2FHSC

Structure of acyl carrier protein bound to fabi, the enoyl reductase from escherichia coli
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
76
structure length
57
Chain Sequence
STIEERVIIGVKQEEVTNNFVEDLGASLDTVELVMALEEEFDTTTVQAAIDYINGHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords enoyl-[acyl-carrier-protein] reductase, NADH-dependent
publication title Structure of Acyl Carrier Protein Bound to FabI, the FASII Enoyl Reductase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/biosynthetic protein
total genus 5
structure length 57
sequence length 76
ec nomenclature
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fhsC00
2CQ8A 2PNGA 2LOLA 5KP6B 2LTEA 2N6ZA 2FVEA 2GDXA 2KGEA 2KR5A 2LIWA 4DG9A 2XZ1C 2FVFA 4MRTC 3RG2A 2KOPA 2MY5A 4R0MA 4IZ6A 2AVAA 2MVVA 4HKGA 2K0XA 2KG8A 4CA3A 2FVAA 2MF4A 2L22A 5KP7B 2N50A 4BPGA 1AF8A 2LIUA 2CNRA 2MD9A 1T8KA 2LKIA 3CE7A 3EJBA 2KG6A 1F80D 1L0IA 2AFEA 2LMLA 4PXHB 2DNWA 2AFDA 2EHTA 2MR7A 2FQ0A 2FQ2A 3GZLA 1DV5A 2K0YA 1ACPA 5HVCA 2KWLA 2K92A 2JQ4A 5HV8A 2N5HA 2FQ1A 1L0HA 2GDWA 2M5RA 5EJDA 1HQBA 1X3OA 1OR5A 2KOSA 1DNYA 2KW2A 3GZMA 2KOQA 2JGPA 2QNWA 2N98A 2K93A 2CGQA 4H2XC 4NEOA 2LPKA 3NY7B 2FAEA 3LMOA 2N6YA 2N5IA 2MVUA 2FADA 2GDYA 4H2YC 2FHSC 2LL8A 2AF8A 3EJEA 2EHSA 2KGAA 3EJDA 2MR8A 2KGDA 2FACA 2L4BA 5KP8B 2ROQA 2JU2A 1HY8A 2JU1A 2L0QA 4PWVB 2KOOA 2KORA 2K94A 2X2BA 2CG5B 4H2WC 4BPHA 2K2QA 1VKUA 5CZDB 4BPFA 1NQ4A 2KG9A 2VSQA 2KGCA 1KLPA 2L9FA 2XZ0D
chains in the Genus database with same CATH superfamily
3I55P 1YJNP 2VLOA 1YI2P 3G21A 1GPJA 2GDXA 2XZ1C 4GR2A 4IZ6A 1VQLP 2AVAA 2MVVA 1NJIQ 4HKGA 2KG8A 3G71P 2EFJA 3CMAP 1S72P 2FVAA 1BAJA 1KC8Q 1RO0A 3CCJP 2M8PA 1T8KA 1KQSO 2LKIA 3CE7A 2PEOA 1UNKA 2PEMA 1W2BO 1L0IA 3VRLC 2GZGA 2KWLA 3Q20A 5HV8A 2N5HA 1L0HA 2GDWA 5EJDA 2E1MA 5HGNA 1DNYA 1GXGA 2KW2A 2XV6A 1RNIA 2CGQA 2K93A 3G0VA 2FAEA 2N6YA 1VQ4P 1EOQA 2VLQA 2NO8A 2K0DX 3U43A 2LL8A 3EJEA 1VQPP 2MR8A 2QA4P 3CXCO 2JU2A 4F37A 3CCEP 2KOOA 4QNBA 4U0EA 1MZ8A 2KORA 3CCSP 1AUMA 2X2BA 5F2NA 2JBGA 5CZDB 1M74A 1K73Q 1M1KQ 1KLPA 2L9FA 2XZ0D 2LOLA 2PEIA 2KR5A 2JYLA 3B4QA 3HYBA 2FVFA 4MRTC 4XFXA 3RG2A 3G28A 2MY5A 4U0CA 1GXHA 3H47A 3DS0A 3CC7P 5KP7B 3CCMP 3CCVP 1VQMP 4U0AA 4PH0A 2GZJA 3CD6P 3EJBA 2ERHA 2Z44A 1YJ9P 1F80D 3CCUP 1M6NA 2LMLA 4PXHB 3H0DA 1Q7YQ 2AFDA 4XRQA 2EHTA 2FQ0A 3GZLA 1DV5A 1ACPA 1RO2A 2FQ1A 3CPWO 5JPAA 1E0HA 3LRYA 3GKLC 4COCA 2QEXP 2Z46A 1A43A 1X3OA 2LF4A 2KOSA 3GZMA 2JGPA 2N98A 7CEIA 3DS5A 1E6JP 1VQKP 2LPKA 5F2OA 2OTJP 3NTEA 2M8LA 2K5XA 3CC2P 2N5IA 2GDYA 5BS1A 2EIAA 2AF8A 2Z45A 2EHSA 3EJDA 3GJNA 1Q81Q 2GZEA 4IPYA 2JO0A 3MGEA 3CC4P 2CWOA 3WBHA 1VQOP 1K8AQ 2M8NA 4BPHA 1VKUA 1N8RQ 1M6EX 4BPFA 1VQNP 3G1GA 1IMQA 2PNGA 2N6ZA 1VHNA 3B5IA 2LIWA 1CEIA 2BHVA 3DS3A 2PEQA 2K0XA 2OARA 2JYGA 2MF4A 2L22A 4BPGA 1YJWP 1D1DA 2LIUA 1Q82Q 2CNRA 2OTLP 1QVFO 2MD9A 2DGYA 1Q86Q 3CMEP 3M1MA 1JJ2O 2AFEA 2JAZA 2PEKA 2ONTA 2K0YA 5HVCA 4XFYA 2K92A 4QKOA 2JQ4A 4COPA 2M5RA 2PEJA 1YITP 1OR5A 1K30A 1ZMBA 1QVGO 2KOQA 3CCQP 2QNWA 1KD1Q 1VQ8P 4U0BA 4H2XC 5HGMA 1VQ9P 3DPHA 3DS4A 1IUQA 2FHSC 5DCKA 1FR2A 5KP8B 2ROQA 3CCLP 1YIJP 1HY8A 2JU1A 1EMVA 1M90Q 4PWVB 2CG5B 2K2QA 4U0DA 4WYMA 3DS1A 2KG9A 4U0FA 2VSQA 2JB0A 3CCRP 2EG5A 2VLPA 2CQ8A 2GZFA 5KP6B 2LTEA 5EW5E 2FVEA 2KGEA 2P9XA 4DG9A 2KOPA 2VLNA 4PH1A 5I4TG 4R0MA 4XFZA 3DS2A 4CA3A 2GZIA 2XXMA 3G4SP 1EIAA 2N50A 4GR6A 1AF8A 5HGLA 1ZNVA 2PENA 3DTJA 1AYIA 3HZQA 1VQ6P 2KG6A 2PY8A 2WPTA 2DNWA 2MR7A 2FQ2A 5F2KA 1IMPA 1VQ7P 1K9MQ 2L6EA 3G26A 1UJZA 4UHPB 3P05A 1HQBA 1YHQP 4M0IA 1BXIA 2BUOA 4NEOA 2GYKA 3G1IA 3G29A 3NY7B 3LMOA 4XROA 3OW2O 3G6EP 3E2DA 5BS2A 2MVUA 1Z6MA 2FADA 4H2YC 3RG6C 1A8OA 2KGAA 1QRJA 2KGDA 5HGOA 2FACA 2L4BA 1VQ5P 2KODA 3H4EA 2XT1A 2L0QA 2K94A 4H2WC 3I56P 1NQ4A 2KGCA
chains in the Genus database with same CATH topology
2CQ8A 2PNGA 2LOLA 5KP6B 2LTEA 2N6ZA 2FVEA 2GDXA 2KGEA 2KR5A 2LIWA 4DG9A 2XZ1C 2FVFA 4MRTC 3RG2A 2KOPA 2MY5A 4R0MA 4IZ6A 2AVAA 2MVVA 4HKGA 2K0XA 2KG8A 4CA3A 2FVAA 2MF4A 2L22A 5KP7B 2N50A 4BPGA 1AF8A 2LIUA 2CNRA 2MD9A 1T8KA 2LKIA 3CE7A 3EJBA 2KG6A 1F80D 1L0IA 2AFEA 2LMLA 4PXHB 2DNWA 2AFDA 2EHTA 2MR7A 2FQ0A 2FQ2A 3GZLA 1DV5A 2K0YA 1ACPA 5HVCA 2KWLA 2K92A 2JQ4A 5HV8A 2N5HA 2FQ1A 1L0HA 2GDWA 2M5RA 5EJDA 1HQBA 1X3OA 1OR5A 2KOSA 1DNYA 2KW2A 3GZMA 2KOQA 2JGPA 2QNWA 2N98A 2K93A 2CGQA 4H2XC 4NEOA 2LPKA 3NY7B 2FAEA 3LMOA 2N6YA 2N5IA 2MVUA 2FADA 2GDYA 4H2YC 2FHSC 2LL8A 2AF8A 3EJEA 2EHSA 2KGAA 3EJDA 2MR8A 2KGDA 2FACA 2L4BA 5KP8B 2ROQA 2JU2A 1HY8A 2JU1A 2L0QA 4PWVB 2KOOA 2KORA 2K94A 2X2BA 2CG5B 4H2WC 4BPHA 2K2QA 1VKUA 5CZDB 4BPFA 1NQ4A 2KG9A 2VSQA 2KGCA 1KLPA 2L9FA 2XZ0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQ8 A;  2PNG A;  2LOL A;  5KP6 B;  2LTE A;  2N6Z A;  2FVE A;  2GDX A;  2KGE A;  2KR5 A;  2LIW A;  4DG9 A;  2XZ1 C;  2FVF A;  4MRT C;  3RG2 A;  2KOP A;  2MY5 A;  4R0M A;  4IZ6 A;  2AVA A;  2MVV A;  4HKG A;  2K0X A;  2KG8 A;  4CA3 A;  2FVA A;  2MF4 A;  2L22 A;  5KP7 B;  2N50 A;  4BPG A;  1AF8 A;  2LIU A;  2CNR A;  2MD9 A;  1T8K A;  2LKI A;  3CE7 A;  3EJB A;  2KG6 A;  1F80 D;  1L0I A;  2AFE A;  2LML A;  4PXH B;  2DNW A;  2AFD A;  2EHT A;  2MR7 A;  2FQ0 A;  2FQ2 A;  3GZL A;  1DV5 A;  2K0Y A;  1ACP A;  5HVC A;  2KWL A;  2K92 A;  2JQ4 A;  5HV8 A;  2N5H A;  2FQ1 A;  1L0H A;  2GDW A;  2M5R A;  5EJD A;  1HQB A;  1X3O A;  1OR5 A;  2KOS A;  1DNY A;  2KW2 A;  3GZM A;  2KOQ A;  2JGP A;  2QNW A;  2N98 A;  2K93 A;  2CGQ A;  4H2X C;  4NEO A;  2LPK A;  3NY7 B;  2FAE A;  3LMO A;  2N6Y A;  2N5I A;  2MVU A;  2FAD A;  2GDY A;  4H2Y C;  2FHS C;  2LL8 A;  2AF8 A;  3EJE A;  2EHS A;  2KGA A;  3EJD A;  2MR8 A;  2KGD A;  2FAC A;  2L4B A;  5KP8 B;  2ROQ A;  2JU2 A;  1HY8 A;  2JU1 A;  2L0Q A;  4PWV B;  2KOO A;  2KOR A;  2K94 A;  2X2B A;  2CG5 B;  4H2W C;  4BPH A;  2K2Q A;  1VKU A;  5CZD B;  4BPF A;  1NQ4 A;  2KG9 A;  2VSQ A;  2KGC A;  1KLP A;  2L9F A;  2XZ0 D; 
#chains in the Genus database with same CATH topology
 3I55 P;  1YJN P;  2VLO A;  1YI2 P;  3G21 A;  1GPJ A;  2GDX A;  2XZ1 C;  4GR2 A;  4IZ6 A;  1VQL P;  2AVA A;  2MVV A;  1NJI Q;  4HKG A;  2KG8 A;  3G71 P;  2EFJ A;  3CMA P;  1S72 P;  2FVA A;  1BAJ A;  1KC8 Q;  1RO0 A;  3CCJ P;  2M8P A;  1T8K A;  1KQS O;  2LKI A;  3CE7 A;  2PEO A;  1UNK A;  2PEM A;  1W2B O;  1L0I A;  3VRL C;  2GZG A;  2KWL A;  3Q20 A;  5HV8 A;  2N5H A;  1L0H A;  2GDW A;  5EJD A;  2E1M A;  5HGN A;  1DNY A;  1GXG A;  2KW2 A;  2XV6 A;  1RNI A;  2CGQ A;  2K93 A;  3G0V A;  2FAE A;  2N6Y A;  1VQ4 P;  1EOQ A;  2VLQ A;  2NO8 A;  2K0D X;  3U43 A;  2LL8 A;  3EJE A;  1VQP P;  2MR8 A;  2QA4 P;  3CXC O;  2JU2 A;  4F37 A;  3CCE P;  2KOO A;  4QNB A;  4U0E A;  1MZ8 A;  2KOR A;  3CCS P;  1AUM A;  2X2B A;  5F2N A;  2JBG A;  5CZD B;  1M74 A;  1K73 Q;  1M1K Q;  1KLP A;  2L9F A;  2XZ0 D;  2LOL A;  2PEI A;  2KR5 A;  2JYL A;  3B4Q A;  3HYB A;  2FVF A;  4MRT C;  4XFX A;  3RG2 A;  3G28 A;  2MY5 A;  4U0C A;  1GXH A;  3H47 A;  3DS0 A;  3CC7 P;  5KP7 B;  3CCM P;  3CCV P;  1VQM P;  4U0A A;  4PH0 A;  2GZJ A;  3CD6 P;  3EJB A;  2ERH A;  2Z44 A;  1YJ9 P;  1F80 D;  3CCU P;  1M6N A;  2LML A;  4PXH B;  3H0D A;  1Q7Y Q;  2AFD A;  4XRQ A;  2EHT A;  2FQ0 A;  3GZL A;  1DV5 A;  1ACP A;  1RO2 A;  2FQ1 A;  3CPW O;  5JPA A;  1E0H A;  3LRY A;  3GKL C;  4COC A;  2QEX P;  2Z46 A;  1A43 A;  1X3O A;  2LF4 A;  2KOS A;  3GZM A;  2JGP A;  2N98 A;  7CEI A;  3DS5 A;  1E6J P;  1VQK P;  2LPK A;  5F2O A;  2OTJ P;  3NTE A;  2M8L A;  2K5X A;  3CC2 P;  2N5I A;  2GDY A;  5BS1 A;  2EIA A;  2AF8 A;  2Z45 A;  2EHS A;  3EJD A;  3GJN A;  1Q81 Q;  2GZE A;  4IPY A;  2JO0 A;  3MGE A;  3CC4 P;  2CWO A;  3WBH A;  1VQO P;  1K8A Q;  2M8N A;  4BPH A;  1VKU A;  1N8R Q;  1M6E X;  4BPF A;  1VQN P;  3G1G A;  1IMQ A;  2PNG A;  2N6Z A;  1VHN A;  3B5I A;  2LIW A;  1CEI A;  2BHV A;  3DS3 A;  2PEQ A;  2K0X A;  2OAR A;  2JYG A;  2MF4 A;  2L22 A;  4BPG A;  1YJW P;  1D1D A;  2LIU A;  1Q82 Q;  2CNR A;  2OTL P;  1QVF O;  2MD9 A;  2DGY A;  1Q86 Q;  3CME P;  3M1M A;  1JJ2 O;  2AFE A;  2JAZ A;  2PEK A;  2ONT A;  2K0Y A;  5HVC A;  4XFY A;  2K92 A;  4QKO A;  2JQ4 A;  4COP A;  2M5R A;  2PEJ A;  1YIT P;  1OR5 A;  1K30 A;  1ZMB A;  1QVG O;  2KOQ A;  3CCQ P;  2QNW A;  1KD1 Q;  1VQ8 P;  4U0B A;  4H2X C;  5HGM A;  1VQ9 P;  3DPH A;  3DS4 A;  1IUQ A;  2FHS C;  5DCK A;  1FR2 A;  5KP8 B;  2ROQ A;  3CCL P;  1YIJ P;  1HY8 A;  2JU1 A;  1EMV A;  1M90 Q;  4PWV B;  2CG5 B;  2K2Q A;  4U0D A;  4WYM A;  3DS1 A;  2KG9 A;  4U0F A;  2VSQ A;  2JB0 A;  3CCR P;  2EG5 A;  2VLP A;  2CQ8 A;  2GZF A;  5KP6 B;  2LTE A;  5EW5 E;  2FVE A;  2KGE A;  2P9X A;  4DG9 A;  2KOP A;  2VLN A;  4PH1 A;  5I4T G;  4R0M A;  4XFZ A;  3DS2 A;  4CA3 A;  2GZI A;  2XXM A;  3G4S P;  1EIA A;  2N50 A;  4GR6 A;  1AF8 A;  5HGL A;  1ZNV A;  2PEN A;  3DTJ A;  1AYI A;  3HZQ A;  1VQ6 P;  2KG6 A;  2PY8 A;  2WPT A;  2DNW A;  2MR7 A;  2FQ2 A;  5F2K A;  1IMP A;  1VQ7 P;  1K9M Q;  2L6E A;  3G26 A;  1UJZ A;  4UHP B;  3P05 A;  1HQB A;  1YHQ P;  4M0I A;  1BXI A;  2BUO A;  4NEO A;  2GYK A;  3G1I A;  3G29 A;  3NY7 B;  3LMO A;  4XRO A;  3OW2 O;  3G6E P;  3E2D A;  5BS2 A;  2MVU A;  1Z6M A;  2FAD A;  4H2Y C;  3RG6 C;  1A8O A;  2KGA A;  1QRJ A;  2KGD A;  5HGO A;  2FAC A;  2L4B A;  1VQ5 P;  2KOD A;  3H4E A;  2XT1 A;  2L0Q A;  2K94 A;  4H2W C;  3I56 P;  1NQ4 A;  2KGC A; 
#chains in the Genus database with same CATH homology
 2CQ8 A;  2PNG A;  2LOL A;  5KP6 B;  2LTE A;  2N6Z A;  2FVE A;  2GDX A;  2KGE A;  2KR5 A;  2LIW A;  4DG9 A;  2XZ1 C;  2FVF A;  4MRT C;  3RG2 A;  2KOP A;  2MY5 A;  4R0M A;  4IZ6 A;  2AVA A;  2MVV A;  4HKG A;  2K0X A;  2KG8 A;  4CA3 A;  2FVA A;  2MF4 A;  2L22 A;  5KP7 B;  2N50 A;  4BPG A;  1AF8 A;  2LIU A;  2CNR A;  2MD9 A;  1T8K A;  2LKI A;  3CE7 A;  3EJB A;  2KG6 A;  1F80 D;  1L0I A;  2AFE A;  2LML A;  4PXH B;  2DNW A;  2AFD A;  2EHT A;  2MR7 A;  2FQ0 A;  2FQ2 A;  3GZL A;  1DV5 A;  2K0Y A;  1ACP A;  5HVC A;  2KWL A;  2K92 A;  2JQ4 A;  5HV8 A;  2N5H A;  2FQ1 A;  1L0H A;  2GDW A;  2M5R A;  5EJD A;  1HQB A;  1X3O A;  1OR5 A;  2KOS A;  1DNY A;  2KW2 A;  3GZM A;  2KOQ A;  2JGP A;  2QNW A;  2N98 A;  2K93 A;  2CGQ A;  4H2X C;  4NEO A;  2LPK A;  3NY7 B;  2FAE A;  3LMO A;  2N6Y A;  2N5I A;  2MVU A;  2FAD A;  2GDY A;  4H2Y C;  2FHS C;  2LL8 A;  2AF8 A;  3EJE A;  2EHS A;  2KGA A;  3EJD A;  2MR8 A;  2KGD A;  2FAC A;  2L4B A;  5KP8 B;  2ROQ A;  2JU2 A;  1HY8 A;  2JU1 A;  2L0Q A;  4PWV B;  2KOO A;  2KOR A;  2K94 A;  2X2B A;  2CG5 B;  4H2W C;  4BPH A;  2K2Q A;  1VKU A;  5CZD B;  4BPF A;  1NQ4 A;  2KG9 A;  2VSQ A;  2KGC A;  1KLP A;  2L9F A;  2XZ0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...