2FHSC

Structure of acyl carrier protein bound to fabi, the enoyl reductase from escherichia coli
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
76
structure length
57
Chain Sequence
STIEERVIIGVKQEEVTNNFVEDLGASLDTVELVMALEEEFDTTTVQAAIDYINGHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Acyl Carrier Protein Bound to FabI, the FASII Enoyl Reductase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/biosynthetic protein
molecule keywords enoyl-[acyl-carrier-protein] reductase, NADH-dependent
total genus 5
structure length 57
sequence length 76
ec nomenclature
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2fhsC00
2M5RA 2N6YA 2FVEA 2CGQA 1AF8A 1DNYA 2KOQA 2KGEA 3GZMA 1HQBA 2GDXA 2LPKA 1L0HA 2KR5A 4BPFA 2KG9A 2KOOA 2JU2A 2L4BA 4DG9A 4IZ6A 2KOPA 2VSQA 3EJEA 2ROQA 5HV8A 4H2YC 1NQ4A 2FQ2A 4PXHB 1L0IA 2N5HA 2DNWA 2KG6A 2LMLA 3LMOA 2CQ8A 1DV5A 2FHSC 2KGDA 2KOSA 2MVUA 1ACPA 2LTEA 2N5IA 5KP8B 3CE7A 2XZ0D 2N6ZA 2MR7A 2FAEA 4H2XC 4BPHA 2FACA 4CA3A 2FQ1A 4H2WC 3GZLA 2JGPA 2QNWA 2KG8A 1HY8A 2KGCA 2MVVA 3EJBA 1F80D 2AF8A 2MY5A 2AVAA 1OR5A 2K2QA 2FVAA 2AFDA 2MD9A 2LL8A 4BPGA 2N98A 2K93A 2KWLA 2K0YA 2MR8A 2L0QA 2FADA 2JU1A 2LKIA 2PNGA 2GDWA 1VKUA 2FVFA 3EJDA 1KLPA 2K0XA 2X2BA 3NY7B 2JQ4A 4MRTC 4PWVB 5EJDA 5KP6B 1X3OA 2EHTA 3RG2A 5CZDB 2L9FA 2LIUA 2K92A 2N50A 4NEOA 4R0MA 5HVCA 2LIWA 2CNRA 2GDYA 1T8KA 2L22A 2KGAA 2AFEA 2FQ0A 2KORA 2LOLA 5KP7B 2CG5B 2K94A 4HKGA 2XZ1C 2MF4A 2EHSA 2KW2A
chains in the Genus database with same CATH superfamily
4XROA 3CCLP 1Q82Q 3LRYA 2XXMA 3GJNA 1IMQA 1YI2P 1A8OA 1L0HA 4BPFA 3I55P 2KG9A 3CXCO 1GPJA 2KOPA 3B4QA 3EJEA 2QEXP 5HV8A 4H2YC 2KODA 1E6JP 1Q86Q 4PXHB 2KG6A 3LMOA 2BHVA 4XFXA 1DV5A 2MVUA 1ACPA 2GZEA 3VRLC 2N5IA 4U0FA 1M6EX 2XZ0D 2FAEA 1BXIA 3CCVP 3GZLA 4XRQA 2QNWA 1VQ5P 2M8PA 1HY8A 3CCEP 1KD1Q 4IPYA 2K5XA 3H47A 1VQ7P 3CC7P 4COPA 1ZNVA 2OTLP 4BPGA 3HZQA 2K93A 2XV6A 3RG6C 1YITP 2PY8A 5HGOA 2JBGA 3EJDA 1KLPA 3NY7B 2GYKA 2L6EA 5KP6B 3G6EP 2JYLA 1YJNP 4QNBA 1VQOP 1IUQA 4NEOA 4R0MA 1E0HA 2BUOA 4XFZA 3M1MA 1EMVA 1EIAA 2JB0A 1M1KQ 2OTJP 1VQKP 5F2NA 1GXGA 3G1GA 1VQ9P 2EHSA 2M5RA 2JAZA 1VQ6P 2GDXA 2PEQA 2LPKA 1M74A 3DS1A 3WBHA 2Z45A 2L4BA 3DS3A 4IZ6A 2VSQA 2ROQA 1YJ9P 1K8AQ 3MGEA 1L0IA 1K30A 2N5HA 2DNWA 2CQ8A 2KGDA 1GXHA 3G1IA 2LTEA 1KC8Q 4U0BA 2MR7A 3CCMP 2PEMA 4BPHA 4U0AA 4CA3A 2FQ1A 2PEIA 5JPAA 1VQLP 2K0DX 4COCA 1M90Q 2MY5A 2EG5A 2ERHA 1OR5A 2MD9A 2N98A 3CCSP 5HGNA 3CPWO 1JJ2O 2EFJA 2PEKA 1N8RQ 1IMPA 1AUMA 4U0EA 1VKUA 1Z6MA 4M0IA 4GR6A 3U43A 2K0XA 3DS4A 4PWVB 2L9FA 5F2OA 2K92A 2QA4P 3P05A 4WYMA 1QRJA 2KGAA 2DGYA 5F2KA 2CG5B 2K94A 5HGMA 3CMAP 2KW2A 2EIAA 2N6YA 2FVEA 3E2DA 1AF8A 2KOQA 4PH1A 4PH0A 1HQBA 3DS2A 3G0VA 3Q20A 4XFYA 3CCRP 2KR5A 1KQSO 1QVFO 1EOQA 2JU2A 2PEOA 5DCKA 3G21A 3HYBA 2Z46A 1RNIA 2JYGA 2FHSC 5KP8B 5I4TG 3G26A 4H2WC 2JGPA 3DS0A 2CWOA 1RO2A 4UHPB 2E1MA 2KGCA 3EJBA 2XT1A 2AF8A 2K2QA 2AFDA 5EW5E 1D1DA 1FR2A 1VHNA 2GZIA 2K0YA 4U0CA 2MR8A 5BS1A 3CCJP 2L0QA 3CC4P 3OW2O 3G28A 2JO0A 1MZ8A 1YHQP 1YIJP 3DPHA 3GKLC 2X2BA 2Z44A 4GR2A 5EJDA 1Q81Q 5HGLA 3CCQP 3I56P 1NJIQ 2N50A 1W2BO 3NTEA 3CD6P 1VQ4P 2PEJA 2M8LA 2LIWA 2CNRA 2PENA 2GDYA 1T8KA 2L22A 2AFEA 1UNKA 2KORA 2LOLA 4U0DA 2OARA 5BS2A 1RO0A 1CEIA 1K73Q 1QVGO 4F37A 2VLPA 2CGQA 1DNYA 2KGEA 3GZMA 3H0DA 3G4SP 3G29A 3CC2P 2P9XA 2KOOA 1ZMBA 4DG9A 2LF4A 7CEIA 1NQ4A 3CCUP 2FQ2A 2LMLA 2ONTA 2KOSA 1BAJA 3DTJA 3CE7A 3B5IA 1K9MQ 2N6ZA 4H2XC 2FACA 2KG8A 2GZFA 2MVVA 1F80D 1Q7YQ 1VQ8P 1YJWP 2AVAA 2FVAA 1VQPP 2LL8A 2KWLA 1S72P 2FADA 2GZGA 3G71P 2JU1A 2LKIA 2PNGA 1VQNP 2GDWA 2NO8A 2FVFA 2M8NA 2WPTA 4MRTC 2JQ4A 1A43A 1X3OA 2GZJA 1UJZA 2EHTA 3RG2A 3H4EA 5CZDB 4QKOA 2LIUA 1AYIA 2VLOA 3CMEP 5HVCA 3DS5A 1VQMP 2FQ0A 5KP7B 1M6NA 4HKGA 2VLNA 2XZ1C 2MF4A 2VLQA
chains in the Genus database with same CATH topology
2M5RA 2N6YA 2FVEA 2CGQA 1AF8A 1DNYA 2KOQA 2KGEA 3GZMA 1HQBA 2GDXA 2LPKA 1L0HA 2KR5A 4BPFA 2KG9A 2KOOA 2JU2A 2L4BA 4DG9A 4IZ6A 2KOPA 2VSQA 3EJEA 2ROQA 5HV8A 4H2YC 1NQ4A 2FQ2A 4PXHB 1L0IA 2N5HA 2DNWA 2KG6A 2LMLA 3LMOA 2CQ8A 1DV5A 2FHSC 2KGDA 2KOSA 2MVUA 1ACPA 2LTEA 2N5IA 5KP8B 3CE7A 2XZ0D 2N6ZA 2MR7A 2FAEA 4H2XC 4BPHA 2FACA 4CA3A 2FQ1A 4H2WC 3GZLA 2JGPA 2QNWA 2KG8A 1HY8A 2KGCA 2MVVA 3EJBA 1F80D 2AF8A 2MY5A 2AVAA 1OR5A 2K2QA 2FVAA 2AFDA 2MD9A 2LL8A 4BPGA 2N98A 2K93A 2KWLA 2K0YA 2MR8A 2L0QA 2FADA 2JU1A 2LKIA 2PNGA 2GDWA 1VKUA 2FVFA 3EJDA 1KLPA 2K0XA 2X2BA 3NY7B 2JQ4A 4MRTC 4PWVB 5EJDA 5KP6B 1X3OA 2EHTA 3RG2A 5CZDB 2L9FA 2LIUA 2K92A 2N50A 4NEOA 4R0MA 5HVCA 2LIWA 2CNRA 2GDYA 1T8KA 2L22A 2KGAA 2AFEA 2FQ0A 2KORA 2LOLA 5KP7B 2CG5B 2K94A 4HKGA 2XZ1C 2MF4A 2EHSA 2KW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5R A;  2N6Y A;  2FVE A;  2CGQ A;  1AF8 A;  1DNY A;  2KOQ A;  2KGE A;  3GZM A;  1HQB A;  2GDX A;  2LPK A;  1L0H A;  2KR5 A;  4BPF A;  2KG9 A;  2KOO A;  2JU2 A;  2L4B A;  4DG9 A;  4IZ6 A;  2KOP A;  2VSQ A;  3EJE A;  2ROQ A;  5HV8 A;  4H2Y C;  1NQ4 A;  2FQ2 A;  4PXH B;  1L0I A;  2N5H A;  2DNW A;  2KG6 A;  2LML A;  3LMO A;  2CQ8 A;  1DV5 A;  2FHS C;  2KGD A;  2KOS A;  2MVU A;  1ACP A;  2LTE A;  2N5I A;  5KP8 B;  3CE7 A;  2XZ0 D;  2N6Z A;  2MR7 A;  2FAE A;  4H2X C;  4BPH A;  2FAC A;  4CA3 A;  2FQ1 A;  4H2W C;  3GZL A;  2JGP A;  2QNW A;  2KG8 A;  1HY8 A;  2KGC A;  2MVV A;  3EJB A;  1F80 D;  2AF8 A;  2MY5 A;  2AVA A;  1OR5 A;  2K2Q A;  2FVA A;  2AFD A;  2MD9 A;  2LL8 A;  4BPG A;  2N98 A;  2K93 A;  2KWL A;  2K0Y A;  2MR8 A;  2L0Q A;  2FAD A;  2JU1 A;  2LKI A;  2PNG A;  2GDW A;  1VKU A;  2FVF A;  3EJD A;  1KLP A;  2K0X A;  2X2B A;  3NY7 B;  2JQ4 A;  4MRT C;  4PWV B;  5EJD A;  5KP6 B;  1X3O A;  2EHT A;  3RG2 A;  5CZD B;  2L9F A;  2LIU A;  2K92 A;  2N50 A;  4NEO A;  4R0M A;  5HVC A;  2LIW A;  2CNR A;  2GDY A;  1T8K A;  2L22 A;  2KGA A;  2AFE A;  2FQ0 A;  2KOR A;  2LOL A;  5KP7 B;  2CG5 B;  2K94 A;  4HKG A;  2XZ1 C;  2MF4 A;  2EHS A;  2KW2 A; 
#chains in the Genus database with same CATH topology
 4XRO A;  3CCL P;  1Q82 Q;  3LRY A;  2XXM A;  3GJN A;  1IMQ A;  1YI2 P;  1A8O A;  1L0H A;  4BPF A;  3I55 P;  2KG9 A;  3CXC O;  1GPJ A;  2KOP A;  3B4Q A;  3EJE A;  2QEX P;  5HV8 A;  4H2Y C;  2KOD A;  1E6J P;  1Q86 Q;  4PXH B;  2KG6 A;  3LMO A;  2BHV A;  4XFX A;  1DV5 A;  2MVU A;  1ACP A;  2GZE A;  3VRL C;  2N5I A;  4U0F A;  1M6E X;  2XZ0 D;  2FAE A;  1BXI A;  3CCV P;  3GZL A;  4XRQ A;  2QNW A;  1VQ5 P;  2M8P A;  1HY8 A;  3CCE P;  1KD1 Q;  4IPY A;  2K5X A;  3H47 A;  1VQ7 P;  3CC7 P;  4COP A;  1ZNV A;  2OTL P;  4BPG A;  3HZQ A;  2K93 A;  2XV6 A;  3RG6 C;  1YIT P;  2PY8 A;  5HGO A;  2JBG A;  3EJD A;  1KLP A;  3NY7 B;  2GYK A;  2L6E A;  5KP6 B;  3G6E P;  2JYL A;  1YJN P;  4QNB A;  1VQO P;  1IUQ A;  4NEO A;  4R0M A;  1E0H A;  2BUO A;  4XFZ A;  3M1M A;  1EMV A;  1EIA A;  2JB0 A;  1M1K Q;  2OTJ P;  1VQK P;  5F2N A;  1GXG A;  3G1G A;  1VQ9 P;  2EHS A;  2M5R A;  2JAZ A;  1VQ6 P;  2GDX A;  2PEQ A;  2LPK A;  1M74 A;  3DS1 A;  3WBH A;  2Z45 A;  2L4B A;  3DS3 A;  4IZ6 A;  2VSQ A;  2ROQ A;  1YJ9 P;  1K8A Q;  3MGE A;  1L0I A;  1K30 A;  2N5H A;  2DNW A;  2CQ8 A;  2KGD A;  1GXH A;  3G1I A;  2LTE A;  1KC8 Q;  4U0B A;  2MR7 A;  3CCM P;  2PEM A;  4BPH A;  4U0A A;  4CA3 A;  2FQ1 A;  2PEI A;  5JPA A;  1VQL P;  2K0D X;  4COC A;  1M90 Q;  2MY5 A;  2EG5 A;  2ERH A;  1OR5 A;  2MD9 A;  2N98 A;  3CCS P;  5HGN A;  3CPW O;  1JJ2 O;  2EFJ A;  2PEK A;  1N8R Q;  1IMP A;  1AUM A;  4U0E A;  1VKU A;  1Z6M A;  4M0I A;  4GR6 A;  3U43 A;  2K0X A;  3DS4 A;  4PWV B;  2L9F A;  5F2O A;  2K92 A;  2QA4 P;  3P05 A;  4WYM A;  1QRJ A;  2KGA A;  2DGY A;  5F2K A;  2CG5 B;  2K94 A;  5HGM A;  3CMA P;  2KW2 A;  2EIA A;  2N6Y A;  2FVE A;  3E2D A;  1AF8 A;  2KOQ A;  4PH1 A;  4PH0 A;  1HQB A;  3DS2 A;  3G0V A;  3Q20 A;  4XFY A;  3CCR P;  2KR5 A;  1KQS O;  1QVF O;  1EOQ A;  2JU2 A;  2PEO A;  5DCK A;  3G21 A;  3HYB A;  2Z46 A;  1RNI A;  2JYG A;  2FHS C;  5KP8 B;  5I4T G;  3G26 A;  4H2W C;  2JGP A;  3DS0 A;  2CWO A;  1RO2 A;  4UHP B;  2E1M A;  2KGC A;  3EJB A;  2XT1 A;  2AF8 A;  2K2Q A;  2AFD A;  5EW5 E;  1D1D A;  1FR2 A;  1VHN A;  2GZI A;  2K0Y A;  4U0C A;  2MR8 A;  5BS1 A;  3CCJ P;  2L0Q A;  3CC4 P;  3OW2 O;  3G28 A;  2JO0 A;  1MZ8 A;  1YHQ P;  1YIJ P;  3DPH A;  3GKL C;  2X2B A;  2Z44 A;  4GR2 A;  5EJD A;  1Q81 Q;  5HGL A;  3CCQ P;  3I56 P;  1NJI Q;  2N50 A;  1W2B O;  3NTE A;  3CD6 P;  1VQ4 P;  2PEJ A;  2M8L A;  2LIW A;  2CNR A;  2PEN A;  2GDY A;  1T8K A;  2L22 A;  2AFE A;  1UNK A;  2KOR A;  2LOL A;  4U0D A;  2OAR A;  5BS2 A;  1RO0 A;  1CEI A;  1K73 Q;  1QVG O;  4F37 A;  2VLP A;  2CGQ A;  1DNY A;  2KGE A;  3GZM A;  3H0D A;  3G4S P;  3G29 A;  3CC2 P;  2P9X A;  2KOO A;  1ZMB A;  4DG9 A;  2LF4 A;  7CEI A;  1NQ4 A;  3CCU P;  2FQ2 A;  2LML A;  2ONT A;  2KOS A;  1BAJ A;  3DTJ A;  3CE7 A;  3B5I A;  1K9M Q;  2N6Z A;  4H2X C;  2FAC A;  2KG8 A;  2GZF A;  2MVV A;  1F80 D;  1Q7Y Q;  1VQ8 P;  1YJW P;  2AVA A;  2FVA A;  1VQP P;  2LL8 A;  2KWL A;  1S72 P;  2FAD A;  2GZG A;  3G71 P;  2JU1 A;  2LKI A;  2PNG A;  1VQN P;  2GDW A;  2NO8 A;  2FVF A;  2M8N A;  2WPT A;  4MRT C;  2JQ4 A;  1A43 A;  1X3O A;  2GZJ A;  1UJZ A;  2EHT A;  3RG2 A;  3H4E A;  5CZD B;  4QKO A;  2LIU A;  1AYI A;  2VLO A;  3CME P;  5HVC A;  3DS5 A;  1VQM P;  2FQ0 A;  5KP7 B;  1M6N A;  4HKG A;  2VLN A;  2XZ1 C;  2MF4 A;  2VLQ A; 
#chains in the Genus database with same CATH homology
 2M5R A;  2N6Y A;  2FVE A;  2CGQ A;  1AF8 A;  1DNY A;  2KOQ A;  2KGE A;  3GZM A;  1HQB A;  2GDX A;  2LPK A;  1L0H A;  2KR5 A;  4BPF A;  2KG9 A;  2KOO A;  2JU2 A;  2L4B A;  4DG9 A;  4IZ6 A;  2KOP A;  2VSQ A;  3EJE A;  2ROQ A;  5HV8 A;  4H2Y C;  1NQ4 A;  2FQ2 A;  4PXH B;  1L0I A;  2N5H A;  2DNW A;  2KG6 A;  2LML A;  3LMO A;  2CQ8 A;  1DV5 A;  2FHS C;  2KGD A;  2KOS A;  2MVU A;  1ACP A;  2LTE A;  2N5I A;  5KP8 B;  3CE7 A;  2XZ0 D;  2N6Z A;  2MR7 A;  2FAE A;  4H2X C;  4BPH A;  2FAC A;  4CA3 A;  2FQ1 A;  4H2W C;  3GZL A;  2JGP A;  2QNW A;  2KG8 A;  1HY8 A;  2KGC A;  2MVV A;  3EJB A;  1F80 D;  2AF8 A;  2MY5 A;  2AVA A;  1OR5 A;  2K2Q A;  2FVA A;  2AFD A;  2MD9 A;  2LL8 A;  4BPG A;  2N98 A;  2K93 A;  2KWL A;  2K0Y A;  2MR8 A;  2L0Q A;  2FAD A;  2JU1 A;  2LKI A;  2PNG A;  2GDW A;  1VKU A;  2FVF A;  3EJD A;  1KLP A;  2K0X A;  2X2B A;  3NY7 B;  2JQ4 A;  4MRT C;  4PWV B;  5EJD A;  5KP6 B;  1X3O A;  2EHT A;  3RG2 A;  5CZD B;  2L9F A;  2LIU A;  2K92 A;  2N50 A;  4NEO A;  4R0M A;  5HVC A;  2LIW A;  2CNR A;  2GDY A;  1T8K A;  2L22 A;  2KGA A;  2AFE A;  2FQ0 A;  2KOR A;  2LOL A;  5KP7 B;  2CG5 B;  2K94 A;  4HKG A;  2XZ1 C;  2MF4 A;  2EHS A;  2KW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...