2JU1 A;  3EJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...