1Q86Q

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q86Q03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q86Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q86Q02
3CCJP 3I56P 1VQ5P 1YITP 1K8AQ 1VQKP 1Q7YQ 1K9MQ 1QVFO 3CMEP 1KQSO 3CC7P 1NJIQ 1M90Q 3G4SP 2OTLP 1VQ9P 1KC8Q 3CCEP 3CXCO 3CC4P 3G71P 3CCSP 1S72P 2QEXP 1VQPP 1VQ6P 1YJWP 3CPWO 1YI2P 3CD6P 1Q86Q 3OW2O 3G6EP 1YJ9P 1VQLP 1YHQP 1VQMP 3I55P 3CCQP 1N8RQ 1VQOP 1VQ8P 3CCLP 3CCRP 2QA4P 1YJNP 1VQ4P 3CMAP 3CCMP 1JJ2O 1Q82Q 2OTJP 1K73Q 1M1KQ 1KD1Q 3CC2P 1YIJP 3CCUP 1QVGO 1VQNP 1Q81Q 3CCVP 1W2BO 1VQ7P
chains in the Genus database with same CATH superfamily
1CEIA 1BDCA 1K9MQ 4OGQC 1HUCA 1S4XA 2QJPB 1E79H 5F2OA 2UWJE 1L0LD 2OGUA 3P32A 4KHXA 4H44D 3EJEA 2YIUC 1NTMG 5AVTB 1EQ7A 4JBZA 2PEIA 4D6TG 3D6YA 5HGNA 2VLNA 3SWKA 1S5LX 5AVYB 2HLOA 2XDJA 2B89A 4ASVA 2GDWA 2O01H 1NAFA 3RL0D 2IYOA 4XFJA 1X9VA 3Q3DA 2JYLA 1N73C 2JP3A 1IO4A 2A45H 1T3JA 3FWNA 3L72E 1HY8A 3LMOA 1DD3A 2FFDA 4DCKA 3CWBJ 4U3FG 1HWTC 2D2CD 1USDA 2WSSH 1PIXA 5GTIH 1MZ9A 1VQPP 2QVAA 5KLIB 2W8ZA 5KLVD 2N9YB 2A45I 2M8PA 3ABVC 3H1LG 2RMZA 2KOQA 3A3YB 3CCVP 4IL6X 5JPAA 1FZCA 1L0IA 2I1KA 3A0BE 4MRTC 2CGQA 3HD7B 4CPGA 2X2BA 3Q2YA 3PRJA 1QRJA 5EFWB 3PH0A 2ZYDA 3M06A 4PH1A 1LJ2A 4U0DA 4AYCA 4I2LC 2N5HA 5F2NA 2LR2A 1WT6A 3CL3D 4H2XC 4WVZA 3CCMP 1Q2NA 1ZN5A 1LWUB 2R32A 1NO4A 2K93A 3HYBA 1ZNVA 2KLVA 3L70E 2FKWB 1JY2P 2HYNA 1WRGA 4HB1A 1GZLA 1KLPA 2KNCA 3CCRP 1RH5B 1BSHA 3CC2P 1BDDA 2K94A 1BE3E 3KXDA 2YKPA 1DNYA 4Y99B 4R4LA 2KZIA 4QNBA 2ZFCA 1KORA 1BE3J 4YXDC 1SQQE 1SQVJ 1IFMA 1YTZI 3V4WA 2XV6A 1TU3F 2LPKA 3OA7A 2E76D 4EDFA 3RBXA 1SQQJ 1SQQK 2ZYGA 4H44C 3PP5A 2KR5A 1NTKJ 3EJDA 3TNUA 5L8RJ 5BU8B 1ZP0C 5AVSB 1RF1A 3CXHH 1J1EB 1KB9H 3CE7A 3WU2H 5EW5E 3U1AA 2P9XA 1JCDA 4BXLA 1Z6MA 1XTCC 1NU1D 3KDPB 1EDKA 2KG8A 3CCUP 3L74J 3I56P 1KQFB 3RL0C 2MY5A 1OZHA 4WB4A 3A2AA 1HJBA 5F2KA 3CXHI 3CWBG 2WSEJ 4HH2A 3PTZA 2W6BA 1NTMD 4H0LD 4U0FA 1YI2P 3NTEA 3I55P 1DD4A 2LKMA 1K05A 2ZAEB 2K3RA 1QLED 3DS4A 1QVFO 3CC7P 1MFTA 3LRYA 3RK2B 5AVXB 2QJYC 4A7PA 2FACA 1OXZA 2PEQA 4L74A 5CCGA 3GMAA 4K35A 3G1GA 1FZBA 2WQYC 5B5EE 2IFNA 4PXHB 4RO0A 5GTHH 1W2BO 1VQ7P 4W7ZA 4PJ0E 3M0AA 3W68A 2EG5A 2FYUD 3HE4B 3GZMA 5KAIH 4XFZA 3DS3A 5AVRB 2QM8A 5HVCA 1RO0A 1BGYE 1EDJA 4H2YC 3L75D 1RO2A 3TGUD 4GOFA 2E1MA 2PGDA 3M91A 1PPJD 2A06E 3L71D 1UJZA 1FU1A 2GZJA 1VL2A 2KYVA 2CWOA 3CLQA 1IFPA 1L0ND 1SQXJ 2WMMA 2H88C 2J59M 4TLFA 3LW5H 1YITP 3RG2A 3H1IE 5M1BA 4I1LA 1VQ9P 1JTHB 2I8DA 3AEDC 4BRYB 3L73J 3P8CE 2OYHB 2JWDA 3H47A 2HR3A 1BE3G 2HPCB 1GK6A 2N98A 1SQVG 3AE2C 1VQMP 4IFDK 5BU5A 4UB6E 1N7SA 1CW5A 1YQ3C 2FFDC 2KB7P 1BXIA 1SQQG 4N3YB 1EIAA 2BUOA 1NTKG 1KILB 3BATA 1KILE 4NPDA 1LP1B 4HJGH 2E76C 3HD7A 2IZ1A 1M1JB 1VQ8P 2AFDA 1IFIA 1FZCC 1YBKA 1VHNA 5CCGD 1T8KA 1ZXGA 1BCCD 3L74G 1AQTA 1M90Q 5CCHA 1IC2A 3CCEP 1URQB 3D70A 3G71P 2WSFH 1PEQA 2FYNB 5APTA 3VMYA 3BRTB 3RK3B 3RK3E 3VOPA 3G6EP 2OARA 3W67A 2XV5A 3Q20A 2P7JA 2AEJA 3IAOA 4H0LC 1E6JP 3BCCJ 1A43A 3B4QA 4RKUJ 1LGHB 4D6TE 2AXCA 3VP9A 4JYCA 3AE3C 2NZ2A 3Q5RA 3DPHA 4XRQA 3H32B 2QIWA 4OWFA 2R44A 4COCA 1E0HA 2LTEA 4R4MA 2WSCH 1LTAC 2ZT9B 2Q9IA 2L4BA 2J58A 4GDOA 2W27A 4M3LA 3H4EA 3MUDA 3KZIE 1NYHA 3Q5SA 5HV8A 3GKLC 2M8NA 3AECC 3G28A 4UB8H 3L72D 2R3CA 3FX0A 2BCCD 1S5LH 3NY7B 1K04A 3IFMA 1NTZJ 4U3FE 1JY3P 4JYBA 2MR7A 2PAJA 2C0XA 1PP9D 4NEOA 4ZKPA 4GR2A 3H1LE 1N7SD 2JJLA 4HKGA 2YKQA 3JC22 3P8MC 1PEUA 1FJPA 1QL1A 3GF7A 3LIDA 4H2WC 1RY3A 2XXMA 3HD7D 2I1JA 1VDFA 1JM0A 1RHZB 1SQXG 3GG2A 2E74B 1CZQA 3MGNA 1RF1C 4IL6H 3WUTA 5APWA 2Q7CA 1S72P 2Q1KA 3L73G 3C1LA 2JDIH 1DH3A 2KG9A 5CCHD 1T8ZA 2WPSA 4JQ0D 4COPA 3M9HA 2KODA 2N9BA 2PRRA 2RH0A 4IPYA 3FWLA 1LT9B 4PWVB 4QKOA 3HUSC 1YJNP 3H1JD 1SVFA 4L76A 1JY2N 3F89A 3H1KJ 3AEEC 1JUNA 2Q5UA 1FE6A 3L70D 5AVZB 2KWLA 3MZWB 4GOEA 3H1HJ 1EXIA 2O01J 2QEXP 5CCGC 2K92A 2IFMA 2WT7B 2Z5IA 4XA4A 1FZGA 1E5WA 3HTKB 1M6NA 1R5SA 3BCCG 2KXPB 2QJPC 4L73A 3VMAA 2E42A 2PEJA 1JJ2O 1L4AB 7CEIA 1VQ5P 2QRXA 3MD0A 2KS1B 2XZ0D 3MGEA 1YTZT 2ZXEB 5H2FH 4BRYA 3CWBE 2KORA 1NTZG 1PFIA 4W80A 2QA4P 2HPCA 2JGPA 2AFEA 1VQNP 2JEEA 1K30A 4GIFA 2N6ZA 5KP6B 1ZV8A 1VQKP 2YMKA 4I7ZB 2JKVA 1VPCA 4PD4H 4U0CA 3UIAA 2OTLP 1KN7A 2KSEA 2CNRA 1KILA 2HODA 1KQGB 2KGAA 4IOIH 2OTKE 3RK2D 1N7SC 3AE5C 1GXGA 1AV1A 1OR5A 4PD4I 4ASWA 3JSVC 5HGMA 1HTLC 1ACPA 2IYPA 1N2DC 1OX3A 1VF5B 3HD7C 2JBGA 3U1CA 3AE7C 2C0WA 5AVWB 1EDLA 2KSJA 3G0VA 1RQUA 3R4YA 4JPZB 2WPQA 1EXJA 5CCHC 1EZVG 1BGYD 2E75D 1DV5A 4GT1A 2OYIB 2YNYA 2H8PD 3VMZA 3Q1MA 2DW3A 3GHGA 5AW8B 5CZDB 3E1IA 3NFQA 2A06D 2GUVA 2V7QJ 3B71A 4I6MC 2M0BA 3C8VA 1FZEA 3DTJA 3H1KG 2CPBA 4CA3A 1LTBC 1JY2O 1CSBA 4ZKUA 3IF4A 4K3AA 4M0IA 1Q90D 1L0HA 1AVYA 4C7NB 2FVEA 3H1HG 1SQPD 2EHSA 3K5BA 3H1ID 3I5CA 1MKMA 4NPFX 2LKIA 1G2CB 1OVVA 1KFMA 2A45G 2FBWC 3P8CD 1SQVE 1GL2B 3MUDC 1NHLA 5K5GB 1IK9A 2WZ7A 4U0BA 2WITA 2MKVA 5HGLA 2XKMA 1SQVK 2LXCB 1NTKE 1YJ9P 2GM4A 1KILD 1EDIA 2FXMA 1W5CE 1SQBD 2B88A 2K5XA 3CCJP 1JB0J 3CMEP 4N78E 1QGKB 1MFZA 1NTKK 2E43A 5B66E 1P84E 4HKZH 3D71A 3L74E 3L35A 2B9BA 3IN6A 2WPVB 3AE6C 3NMDA 5AW0B 3S4RA 3SSUA 3HRNA 1PEOA 2QE7H 2Z45A 1QVGO 1URQD 1H0TB 1CI6A 1U7MA 2M5AB 2QG4A 1FZAA 2MR8A 4XFYA 3RK3D 3O6QB 4GODA 2VLOA 1L0LJ 1NVOA 2C9NY 2KZJA 3NXSA 1RQVA 1HJ0A 2E5TA 3OW2O 1YQ4C 3JCUE 4D6TD 2IZ0A 2KLUA 3HUSA 2D2CC 2EFJA 1Q81Q 5APQA 1JOCA 2ZJSE 2R5DA 1SS1A 5CJ4A 2B87B 3RK2C 4PV1B 1EMVA 2YO2A 4B86A 5AVVB 4AQRD 5I4TG 4R0MA 1LT1A 1T2KD 1ZOYC 4ZMDA 3DS0A 2J5UA 1JY3N 5KKZC 4BWNA 2GZIA 3LW5J 1FAVA 1PZQA 4H13B 4U3FD 1KQSO 5AW2B 5C39A 1VKUA 3N4XA 3CCSP 3V2PA 4EOTA 5KLVJ 5KLVK 1D7MA 1YHQP 1S2EA 2YO3A 3H1LD 3KPEA 2E75C 1OW8A 1L4AC 2IBZG 1ZRTE 1QL2A 1Q7YQ 1PGJA 1FR2A 3N7NA 1BSNA 1OIPA 1OFCX 1SQXE 5TISE 4EYYQ 3CPWO 2Q3EA 3T97B 3WBHA 4GR6A 1P84I 1QX8A 2E74D 3CI9A 3L73E 3CX5E 1KTMA 5KP8B 1SQXK 5E79E 3TK1A 2L5GB 3VN0A 2G8YA 2GZFA 2SPZA 1GU4A 2WSFJ 4RJTA 2Y0DA 3B8EB 2OYHC 2YMYA 2VRSA 1OMIA 5KTBA 1W2EA 2LXBA 1GW4A 3SFEC 5EJDA 1AA0A 2EHTA 2L6EA 4PD4D 5B5EH 3AE1C 1WMKA 1KILC 1IZNB 1VQ6P 2FHSC 4L75A 4PJ0H 2M5RA 4BPGA 1Y9BA 2QJKC 2WSCJ 1OWAA 1SFCB 2K9JB 2POHA 3RGUA 2P58A 1LTIC 2E76B 4OVNF 2FXOA 1X22A 2FVFA 1JMMA 1URQC 2N1TB 3D6ZA 3DS5A 1L0LG 4U7JA 2OYIA 3BCCE 3F5HA 2WPTA 3VMXA 1FJKA 4F37A 2AEMA 1UNKA 3RK3C 5AW3B 1VQ4P 1LNQA 1KD1Q 5CJ0A 2FQ2A 3TYYA 1FDOA 2GZGA 1RNIA 1NH4A 4YPCA 5CHXA 2BQ1E 1LWUA 3EFFK 1EC5A 3GHGC 3B5NB 5AW6B 3EFGA 1JNMA 2ZVOB 2PEMA 4C7NA 1PL5A 1NU1J 1HF9A 3GZLA 5KP7B 1NTZE 3B4SA 3WUVA 1G2CA 1J1DC 3CWBD 1IFJA 1JY3O 2K9YA 1GL2A 1F80D 2RN0A 1USEA 3AE8C 1T2KC 2ZXXA 3CX5I 2Y0EA 4UB6H 1GU5A 2P2UA 2O1JA 3OJAB 3A0HE 3VP8A 1NTZK 2AXTE 5KLVG 5KAFH 1LTGC 3ZDMA 3E1RA 2LF4A 4Z1MH 5BVZA 1J2JB 2FXPA 1KYOE 5HGOA 1T6AA 4YTPC 2YKOA 2O3JA 4KT0J 3RG6C 2NPSB 2JU2A 3KHUA 5BS2A 4U0AA 1HBWA 1NAYA 1GW3A 1VF5D 3LIEA 1GPJA 1H0TA 1AUMA 2FYUJ 2M5AA 1FBMA 2ZYAA 1U57A 1IFDA 1EZVE 3AE9C 3M9QA 3L71E 3ITKA 1KV4A 2P1JA 5APVA 3L75J 3SWYA 3Q5PA 3TGUJ 1RF1B 2JB0A 1AQ5A 2FAEA 2QNWA 1QEXA 3L71J 3U59A 1S9KE 3DS2A 3H1KE 1LTJB 2B87A 3SWFA 2Q6QA 1M8OB 2WWWA 4LGDE 3KZIH 1FDIA 2MVUA 3H1HE 1L0NJ 1GD2E 1KFNA 3GW6A 1NQ4A 1FOSE 4XFXA 2JO1A 2JQ4A 2RKLA 2FADA 3PLNA 2YXRB 2Z4EA 4UHPB 1BE3D 3HE4A 3HZQA 1SQVD 1GL2D 2WTYA 2V4HA 1UIIA 2WVRA 3A5TA 1YIJP 3BASA 5GTIE 4WY4B 2ZVNB 3MTUE 4C46A 5APXA 2BHVA 2Z44A 1MV8A 1SQQD 2M3EA 1NTKD 4ZNCA 2JO0A 1S1CX 3CXCO 2AVAA 2XNXA 1GMJA 2R5BA 3BRVB 1X79B 3G3ZA 2QM7A 4N6JA 1SLQA 4N78D 3KYQA 1X3OA 3CMAP 1P84D 3T97A 2E5YA 1HVVA 3L74D 4XROA 1BCCJ 2IDBA 4OGQB 1DIPA 1M6EX 3HE5B 1OVRA 1NWQA 2KOSA 3GLMA 2BEZF 1JTHA 2YIUB 1M57D 1YYCA 3FXEA 2OYHA 3L37A 1PEMA 3H6PA 1AVOA 2YXQB 1IJDB 1HQBA 2L91A 1A02J 5AVQB 1EZVI 4I7ZC 1ZMBA 4EIJA 1HGVA 3V2RA 1G1IA 3O8ZA 1X0TA 1S3JA 1N73B 1LP1A 1UIXA 1FZFA 5KLIC 3GF3A 2Z46A 4PV1D 2BCCE 1M1JA 2W83C 3V6IA 1NJIQ 4LLHA 1SFCA 3WUUA 2K9JA 2ITAA 2FYUG 1EOQA 3L72J 1PP9E 2BCCJ 2H89C 1VF5C 2FQ1A 1URQA 1Q86Q 1RE4A 2N1TA 1N7SB 4H13D 5CMZA 2K0XA 1VQLP 1GTWA 3G21A 1PP9J 1GXHA 3L75G 3TGUG 2WPRA 5AW7B 2IBZE 3G29A 1JO5A 2KOGA 1PPJG 3L71G 2OYIC 2JAZA 1ZRTD 3B5NA 2BEQD 1U7JA 3H32A 3CXHE 1KB9E 2MF4A 5KJ7A 4NPEA 1SQXD 3PJSK 3WU2E 1L0NG 1LWUC 5APSA 1NGMB 4IFMA 3L73D 3CX5D 4DOJA 4DG9A 4KJMA 3VTPC 1M74A 4RESB 2Y9YA 1DEEG 1Y47A 2GYKA 1T3UA 1H89A 1GL2C 3B5IA 3H1JE 4Y99C 1JCCA 5CBOA 2PNGA 2O1KA 1IUQA 3M1MA 2NPSA 2G3AA 2W90A 3H1JJ 3A0BH 2M8RA 3PHLA 2JR8A 2KP8A 2KIKA 2M8LA 1FC2C 3L70J 2CG5B 1KMIZ 2L0QA 2PEKA 2K1AA 1BCCG 2K88A 3S9OA 2OQQA 5GTHE 1R8EA 2NRGA 3C9IA 1J1EC 1NKZB 1SFCD 2H7HA 5KAIE 2V7QH 3P7KA 1L0LE 2LIWA 1N7LA 2N1TD 4H44B 1MZ8A 3BCCD 2P67A 3DS1A 5DCKA 3MIWA 1H8AA 1RF0A 1Y8AA 1L0LK 2JU1A 1OW6A 2IBZI 1LTJA 1AF8A 2MD9A 1LT9A 3V2QA 2OTJP 3B5ND 2ERHA 3RL0B 1Z56A 2KUBA 2KGEA 3QH9A 5KJ7D 1IMPA 1KB9I 1NOHA 2VSQA 4PV1C 4PH0A 1A8OA 2ZT9D 3L72G 1NTZD 4OH8B 1H88A 2BCCG 1LTTC 2FY8A 3AEAC 2DNWA 2LL8A 2EIAA 2XZRA 2D2CB 1XTGB 2XZ1C 3P05A 4BPFA 2WT7A 3NTNA 3M0DA 4WY4A 5KLVE 3EQ2A 1PP9G 4H13C 3U43A 4AUWA 1GK4A 3TF5A 2QJYB 3HTKA 3TDKA 2N5IA 4Y28J 1KYOD 3G1IA 5CBNA 5KKZB 2KGDA 5B66H 1P84H 2Q3IA 4TT3H 2NPSD 1L4AA 3TSIA 3MHVA 3USSA 3A7OA 3BVHA 2KS1A 3HE5A 2WSEH 2MVVA 2E75B 1RE3C 2VLQA 2GDYA 4DJGA 1M1KQ 5DJTB 1DX7A 1EZVD 4BPHA 3G26A 2MJZA 1ZR4A 1BGYJ 3JCUH 2KI7B 1KC8Q 2GDXA 3CC4P 1FS0E 2Y0CA 2P10A 2KOPA 1FOSF 4YXWH 4IZ6A 1OVUA 1FDMA 1N73A 3H1JG 1S9KD 3H1KD 2XNDH 1SQPE 5BS1A 2KOOA 3L70G 1PGPA 3H1HD 2KGCA 1PV3A 1IK7A 1JEKA 1SQPJ 1SQPK 3EJBA 3H1IJ 1N8RQ 1ZR2A 3V5BA 1M1JC 4UB8E 2FFDB 2XU6A 1S5LE 3CCLP 1IMQA 2N50A 3E7KA 1SP4A 3RBZA 1SFCC 3AEGC 3V4QA 3E2DA 5KAFE 3G4SP 3G9RA 2CQ8A 1AFOA 1SQBE 2HODB 5DJUB 1ZLLA 4WY4D 1RE4C 2N1TC 3RL0g 4QMAA 2K0YA 2FYNC 2QJKB 4IFFA 1A02F 1ZW0A 1FZCB 1Q82Q 2R3SA 4MN4C 3GJNA 3AEBC 2DGYA 1SQBJ 1SQBK 3QWOC 1M56D 5AW5B 1K8AQ 4HYTB 5TISH 3R2PA 4DT0A 3V2NA 2AF8A 2M3BA 1NU1E 1OW7A 3AE4C 1L4AD 3CX5H 2AEFA 3B5NC 5E79H 1AYIA 3CD6P 1HH0A 2FVAA 3H25A 4OGQD 2FQ0A 3FXDA 2XT1A 3S1KA 1VQOP 2GZEA 4IL6E 2VLPA 5KJ7C 1NU1K 1NTME 4H0LB 3SFDC 2K37A 2CPSA 2K0DX 1KQLA 2BASA 2ZT9C 2GA1A 4JF7A 1ZMEC 1LTSC 3GHGB 2FYZA 2OYOA 1NTMJ 1NTMK 2KW2A 4XE5B 4D6TJ 3KQGA 2KG6A 1PGQA 1L2PA 1HGZA 1J1DB 2JYGA 1KZUB 2CK3H 1JMBA 2JWAA 4EI2A 2HG5D 3WMM0 2KNCB 2NPSC 2IX7C 2Y9ZA 1M7LA 2FYUE 5AW9B 3CCQP 3VYIA 3OAKA 1D1DA 2LIUA 1R5LA 4U3FJ 1DEBA 3EWKA 2FYUK 4GKGA 1BGYG 2E74C 2HFED 3L75E 5AW4B 2ONTA 3O6QA 3TGUE 2N6YA 1PPJE 3H1LJ 2GUSA 4W7YA 2KK7A 2W6AA 2IBZD 2O01N 2A06G 3L36A 1NKNA 3TNUB 2H43A 1RF0C 1L0NE 3CXHD 1KB9D 1YJWP 1LTJC 1LT9C 1CI6B 1N86A 3FGAD 1SQPG 3L4FA 3H1IG 1L0NK 5H2FE 3A0HH 2PP6A 1PGOA 2AXTH 2QSIA 1GDTA 1BAJA 2C9LY 5TJHA 4LC1A 2K2QA 2L22A 4C7RA 2L9FA 4WWIA 1G1JA 4O9BA 2PFXA 1KYOH 3HUSB 3M9BA 4PD4E 4DZOA 3II6A 4WBAA 3VRLC 2Z5HA 3M0DC 4WYMA 2W6JH 4WY4C 5APUA 1SQBG 5APYA 3AEFC 2PY8A 3H0DA 2IPPA 2LMLA 4U0EA 2LOLA 2ROQA 1BCCE 1KYOI 2NO8A 3MP7B 1IFNA 5AVUB 1MUUA 2PEOA 1RE3A 5AW1B 1AJYA 1K73Q 3IR9A 2PENA 1X8YA 1NU1G
chains in the Genus database with same CATH topology
3CCJP 3I56P 1YITP 1Q7YQ 1K9MQ 4PH1A 3CMEP 3H4EA 5HGMA 3B5IA 1RNIA 3E2DA 3G4SP 1ZMBA 1VQ9P 5F2KA 2BQ1E 2M8NA 5F2OA 3G28A 4U0DA 3DS2A 2ONTA 2QEXP 4U0FA 3H47A 5F2NA 3CPWO 1YI2P 2PEMA 1IUQA 3NTEA 3M1MA 3WBHA 4GR6A 3I55P 1VQMP 3G1IA 3CCMP 1PEOA 3G0VA 2Z46A 1Q82Q 2PEIA 2Z45A 2DGYA 1QVGO 2M8LA 5HGNA 1K8AQ 1M6NA 3DS4A 1QVFO 3CC7P 4GR2A 3LRYA 4XFYA 1NJIQ 2PEKA 4XFXA 3HYBA 1EIAA 2BUOA 1EOQA 2PEQA 3HZQA 1YJWP 3CD6P 1PEUA 1Q86Q 3OW2O 1VQLP 2JYLA 2XT1A 1VQOP 1VQ8P 3G21A 3G1GA 3CCRP 2PEJA 1JJ2O 2XXMA 3CC2P 1M1KQ 1YIJP 2EFJA 1Q81Q 2LF4A 1W2BO 3DTJA 1VQ7P 2BHVA 1VQ5P 2Z44A 5HGOA 3MGEA 3G26A 2EG5A 3DS1A 4QNBA 1M90Q 3G29A 1BAJA 2L6EA 3RG6C 2JO0A 5DCKA 1KC8Q 3CCEP 3CXCO 4XFZA 3DS3A 3CC4P 3G71P 4M0IA 1S72P 1VQPP 1PEQA 1VQ6P 5I4TG 1RO0A 5BS2A 3G6EP 2XV6A 2OARA 4U0AA 3VRLC 2QA4P 2M8PA 3CMAP 3DS0A 2OTJP 3Q20A 4COPA 1VQNP 1K30A 3CCVP 5JPAA 4WYMA 1RO2A 1VQKP 4XROA 1E6JP 5BS1A 1M6EX 1KQSO 1A43A 1AUMA 2E1MA 2PY8A 4U0CA 2KODA 2OTLP 2JYGA 4U0BA 3H0DA 3CCSP 4IPYA 1A8OA 4U0EA 5HGLA 3DPHA 4PH0A 4XRQA 3DS5A 2P9XA 4COCA 1YJ9P 2EIAA 1YHQP 1N8RQ 1QRJA 3CCQP 1PEMA 2CWOA 1YJNP 1VQ4P 1D1DA 2PEOA 1M74A 1K73Q 1KD1Q 3CCUP 2PENA 3P05A 3CCLP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ P;  3I56 P;  1VQ5 P;  1YIT P;  1K8A Q;  1VQK P;  1Q7Y Q;  1K9M Q;  1QVF O;  3CME P;  1KQS O;  3CC7 P;  1NJI Q;  1M90 Q;  3G4S P;  2OTL P;  1VQ9 P;  1KC8 Q;  3CCE P;  3CXC O;  3CC4 P;  3G71 P;  3CCS P;  1S72 P;  2QEX P;  1VQP P;  1VQ6 P;  1YJW P;  3CPW O;  1YI2 P;  3CD6 P;  1Q86 Q;  3OW2 O;  3G6E P;  1YJ9 P;  1VQL P;  1YHQ P;  1VQM P;  3I55 P;  3CCQ P;  1N8R Q;  1VQO P;  1VQ8 P;  3CCL P;  3CCR P;  2QA4 P;  1YJN P;  1VQ4 P;  3CMA P;  3CCM P;  1JJ2 O;  1Q82 Q;  2OTJ P;  1K73 Q;  1M1K Q;  1KD1 Q;  3CC2 P;  1YIJ P;  3CCU P;  1QVG O;  1VQN P;  1Q81 Q;  3CCV P;  1W2B O;  1VQ7 P; 
#chains in the Genus database with same CATH topology
 1CEI A;  1BDC A;  1K9M Q;  4OGQ C;  1HUC A;  1S4X A;  2QJP B;  1E79 H;  5F2O A;  2UWJ E;  1L0L D;  2OGU A;  3P32 A;  4KHX A;  4H44 D;  3EJE A;  2YIU C;  1NTM G;  5AVT B;  1EQ7 A;  4JBZ A;  2PEI A;  4D6T G;  3D6Y A;  5HGN A;  2VLN A;  3SWK A;  1S5L X;  5AVY B;  2HLO A;  2XDJ A;  2B89 A;  4ASV A;  2GDW A;  2O01 H;  1NAF A;  3RL0 D;  2IYO A;  4XFJ A;  1X9V A;  3Q3D A;  2JYL A;  1N73 C;  2JP3 A;  1IO4 A;  2A45 H;  1T3J A;  3FWN A;  3L72 E;  1HY8 A;  3LMO A;  1DD3 A;  2FFD A;  4DCK A;  3CWB J;  4U3F G;  1HWT C;  2D2C D;  1USD A;  2WSS H;  1PIX A;  5GTI H;  1MZ9 A;  1VQP P;  2QVA A;  5KLI B;  2W8Z A;  5KLV D;  2N9Y B;  2A45 I;  2M8P A;  3ABV C;  3H1L G;  2RMZ A;  2KOQ A;  3A3Y B;  3CCV P;  4IL6 X;  5JPA A;  1FZC A;  1L0I A;  2I1K A;  3A0B E;  4MRT C;  2CGQ A;  3HD7 B;  4CPG A;  2X2B A;  3Q2Y A;  3PRJ A;  1QRJ A;  5EFW B;  3PH0 A;  2ZYD A;  3M06 A;  4PH1 A;  1LJ2 A;  4U0D A;  4AYC A;  4I2L C;  2N5H A;  5F2N A;  2LR2 A;  1WT6 A;  3CL3 D;  4H2X C;  4WVZ A;  3CCM P;  1Q2N A;  1ZN5 A;  1LWU B;  2R32 A;  1NO4 A;  2K93 A;  3HYB A;  1ZNV A;  2KLV A;  3L70 E;  2FKW B;  1JY2 P;  2HYN A;  1WRG A;  4HB1 A;  1GZL A;  1KLP A;  2KNC A;  3CCR P;  1RH5 B;  1BSH A;  3CC2 P;  1BDD A;  2K94 A;  1BE3 E;  3KXD A;  2YKP A;  1DNY A;  4Y99 B;  4R4L A;  2KZI A;  4QNB A;  2ZFC A;  1KOR A;  1BE3 J;  4YXD C;  1SQQ E;  1SQV J;  1IFM A;  1YTZ I;  3V4W A;  2XV6 A;  1TU3 F;  2LPK A;  3OA7 A;  2E76 D;  4EDF A;  3RBX A;  1SQQ J;  1SQQ K;  2ZYG A;  4H44 C;  3PP5 A;  2KR5 A;  1NTK J;  3EJD A;  3TNU A;  5L8R J;  5BU8 B;  1ZP0 C;  5AVS B;  1RF1 A;  3CXH H;  1J1E B;  1KB9 H;  3CE7 A;  3WU2 H;  5EW5 E;  3U1A A;  2P9X A;  1JCD A;  4BXL A;  1Z6M A;  1XTC C;  1NU1 D;  3KDP B;  1EDK A;  2KG8 A;  3CCU P;  3L74 J;  3I56 P;  1KQF B;  3RL0 C;  2MY5 A;  1OZH A;  4WB4 A;  3A2A A;  1HJB A;  5F2K A;  3CXH I;  3CWB G;  2WSE J;  4HH2 A;  3PTZ A;  2W6B A;  1NTM D;  4H0L D;  4U0F A;  1YI2 P;  3NTE A;  3I55 P;  1DD4 A;  2LKM A;  1K05 A;  2ZAE B;  2K3R A;  1QLE D;  3DS4 A;  1QVF O;  3CC7 P;  1MFT A;  3LRY A;  3RK2 B;  5AVX B;  2QJY C;  4A7P A;  2FAC A;  1OXZ A;  2PEQ A;  4L74 A;  5CCG A;  3GMA A;  4K35 A;  3G1G A;  1FZB A;  2WQY C;  5B5E E;  2IFN A;  4PXH B;  4RO0 A;  5GTH H;  1W2B O;  1VQ7 P;  4W7Z A;  4PJ0 E;  3M0A A;  3W68 A;  2EG5 A;  2FYU D;  3HE4 B;  3GZM A;  5KAI H;  4XFZ A;  3DS3 A;  5AVR B;  2QM8 A;  5HVC A;  1RO0 A;  1BGY E;  1EDJ A;  4H2Y C;  3L75 D;  1RO2 A;  3TGU D;  4GOF A;  2E1M A;  2PGD A;  3M91 A;  1PPJ D;  2A06 E;  3L71 D;  1UJZ A;  1FU1 A;  2GZJ A;  1VL2 A;  2KYV A;  2CWO A;  3CLQ A;  1IFP A;  1L0N D;  1SQX J;  2WMM A;  2H88 C;  2J59 M;  4TLF A;  3LW5 H;  1YIT P;  3RG2 A;  3H1I E;  5M1B A;  4I1L A;  1VQ9 P;  1JTH B;  2I8D A;  3AED C;  4BRY B;  3L73 J;  3P8C E;  2OYH B;  2JWD A;  3H47 A;  2HR3 A;  1BE3 G;  2HPC B;  1GK6 A;  2N98 A;  1SQV G;  3AE2 C;  1VQM P;  4IFD K;  5BU5 A;  4UB6 E;  1N7S A;  1CW5 A;  1YQ3 C;  2FFD C;  2KB7 P;  1BXI A;  1SQQ G;  4N3Y B;  1EIA A;  2BUO A;  1NTK G;  1KIL B;  3BAT A;  1KIL E;  4NPD A;  1LP1 B;  4HJG H;  2E76 C;  3HD7 A;  2IZ1 A;  1M1J B;  1VQ8 P;  2AFD A;  1IFI A;  1FZC C;  1YBK A;  1VHN A;  5CCG D;  1T8K A;  1ZXG A;  1BCC D;  3L74 G;  1AQT A;  1M90 Q;  5CCH A;  1IC2 A;  3CCE P;  1URQ B;  3D70 A;  3G71 P;  2WSF H;  1PEQ A;  2FYN B;  5APT A;  3VMY A;  3BRT B;  3RK3 B;  3RK3 E;  3VOP A;  3G6E P;  2OAR A;  3W67 A;  2XV5 A;  3Q20 A;  2P7J A;  2AEJ A;  3IAO A;  4H0L C;  1E6J P;  3BCC J;  1A43 A;  3B4Q A;  4RKU J;  1LGH B;  4D6T E;  2AXC A;  3VP9 A;  4JYC A;  3AE3 C;  2NZ2 A;  3Q5R A;  3DPH A;  4XRQ A;  3H32 B;  2QIW A;  4OWF A;  2R44 A;  4COC A;  1E0H A;  2LTE A;  4R4M A;  2WSC H;  1LTA C;  2ZT9 B;  2Q9I A;  2L4B A;  2J58 A;  4GDO A;  2W27 A;  4M3L A;  3H4E A;  3MUD A;  3KZI E;  1NYH A;  3Q5S A;  5HV8 A;  3GKL C;  2M8N A;  3AEC C;  3G28 A;  4UB8 H;  3L72 D;  2R3C A;  3FX0 A;  2BCC D;  1S5L H;  3NY7 B;  1K04 A;  3IFM A;  1NTZ J;  4U3F E;  1JY3 P;  4JYB A;  2MR7 A;  2PAJ A;  2C0X A;  1PP9 D;  4NEO A;  4ZKP A;  4GR2 A;  3H1L E;  1N7S D;  2JJL A;  4HKG A;  2YKQ A;  3JC2 2;  3P8M C;  1PEU A;  1FJP A;  1QL1 A;  3GF7 A;  3LID A;  4H2W C;  1RY3 A;  2XXM A;  3HD7 D;  2I1J A;  1VDF A;  1JM0 A;  1RHZ B;  1SQX G;  3GG2 A;  2E74 B;  1CZQ A;  3MGN A;  1RF1 C;  4IL6 H;  3WUT A;  5APW A;  2Q7C A;  1S72 P;  2Q1K A;  3L73 G;  3C1L A;  2JDI H;  1DH3 A;  2KG9 A;  5CCH D;  1T8Z A;  2WPS A;  4JQ0 D;  4COP A;  3M9H A;  2KOD A;  2N9B A;  2PRR A;  2RH0 A;  4IPY A;  3FWL A;  1LT9 B;  4PWV B;  4QKO A;  3HUS C;  1YJN P;  3H1J D;  1SVF A;  4L76 A;  1JY2 N;  3F89 A;  3H1K J;  3AEE C;  1JUN A;  2Q5U A;  1FE6 A;  3L70 D;  5AVZ B;  2KWL A;  3MZW B;  4GOE A;  3H1H J;  1EXI A;  2O01 J;  2QEX P;  5CCG C;  2K92 A;  2IFM A;  2WT7 B;  2Z5I A;  4XA4 A;  1FZG A;  1E5W A;  3HTK B;  1M6N A;  1R5S A;  3BCC G;  2KXP B;  2QJP C;  4L73 A;  3VMA A;  2E42 A;  2PEJ A;  1JJ2 O;  1L4A B;  7CEI A;  1VQ5 P;  2QRX A;  3MD0 A;  2KS1 B;  2XZ0 D;  3MGE A;  1YTZ T;  2ZXE B;  5H2F H;  4BRY A;  3CWB E;  2KOR A;  1NTZ G;  1PFI A;  4W80 A;  2QA4 P;  2HPC A;  2JGP A;  2AFE A;  1VQN P;  2JEE A;  1K30 A;  4GIF A;  2N6Z A;  5KP6 B;  1ZV8 A;  1VQK P;  2YMK A;  4I7Z B;  2JKV A;  1VPC A;  4PD4 H;  4U0C A;  3UIA A;  2OTL P;  1KN7 A;  2KSE A;  2CNR A;  1KIL A;  2HOD A;  1KQG B;  2KGA A;  4IOI H;  2OTK E;  3RK2 D;  1N7S C;  3AE5 C;  1GXG A;  1AV1 A;  1OR5 A;  4PD4 I;  4ASW A;  3JSV C;  5HGM A;  1HTL C;  1ACP A;  2IYP A;  1N2D C;  1OX3 A;  1VF5 B;  3HD7 C;  2JBG A;  3U1C A;  3AE7 C;  2C0W A;  5AVW B;  1EDL A;  2KSJ A;  3G0V A;  1RQU A;  3R4Y A;  4JPZ B;  2WPQ A;  1EXJ A;  5CCH C;  1EZV G;  1BGY D;  2E75 D;  1DV5 A;  4GT1 A;  2OYI B;  2YNY A;  2H8P D;  3VMZ A;  3Q1M A;  2DW3 A;  3GHG A;  5AW8 B;  5CZD B;  3E1I A;  3NFQ A;  2A06 D;  2GUV A;  2V7Q J;  3B71 A;  4I6M C;  2M0B A;  3C8V A;  1FZE A;  3DTJ A;  3H1K G;  2CPB A;  4CA3 A;  1LTB C;  1JY2 O;  1CSB A;  4ZKU A;  3IF4 A;  4K3A A;  4M0I A;  1Q90 D;  1L0H A;  1AVY A;  4C7N B;  2FVE A;  3H1H G;  1SQP D;  2EHS A;  3K5B A;  3H1I D;  3I5C A;  1MKM A;  4NPF X;  2LKI A;  1G2C B;  1OVV A;  1KFM A;  2A45 G;  2FBW C;  3P8C D;  1SQV E;  1GL2 B;  3MUD C;  1NHL A;  5K5G B;  1IK9 A;  2WZ7 A;  4U0B A;  2WIT A;  2MKV A;  5HGL A;  2XKM A;  1SQV K;  2LXC B;  1NTK E;  1YJ9 P;  2GM4 A;  1KIL D;  1EDI A;  2FXM A;  1W5C E;  1SQB D;  2B88 A;  2K5X A;  3CCJ P;  1JB0 J;  3CME P;  4N78 E;  1QGK B;  1MFZ A;  1NTK K;  2E43 A;  5B66 E;  1P84 E;  4HKZ H;  3D71 A;  3L74 E;  3L35 A;  2B9B A;  3IN6 A;  2WPV B;  3AE6 C;  3NMD A;  5AW0 B;  3S4R A;  3SSU A;  3HRN A;  1PEO A;  2QE7 H;  2Z45 A;  1QVG O;  1URQ D;  1H0T B;  1CI6 A;  1U7M A;  2M5A B;  2QG4 A;  1FZA A;  2MR8 A;  4XFY A;  3RK3 D;  3O6Q B;  4GOD A;  2VLO A;  1L0L J;  1NVO A;  2C9N Y;  2KZJ A;  3NXS A;  1RQV A;  1HJ0 A;  2E5T A;  3OW2 O;  1YQ4 C;  3JCU E;  4D6T D;  2IZ0 A;  2KLU A;  3HUS A;  2D2C C;  2EFJ A;  1Q81 Q;  5APQ A;  1JOC A;  2ZJS E;  2R5D A;  1SS1 A;  5CJ4 A;  2B87 B;  3RK2 C;  4PV1 B;  1EMV A;  2YO2 A;  4B86 A;  5AVV B;  4AQR D;  5I4T G;  4R0M A;  1LT1 A;  1T2K D;  1ZOY C;  4ZMD A;  3DS0 A;  2J5U A;  1JY3 N;  5KKZ C;  4BWN A;  2GZI A;  3LW5 J;  1FAV A;  1PZQ A;  4H13 B;  4U3F D;  1KQS O;  5AW2 B;  5C39 A;  1VKU A;  3N4X A;  3CCS P;  3V2P A;  4EOT A;  5KLV J;  5KLV K;  1D7M A;  1YHQ P;  1S2E A;  2YO3 A;  3H1L D;  3KPE A;  2E75 C;  1OW8 A;  1L4A C;  2IBZ G;  1ZRT E;  1QL2 A;  1Q7Y Q;  1PGJ A;  1FR2 A;  3N7N A;  1BSN A;  1OIP A;  1OFC X;  1SQX E;  5TIS E;  4EYY Q;  3CPW O;  2Q3E A;  3T97 B;  3WBH A;  4GR6 A;  1P84 I;  1QX8 A;  2E74 D;  3CI9 A;  3L73 E;  3CX5 E;  1KTM A;  5KP8 B;  1SQX K;  5E79 E;  3TK1 A;  2L5G B;  3VN0 A;  2G8Y A;  2GZF A;  2SPZ A;  1GU4 A;  2WSF J;  4RJT A;  2Y0D A;  3B8E B;  2OYH C;  2YMY A;  2VRS A;  1OMI A;  5KTB A;  1W2E A;  2LXB A;  1GW4 A;  3SFE C;  5EJD A;  1AA0 A;  2EHT A;  2L6E A;  4PD4 D;  5B5E H;  3AE1 C;  1WMK A;  1KIL C;  1IZN B;  1VQ6 P;  2FHS C;  4L75 A;  4PJ0 H;  2M5R A;  4BPG A;  1Y9B A;  2QJK C;  2WSC J;  1OWA A;  1SFC B;  2K9J B;  2POH A;  3RGU A;  2P58 A;  1LTI C;  2E76 B;  4OVN F;  2FXO A;  1X22 A;  2FVF A;  1JMM A;  1URQ C;  2N1T B;  3D6Z A;  3DS5 A;  1L0L G;  4U7J A;  2OYI A;  3BCC E;  3F5H A;  2WPT A;  3VMX A;  1FJK A;  4F37 A;  2AEM A;  1UNK A;  3RK3 C;  5AW3 B;  1VQ4 P;  1LNQ A;  1KD1 Q;  5CJ0 A;  2FQ2 A;  3TYY A;  1FDO A;  2GZG A;  1RNI A;  1NH4 A;  4YPC A;  5CHX A;  2BQ1 E;  1LWU A;  3EFF K;  1EC5 A;  3GHG C;  3B5N B;  5AW6 B;  3EFG A;  1JNM A;  2ZVO B;  2PEM A;  4C7N A;  1PL5 A;  1NU1 J;  1HF9 A;  3GZL A;  5KP7 B;  1NTZ E;  3B4S A;  3WUV A;  1G2C A;  1J1D C;  3CWB D;  1IFJ A;  1JY3 O;  2K9Y A;  1GL2 A;  1F80 D;  2RN0 A;  1USE A;  3AE8 C;  1T2K C;  2ZXX A;  3CX5 I;  2Y0E A;  4UB6 H;  1GU5 A;  2P2U A;  2O1J A;  3OJA B;  3A0H E;  3VP8 A;  1NTZ K;  2AXT E;  5KLV G;  5KAF H;  1LTG C;  3ZDM A;  3E1R A;  2LF4 A;  4Z1M H;  5BVZ A;  1J2J B;  2FXP A;  1KYO E;  5HGO A;  1T6A A;  4YTP C;  2YKO A;  2O3J A;  4KT0 J;  3RG6 C;  2NPS B;  2JU2 A;  3KHU A;  5BS2 A;  4U0A A;  1HBW A;  1NAY A;  1GW3 A;  1VF5 D;  3LIE A;  1GPJ A;  1H0T A;  1AUM A;  2FYU J;  2M5A A;  1FBM A;  2ZYA A;  1U57 A;  1IFD A;  1EZV E;  3AE9 C;  3M9Q A;  3L71 E;  3ITK A;  1KV4 A;  2P1J A;  5APV A;  3L75 J;  3SWY A;  3Q5P A;  3TGU J;  1RF1 B;  2JB0 A;  1AQ5 A;  2FAE A;  2QNW A;  1QEX A;  3L71 J;  3U59 A;  1S9K E;  3DS2 A;  3H1K E;  1LTJ B;  2B87 A;  3SWF A;  2Q6Q A;  1M8O B;  2WWW A;  4LGD E;  3KZI H;  1FDI A;  2MVU A;  3H1H E;  1L0N J;  1GD2 E;  1KFN A;  3GW6 A;  1NQ4 A;  1FOS E;  4XFX A;  2JO1 A;  2JQ4 A;  2RKL A;  2FAD A;  3PLN A;  2YXR B;  2Z4E A;  4UHP B;  1BE3 D;  3HE4 A;  3HZQ A;  1SQV D;  1GL2 D;  2WTY A;  2V4H A;  1UII A;  2WVR A;  3A5T A;  1YIJ P;  3BAS A;  5GTI E;  4WY4 B;  2ZVN B;  3MTU E;  4C46 A;  5APX A;  2BHV A;  2Z44 A;  1MV8 A;  1SQQ D;  2M3E A;  1NTK D;  4ZNC A;  2JO0 A;  1S1C X;  3CXC O;  2AVA A;  2XNX A;  1GMJ A;  2R5B A;  3BRV B;  1X79 B;  3G3Z A;  2QM7 A;  4N6J A;  1SLQ A;  4N78 D;  3KYQ A;  1X3O A;  3CMA P;  1P84 D;  3T97 A;  2E5Y A;  1HVV A;  3L74 D;  4XRO A;  1BCC J;  2IDB A;  4OGQ B;  1DIP A;  1M6E X;  3HE5 B;  1OVR A;  1NWQ A;  2KOS A;  3GLM A;  2BEZ F;  1JTH A;  2YIU B;  1M57 D;  1YYC A;  3FXE A;  2OYH A;  3L37 A;  1PEM A;  3H6P A;  1AVO A;  2YXQ B;  1IJD B;  1HQB A;  2L91 A;  1A02 J;  5AVQ B;  1EZV I;  4I7Z C;  1ZMB A;  4EIJ A;  1HGV A;  3V2R A;  1G1I A;  3O8Z A;  1X0T A;  1S3J A;  1N73 B;  1LP1 A;  1UIX A;  1FZF A;  5KLI C;  3GF3 A;  2Z46 A;  4PV1 D;  2BCC E;  1M1J A;  2W83 C;  3V6I A;  1NJI Q;  4LLH A;  1SFC A;  3WUU A;  2K9J A;  2ITA A;  2FYU G;  1EOQ A;  3L72 J;  1PP9 E;  2BCC J;  2H89 C;  1VF5 C;  2FQ1 A;  1URQ A;  1Q86 Q;  1RE4 A;  2N1T A;  1N7S B;  4H13 D;  5CMZ A;  2K0X A;  1VQL P;  1GTW A;  3G21 A;  1PP9 J;  1GXH A;  3L75 G;  3TGU G;  2WPR A;  5AW7 B;  2IBZ E;  3G29 A;  1JO5 A;  2KOG A;  1PPJ G;  3L71 G;  2OYI C;  2JAZ A;  1ZRT D;  3B5N A;  2BEQ D;  1U7J A;  3H32 A;  3CXH E;  1KB9 E;  2MF4 A;  5KJ7 A;  4NPE A;  1SQX D;  3PJS K;  3WU2 E;  1L0N G;  1LWU C;  5APS A;  1NGM B;  4IFM A;  3L73 D;  3CX5 D;  4DOJ A;  4DG9 A;  4KJM A;  3VTP C;  1M74 A;  4RES B;  2Y9Y A;  1DEE G;  1Y47 A;  2GYK A;  1T3U A;  1H89 A;  1GL2 C;  3B5I A;  3H1J E;  4Y99 C;  1JCC A;  5CBO A;  2PNG A;  2O1K A;  1IUQ A;  3M1M A;  2NPS A;  2G3A A;  2W90 A;  3H1J J;  3A0B H;  2M8R A;  3PHL A;  2JR8 A;  2KP8 A;  2KIK A;  2M8L A;  1FC2 C;  3L70 J;  2CG5 B;  1KMI Z;  2L0Q A;  2PEK A;  2K1A A;  1BCC G;  2K88 A;  3S9O A;  2OQQ A;  5GTH E;  1R8E A;  2NRG A;  3C9I A;  1J1E C;  1NKZ B;  1SFC D;  2H7H A;  5KAI E;  2V7Q H;  3P7K A;  1L0L E;  2LIW A;  1N7L A;  2N1T D;  4H44 B;  1MZ8 A;  3BCC D;  2P67 A;  3DS1 A;  5DCK A;  3MIW A;  1H8A A;  1RF0 A;  1Y8A A;  1L0L K;  2JU1 A;  1OW6 A;  2IBZ I;  1LTJ A;  1AF8 A;  2MD9 A;  1LT9 A;  3V2Q A;  2OTJ P;  3B5N D;  2ERH A;  3RL0 B;  1Z56 A;  2KUB A;  2KGE A;  3QH9 A;  5KJ7 D;  1IMP A;  1KB9 I;  1NOH A;  2VSQ A;  4PV1 C;  4PH0 A;  1A8O A;  2ZT9 D;  3L72 G;  1NTZ D;  4OH8 B;  1H88 A;  2BCC G;  1LTT C;  2FY8 A;  3AEA C;  2DNW A;  2LL8 A;  2EIA A;  2XZR A;  2D2C B;  1XTG B;  2XZ1 C;  3P05 A;  4BPF A;  2WT7 A;  3NTN A;  3M0D A;  4WY4 A;  5KLV E;  3EQ2 A;  1PP9 G;  4H13 C;  3U43 A;  4AUW A;  1GK4 A;  3TF5 A;  2QJY B;  3HTK A;  3TDK A;  2N5I A;  4Y28 J;  1KYO D;  3G1I A;  5CBN A;  5KKZ B;  2KGD A;  5B66 H;  1P84 H;  2Q3I A;  4TT3 H;  2NPS D;  1L4A A;  3TSI A;  3MHV A;  3USS A;  3A7O A;  3BVH A;  2KS1 A;  3HE5 A;  2WSE H;  2MVV A;  2E75 B;  1RE3 C;  2VLQ A;  2GDY A;  4DJG A;  1M1K Q;  5DJT B;  1DX7 A;  1EZV D;  4BPH A;  3G26 A;  2MJZ A;  1ZR4 A;  1BGY J;  3JCU H;  2KI7 B;  1KC8 Q;  2GDX A;  3CC4 P;  1FS0 E;  2Y0C A;  2P10 A;  2KOP A;  1FOS F;  4YXW H;  4IZ6 A;  1OVU A;  1FDM A;  1N73 A;  3H1J G;  1S9K D;  3H1K D;  2XND H;  1SQP E;  5BS1 A;  2KOO A;  3L70 G;  1PGP A;  3H1H D;  2KGC A;  1PV3 A;  1IK7 A;  1JEK A;  1SQP J;  1SQP K;  3EJB A;  3H1I J;  1N8R Q;  1ZR2 A;  3V5B A;  1M1J C;  4UB8 E;  2FFD B;  2XU6 A;  1S5L E;  3CCL P;  1IMQ A;  2N50 A;  3E7K A;  1SP4 A;  3RBZ A;  1SFC C;  3AEG C;  3V4Q A;  3E2D A;  5KAF E;  3G4S P;  3G9R A;  2CQ8 A;  1AFO A;  1SQB E;  2HOD B;  5DJU B;  1ZLL A;  4WY4 D;  1RE4 C;  2N1T C;  3RL0 g;  4QMA A;  2K0Y A;  2FYN C;  2QJK B;  4IFF A;  1A02 F;  1ZW0 A;  1FZC B;  1Q82 Q;  2R3S A;  4MN4 C;  3GJN A;  3AEB C;  2DGY A;  1SQB J;  1SQB K;  3QWO C;  1M56 D;  5AW5 B;  1K8A Q;  4HYT B;  5TIS H;  3R2P A;  4DT0 A;  3V2N A;  2AF8 A;  2M3B A;  1NU1 E;  1OW7 A;  3AE4 C;  1L4A D;  3CX5 H;  2AEF A;  3B5N C;  5E79 H;  1AYI A;  3CD6 P;  1HH0 A;  2FVA A;  3H25 A;  4OGQ D;  2FQ0 A;  3FXD A;  2XT1 A;  3S1K A;  1VQO P;  2GZE A;  4IL6 E;  2VLP A;  5KJ7 C;  1NU1 K;  1NTM E;  4H0L B;  3SFD C;  2K37 A;  2CPS A;  2K0D X;  1KQL A;  2BAS A;  2ZT9 C;  2GA1 A;  4JF7 A;  1ZME C;  1LTS C;  3GHG B;  2FYZ A;  2OYO A;  1NTM J;  1NTM K;  2KW2 A;  4XE5 B;  4D6T J;  3KQG A;  2KG6 A;  1PGQ A;  1L2P A;  1HGZ A;  1J1D B;  2JYG A;  1KZU B;  2CK3 H;  1JMB A;  2JWA A;  4EI2 A;  2HG5 D;  3WMM 0;  2KNC B;  2NPS C;  2IX7 C;  2Y9Z A;  1M7L A;  2FYU E;  5AW9 B;  3CCQ P;  3VYI A;  3OAK A;  1D1D A;  2LIU A;  1R5L A;  4U3F J;  1DEB A;  3EWK A;  2FYU K;  4GKG A;  1BGY G;  2E74 C;  2HFE D;  3L75 E;  5AW4 B;  2ONT A;  3O6Q A;  3TGU E;  2N6Y A;  1PPJ E;  3H1L J;  2GUS A;  4W7Y A;  2KK7 A;  2W6A A;  2IBZ D;  2O01 N;  2A06 G;  3L36 A;  1NKN A;  3TNU B;  2H43 A;  1RF0 C;  1L0N E;  3CXH D;  1KB9 D;  1YJW P;  1LTJ C;  1LT9 C;  1CI6 B;  1N86 A;  3FGA D;  1SQP G;  3L4F A;  3H1I G;  1L0N K;  5H2F E;  3A0H H;  2PP6 A;  1PGO A;  2AXT H;  2QSI A;  1GDT A;  1BAJ A;  2C9L Y;  5TJH A;  4LC1 A;  2K2Q A;  2L22 A;  4C7R A;  2L9F A;  4WWI A;  1G1J A;  4O9B A;  2PFX A;  1KYO H;  3HUS B;  3M9B A;  4PD4 E;  4DZO A;  3II6 A;  4WBA A;  3VRL C;  2Z5H A;  3M0D C;  4WYM A;  2W6J H;  4WY4 C;  5APU A;  1SQB G;  5APY A;  3AEF C;  2PY8 A;  3H0D A;  2IPP A;  2LML A;  4U0E A;  2LOL A;  2ROQ A;  1BCC E;  1KYO I;  2NO8 A;  3MP7 B;  1IFN A;  5AVU B;  1MUU A;  2PEO A;  1RE3 A;  5AW1 B;  1AJY A;  1K73 Q;  3IR9 A;  2PEN A;  1X8Y A;  1NU1 G; 
#chains in the Genus database with same CATH homology
 3CCJ P;  3I56 P;  1YIT P;  1Q7Y Q;  1K9M Q;  4PH1 A;  3CME P;  3H4E A;  5HGM A;  3B5I A;  1RNI A;  3E2D A;  3G4S P;  1ZMB A;  1VQ9 P;  5F2K A;  2BQ1 E;  2M8N A;  5F2O A;  3G28 A;  4U0D A;  3DS2 A;  2ONT A;  2QEX P;  4U0F A;  3H47 A;  5F2N A;  3CPW O;  1YI2 P;  2PEM A;  1IUQ A;  3NTE A;  3M1M A;  3WBH A;  4GR6 A;  3I55 P;  1VQM P;  3G1I A;  3CCM P;  1PEO A;  3G0V A;  2Z46 A;  1Q82 Q;  2PEI A;  2Z45 A;  2DGY A;  1QVG O;  2M8L A;  5HGN A;  1K8A Q;  1M6N A;  3DS4 A;  1QVF O;  3CC7 P;  4GR2 A;  3LRY A;  4XFY A;  1NJI Q;  2PEK A;  4XFX A;  3HYB A;  1EIA A;  2BUO A;  1EOQ A;  2PEQ A;  3HZQ A;  1YJW P;  3CD6 P;  1PEU A;  1Q86 Q;  3OW2 O;  1VQL P;  2JYL A;  2XT1 A;  1VQO P;  1VQ8 P;  3G21 A;  3G1G A;  3CCR P;  2PEJ A;  1JJ2 O;  2XXM A;  3CC2 P;  1M1K Q;  1YIJ P;  2EFJ A;  1Q81 Q;  2LF4 A;  1W2B O;  3DTJ A;  1VQ7 P;  2BHV A;  1VQ5 P;  2Z44 A;  5HGO A;  3MGE A;  3G26 A;  2EG5 A;  3DS1 A;  4QNB A;  1M90 Q;  3G29 A;  1BAJ A;  2L6E A;  3RG6 C;  2JO0 A;  5DCK A;  1KC8 Q;  3CCE P;  3CXC O;  4XFZ A;  3DS3 A;  3CC4 P;  3G71 P;  4M0I A;  1S72 P;  1VQP P;  1PEQ A;  1VQ6 P;  5I4T G;  1RO0 A;  5BS2 A;  3G6E P;  2XV6 A;  2OAR A;  4U0A A;  3VRL C;  2QA4 P;  2M8P A;  3CMA P;  3DS0 A;  2OTJ P;  3Q20 A;  4COP A;  1VQN P;  1K30 A;  3CCV P;  5JPA A;  4WYM A;  1RO2 A;  1VQK P;  4XRO A;  1E6J P;  5BS1 A;  1M6E X;  1KQS O;  1A43 A;  1AUM A;  2E1M A;  2PY8 A;  4U0C A;  2KOD A;  2OTL P;  2JYG A;  4U0B A;  3H0D A;  3CCS P;  4IPY A;  1A8O A;  4U0E A;  5HGL A;  3DPH A;  4PH0 A;  4XRQ A;  3DS5 A;  2P9X A;  4COC A;  1YJ9 P;  2EIA A;  1YHQ P;  1N8R Q;  1QRJ A;  3CCQ P;  1PEM A;  2CWO A;  1YJN P;  1VQ4 P;  1D1D A;  2PEO A;  1M74 A;  1K73 Q;  1KD1 Q;  3CCU P;  2PEN A;  3P05 A;  3CCL P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...