1Q86Q

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q86Q03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q86Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q86Q02
1Q82Q 1VQ5P 1K9MQ 3G71P 3CCQP 3CCMP 3CMAP 1KC8Q 1VQ4P 1K8AQ 1VQMP 1VQKP 1VQPP 3CCEP 1YJNP 1Q81Q 3CMEP 1VQ6P 3CCJP 1VQNP 1NJIQ 1VQOP 1Q7YQ 1JJ2O 1M1KQ 3G4SP 1VQ9P 1YITP 3CD6P 1YI2P 1S72P 3CC4P 1YIJP 3CCLP 2OTLP 1YHQP 3I56P 3CCUP 1VQLP 1M90Q 3CXCO 2OTJP 1KQSO 1VQ7P 3I55P 1Q86Q 1QVFO 3CC2P 3CCSP 3G6EP 1VQ8P 3CPWO 3CCVP 3CCRP 1YJ9P 1YJWP 1W2BO 2QA4P 3OW2O 1QVGO 1K73Q 1N8RQ 1KD1Q 2QEXP 3CC7P
chains in the Genus database with same CATH superfamily
3GZMA 2XV6A 3TNUB 1BCCD 1KC8Q 3A7OA 1L0NG 1X8YA 3CC4P 3G26A 2YKOA 1WRGA 4WY4C 2R3CA 1CEIA 2GZIA 3CWBE 3G6EP 3RK3E 2ZYAA 1H8AA 3H1KD 1USEA 4R4LA 1H88A 2XDJA 3L72D 2JWAA 2NO8A 4BWNA 2HODA 1Q90D 2JO0A 1NGMB 3HE5A 2WVRA 4H2YC 2DGYA 3CC2P 4H44B 4IZ6A 2PEIA 2QEXP 3LW5J 2E74C 2KNCB 1G1JA 2HFED 1GL2D 1SQXK 1K8AQ 3KZIH 3SSUA 2LOLA 4EDFA 3DS4A 5APYA 4U7JA 1AQTA 4HYTB 2G3AA 5AW6B 4C7NA 5AVTB 4U0AA 1NTZJ 1LTJA 1W2BO 2YNYA 2ZAEB 2QA4P 4XA4A 4GIFA 1NTKD 3BCCE 3TYYA 4I7ZC 3CMAP 1NTZK 1OMIA 5GTIH 1ZR4A 7CEIA 1RHZB 1JB0J 5B66H 1EC5A 2E75B 4I1LA 4A7PA 1NTMD 3P8MC 3A2AA 1FZCB 1M6EX 1L0ND 3L75D 1T2KD 3MGEA 2PGDA 1USDA 2XKMA 5TISH 1S3JA 1HJ0A 2WT7B 3BVHA 4QNBA 3G9RA 4KT0J 1URQD 2A45I 1KILE 1VQ4P 5KKZB 1VQNP 1ZRTE 1NH4A 4IPYA 2HODB 1M1KQ 5KTBA 3HE5B 1RF1A 1GL2C 2OYHA 1SQBE 2FBWC 2LL8A 1SQPG 1GTWA 5L8RJ 4Y28J 1FS0E 1LTTC 2IYPA 3LRYA 1L4AA 1ZN5A 1BE3E 1VQ9P 3CD6P 2W83C 1W2EA 4U3FJ 4C7NB 4PJ0H 3NMDA 2N1TD 4JPZB 4LLHA 1IFPA 2Q1KA 1RE4C 2QJKC 5BU8B 1VF5D 2M5AA 1BAJA 2OQQA 2ZXEB 2Z46A 4NEOA 1YITP 1SQQD 1FE6A 2BASA 1H0TA 1IFJA 1T2KC 4U0BA 3FWLA 4N78E 2KWLA 1GD2E 3GLMA 1S2EA 3BCCJ 3H1ID 4I2LC 4BRYA 1AQ5A 4COPA 4NPDA 2QRXA 2VLQA 1KYOD 1URQC 2I1KA 1XTCC 1JOCA 3C1LA 2XZ1C 3HD7D 4JYCA 2LXCB 2N5HA 2FYNC 2JWDA 1JY2N 2M5RA 2NPSD 1RF1B 1PP9J 1FJKA 1YQ4C 1N7LA 1SQPD 2AXTH 1RQVA 2GDWA 2QIWA 2KP8A 4UB8E 1GXGA 2BCCE 2GUSA 1L4AB 4U0DA 1NU1E 2H88C 3H1LE 1OZHA 2FVFA 1KYOH 2WQYC 3WMM0 2N1TC 5GTHE 1VQ6P 1IFDA 1LT9B 3QWOC 4OWFA 2POHA 2XNXA 3P32A 3UIAA 1SQBJ 5KLIB 1VF5C 1RE3C 3GHGC 1L0HA 2RMZA 3CWBG 1MV8A 1FR2A 3CC7P 3H0DA 1SS1A 2Z45A 2JBGA 1EZVI 1MFTA 1PIXA 3C9IA 3L35A 4DZOA 1JY3N 2M5AB 2QG4A 1BE3J 1JJ2O 1FJPA 2LIUA 2M3BA 1H0TB 1FAVA 2O1JA 5E79E 1IFIA 2BEQD 2HR3A 3L70G 3PRJA 2KGAA 4YTPC 3AE6C 4BRYB 1P84I 2MKVA 2DNWA 1WT6A 2QM7A 1IFNA 4N3YB 3GZLA 5AW1B 3AEAC 3HD7C 4L75A 1KILA 1QL1A 4OH8B 3B5IA 1E79H 3O8ZA 2JU1A 4NPFX 1PGJA 2NPSC 4RKUJ 4DG9A 5KLVK 4Z1MH 4WY4A 1Q86Q 2OYIA 3SFEC 1OW6A 3L74E 1NHLA 5F2NA 1X79B 2QJPB 3V2QA 1VQOP 3MHVA 4IL6X 1SFCD 2AXCA 3CX5I 2AEFA 1M1JC 4DT0A 1QVFO 3JC22 4K35A 4ZNCA 4ZMDA 3AEGC 1JNMA 4UB6E 2W6BA 4EOTA 1VHNA 4WB4A 3RL0g 2K9YA 2KZIA 3AE9C 2E42A 1OX3A 2YMKA 3VRLC 1YBKA 2BCCJ 2PEMA 2ZT9D 2FXOA 3H1LJ 2LXBA 3HUSA 5APSA 3IAOA 4TT3H 1LTBC 3W68A 1IZNB 3L70D 3H1JE 1QX8A 1AVOA 3M91A 2FQ1A 5I4TG 2IZ0A 1GU5A 1M8OB 3U1CA 1PL5A 4ASWA 2KG8A 4OVNF 1EMVA 1SQBG 2FFDC 4F37A 2N9BA 2FVAA 1HTLC 4GR6A 3E7KA 2P9XA 1L0LD 2QJYC 1NAFA 1KILB 1VQMP 1FOSF 2MVUA 1BE3G 4QKOA 2IFMA 3CCLP 2E5YA 1N86A 2FYZA 4WY4B 1NTKK 2OYIB 3VP9A 1X3OA 1IMPA 4N6JA 3CXHI 5K5GB 2FXPA 2DW3A 1VQ8P 1EDIA 1SFCC 2VRSA 5AVRB 3SWYA 3H1HE 3DS0A 2CGQA 2HPCA 1SQVD 3P05A 1KB9I 1ZLLA 2E76D 5AVVB 3L4FA 2C9NY 1QEXA 2NZ2A 5KAIH 3IF4A 3D70A 1TU3F 1OR5A 2IBZG 3Q5RA 3L74J 1K73Q 1SQXE 2E74B 3SWKA 3GJNA 2KI7B 3AE2C 1VQKP 1PZQA 1JO5A 2YXQB 5KP7B 4WBAA 2ZXXA 2L0QA 4XE5B 1JY2O 3MZWB 1T3JA 3HUSB 3HZQA 3USSA 1J1DC 1N2DC 4I7ZB 3PTZA 1VQPP 1Y8AA 4Y99C 4IFMA 1OW7A 5AW7B 2EG5A 3P8CE 2IYOA 3MTUE 1P84E 2KG6A 1YJ9P 2H8PD 3D6ZA 5KJ7D 2IFNA 1NU1G 3H1LG 3H1JJ 2K0YA 1KN7A 4DJGA 1IO4A 3JCUE 1JY3O 2Q7CA 1FZBA 1S5LX 2E76C 3NXSA 2H43A 5AVYB 2WSFH 1K04A 1RQUA 2E43A 2K1AA 1ZV8A 2KXPB 1Z6MA 4D6TE 2HPCB 1SQQK 2SPZA 1PEOA 5EW5E 5KAFE 3RL0D 3IR9A 3DS3A 3H1IJ 1QLED 2IBZD 2AVAA 2CQ8A 2LR2A 1T3UA 1NKZB 1IK9A 2LKMA 4N78D 1N73A 2KORA 5CCGD 1PFIA 4PV1D 2O1KA 3L71E 1GDTA 3H1HJ 4W7ZA 2MR8A 2WT7A 3S4RA 4L74A 5AW9B 1A02F 2MJZA 1FZAA 5AVXB 4U3FE 3DS1A 2FYUE 2MVVA 1KV4A 1SQXJ 2RN0A 3B5NA 1BSHA 1PEQA 2A45G 3Q2YA 1DH3A 3H32A 3TGUG 1QL2A 3L73E 5KJ7C 2EIAA 1HGZA 2GZFA 2C9LY 5CBOA 4IL6E 1YTZT 1EDJA 1FU1A 1NU1D 2K0DX 2ZYDA 2N9YB 5TJHA 1Q2NA 1M56D 3OAKA 1UIIA 4GDOA 2XT1A 1AYIA 1DEBA 3JSVC 1N7SD 3RL0C 3SFDC 1RF0C 4WYMA 5CJ0A 1KQGB 2KZJA 1D1DA 1A43A 1KQSO 4HKGA 3I55P 2Q6QA 3M0DA 5KP6B 3CCVP 1NQ4A 3VMAA 2L6EA 1KB9E 5AVUB 2R32A 4PV1C 1ZNVA 3AEBC 4UB8H 5HV8A 3GW6A 4L73A 1N73B 4PD4D 4LGDE 4H44D 2V7QJ 3WU2H 1LGHB 1IMQA 1PP9E 1HJBA 3H6PA 2B9BA 3KHUA 2PEJA 1NAYA 3P7KA 1EOQA 1YTZI 2K3RA 3AE7C 4D6TJ 5B5EE 2J5UA 1X22A 2YXRB 3A3YB 5AW3B 1LP1A 1ACPA 3M1MA 1PGPA 2IX7C 3E1IA 4M3LA 2FQ2A 2WSEJ 3L36A 4U0FA 2ZJSE 3L71J 2JGPA 3B5NB 1NYHA 2JQ4A 3TGUD 1HGVA 2ZYGA 1LWUA 3H32B 4TLFA 5E79H 4PD4H 2WTYA 2KR5A 5HGNA 1HWTC 3V4WA 1LT9A 1FDIA 1PPJE 3BRTB 1M90Q 2D2CB 2FYUJ 4PH0A 2QE7H 2I1JA 1N7SC 2KS1A 5APTA 3U43A 2KGCA 1KFNA 3Q3DA 2FHSC 1SQXG 4H2WC 2FYUK 5AVQB 2IZ1A 2KLUA 1VKUA 3L73J 2V4HA 2GZJA 4BPGA 5KLVE 2GUVA 2Z44A 1L0IA 2A45H 2UWJE 2NPSB 5APXA 1VDFA 4H44C 2PY8A 3BRVB 1NTZG 1BGYE 5CCHA 3LIEA 2GZEA 2AF8A 1NJIQ 2P7JA 2N6YA 3EJDA 1BDDA 4UB6H 1L0LK 3G0VA 3KZIE 2ROQA 1KYOI 1S9KD 3O6QB 3FXEA 2KUBA 5H2FE 2Y9YA 3M9QA 1LP1B 1KQLA 2WPRA 1JY2P 3CCQP 4EYYQ 1JCDA 2GDYA 3H1KE 3GF3A 5AW5B 2K93A 3L72E 1UIXA 1NWQA 1S5LE 1SQVK 1FZCC 1LWUB 5GTIE 4D6TG 3D6YA 1OW8A 5B66E 5AVSB 4BPFA 2JB0A 2CNRA 2GYKA 2J58A 2Z5IA 1E5WA 2WSCJ 3HTKB 1YI2P 1RY3A 2LF4A 2X2BA 3MUDA 3L37A 5JPAA 2KS1B 1VQ7P 3AE1C 2JKVA 3KDPB 3L71G 2QVAA 3R2PA 3MD0A 5F2KA 1JM0A 1MFZA 5KKZC 1GW4A 2ONTA 3PLNA 1NTKE 1OIPA 3BATA 2KIKA 1Z56A 2PP6A 3I56P 2H7HA 4H0LD 2PFXA 1NTZD 2AEJA 4U3FG 4OGQD 3CCRP 1NTME 2ZVOB 2G8YA 2PENA 1A8OA 2KOGA 4CPGA 5KLVJ 2AEMA 3L75E 3OJAB 4XFXA 3LIDA 3LW5H 1JMBA 3B4SA 1J1EC 5AW0B 1FDOA 4B86A 1L4AD 1LTJC 1JMMA 2PEQA 2M8NA 3EWKA 1DNYA 1E0HA 2PEOA 1L2PA 2PRRA 1BGYJ 3AE5C 1VL2A 1AF8A 3BCCG 1YJNP 1BCCJ 2O01N 1OWAA 3PH0A 3M9BA 1XTGB 3CXCO 2P58A 2KW2A 3WUUA 3RK2B 4RJTA 1MZ9A 2W6JH 1MUUA 3NTEA 3A0BE 2WITA 1GK4A 1HVVA 1ZP0C 3Q5PA 1NO4A 3B71A 3H1KJ 1IJDB 4Y99B 1NKNA 5AVWB 1GU4A 2L91A 1EIAA 3L72J 3CWBD 3VP8A 1IC2A 3RK3D 1PP9G 2W27A 2FQ0A 4GOFA 5HVCA 1DIPA 5KP8B 4H0LC 3IFMA 1G2CA 1CZQA 2QM8A 4EIJA 5CJ4A 4OGQC 3W67A 1KZUB 1RF1C 4U3FD 3A0HE 4U0EA 2OYHC 1HH0A 2K0XA 1SQQE 2LIWA 4ZKUA 1OXZA 1L4AC 3VYIA 3EJBA 2WSEH 3H4EA 1NTKJ 3VN0A 3H1IE 1GZLA 4KJMA 2O01J 2Z5HA 4H13D 2OTLP 1PPJG 2ITAA 2CWOA 3EJEA 2BQ1E 5KLIC 3D71A 3HE4A 1KYOE 3BCCD 1NTMJ 2N98A 1AJYA 5HGMA 2VLOA 2QSIA 2CPBA 1L0NJ 4RESB 1NTMK 3L75J 2BUOA 5KLVG 1BXIA 1HY8A 1K05A 1L0NK 4PH1A 1GL2A 4ZKPA 1SQPE 2P1JA 3RK3C 5C39A 4IL6H 4HH2A 2KK7A 1GXHA 2Y0DA 3H47A 1PP9D 1M57D 1Q81Q 2R3SA 2JR8A 2ZT9C 4BPHA 1ZOYC 2M0BA 2WPSA 3FXDA 1SVFA 1AV1A 1T8ZA 5DCKA 1R8EA 1KILD 1G2CB 3TDKA 2YO3A 5EJDA 1EZVE 1ZRTD 1ZMBA 3T97A 2L5GB 3KXDA 1RE4A 2JAZA 3G1GA 1SQBD 2HYNA 3VMXA 3Q20A 3L72G 2YKQA 2ZVNB 1EXJA 5AW8B 1PEUA 3NTNA 4H13C 3CE7A 4I6MC 3CLQA 4KHXA 2KGEA 2EHSA 2BCCG 3MIWA 4PV1B 1BE3D 3H25A 2P10A 3S1KA 5B5EH 1D7MA 1Y9BA 2FXMA 5APVA 1BSNA 3HE4B 2K2QA 1URQA 1GPJA 3TF5A 1SQQJ 2KOQA 3DS5A 2JJLA 2R44A 3K5BA 2N6ZA 2WPTA 1LTSC 2KLVA 2K9JA 3G71P 2MY5A 2KG9A 3SWFA 5F2OA 3HRNA 2PAJA 1NTKG 2H89C 3CX5E 1GL2B 3G21A 4JF7A 2IBZI 2P67A 1DV5A 1PGQA 3CPWO 3VOPA 5CBNA 3AEEC 3OW2O 2M3EA 4GR2A 1EXIA 1KILC 5AW4B 2GM4A 1H89A 4AUWA 2N1TA 4R0MA 3L75G 4YXWH 2OYIC 4EI2A 1N7SB 4JBZA 1SQPJ 1RE3A 3GHGA 3L74G 4XFYA 1R5SA 3T97B 5CHXA 5DJUB 1SQPK 2QJKB 4MRTC 1X0TA 3AEDC 3V2NA 2YIUC 3ABVC 3L70E 3PHLA 3CI9A 2BCCD 3AE4C 3H1LD 1CI6A 1FBMA 1PEMA 5KAIE 4COCA 2XNDH 5H2FH 5AVZB 3HD7A 1L0LE 1URQB 4HJGH 2ERHA 2C0XA 3CXHE 2NPSA 2E5TA 3KPEA 2K9JB 3HUSC 1PGOA 5CCGC 2OYOA 1S5LH 1OVUA 2FYNB 2KSEA 3V2RA 1M6NA 3TSIA 1SQVE 3H1JG 1ZXGA 2Y9ZA 5BS1A 5GTHH 4PD4I 2M8PA 2A06E 4C7RA 1SQQG 1ZW0A 1GW3A 1M1JA 3EQ2A 3DPHA 4UHPB 3O6QA 1RO0A 5AW2B 1FZEA 3V6IA 2VSQA 3CCMP 3KQGA 2N1TB 1LNQA 1IK7A 3R4YA 2JYLA 1A02J 2JDIH 4L76A 3H1IG 2CK3H 3IN6A 3L74D 1VQLP 2XZ0D 1K30A 1JTHA 1VF5B 3GHGB 4JQ0D 2AFDA 1KQFB 2O01H 4ASVA 4C46A 3E1RA 3H1HG 4CA3A 2K94A 4K3AA 2E75D 2ZFCA 3CCJP 4R4MA 4WVZA 1Q7YQ 2JO1A 2W8ZA 1JUNA 3DS2A 2MR7A 2LKIA 1AVYA 3HTKA 4H2XC 1T8KA 3CWBJ 3PP5A 1CI6B 3M06A 2FFDA 2FKWB 2K92A 1IUQA 2QNWA 1S1CX 1OVVA 1CSBA 3HD7B 2XU6A 1EQ7A 2KODA 3L70J 1J1EB 3CCUP 4GOEA 5M1BA 3WUVA 3CL3D 3LMOA 1LT1A 1LTJB 2R5BA 1CW5A 4PXHB 4M0IA 2IPPA 2FVEA 1N8RQ 3NFQA 1SFCA 1DX7A 3H1JD 1EZVG 3RBXA 2KYVA 3EFGA 1L0LJ 3A0BH 2B88A 2EFJA 2B89A 3B5ND 1G1IA 1BCCE 3VMZA 1T6AA 2JP3A 3RBZA 2IBZE 3MGNA 1M1JB 1F80D 5APQA 2OGUA 2LTEA 3MP7B 1HBWA 2WWWA 2JYGA 3Q1MA 4AQRD 1S4XA 2D2CD 1SQVJ 3GF7A 3N4XA 3B4QA 1JTHB 3HYBA 5CMZA 3VTPC 4JYBA 1NOHA 2E75C 1EDLA 2W6AA 3H1HD 1AFOA 3E2DA 2VLPA 3A0HH 1HQBA 4YXDC 1U7JA 1YJWP 4H0LB 2BEZF 2HLOA 3G1IA 1VQ5P 4OGQB 3RG6C 4LC1A 3G29A 3PJSK 3FX0A 3C8VA 2OYHB 1N73C 3OA7A 4IFDK 1J2JB 2M8RA 2YMYA 3QH9A 1SQXD 2FFDB 3II6A 4XRQA 1AA0A 4HKZH 2Z4EA 4XFJA 4IFFA 3M0AA 3WU2E 1K9MQ 3DTJA 2KGDA 1JY3P 2QJYB 3V4QA 5TISE 3M9HA 2WSFJ 3AE8C 2KOSA 1WMKA 1FDMA 2WPVB 1PV3A 1MZ8A 4BXLA 2Q9IA 4MN4C 3WBHA 1ZR2A 1EZVD 3B5NC 1JEKA 2FYUG 5HGOA 1SFCB 1SQBK 4PWVB 1OFCX 1KFMA 2M8LA 4O9BA 3RG2A 1KLPA 5BVZA 1L0NE 3L73G 3P8CD 2MF4A 5APUA 3TK1A 1YIJP 2YO2A 1P84D 2D2CC 4PD4E 3ITKA 2WSSH 3RK3B 1QVGO 4W80A 2FACA 4HB1A 1UJZA 4U0CA 1M7LA 2C0WA 4PJ0E 3GG2A 2XV5A 2ZT9B 2P2UA 4AYCA 3ZDMA 1L0LG 2EHTA 3F5HA 4GT1A 2O3JA 2GDXA 4D6TD 3M0DC 2CPSA 2L9FA 2IDBA 2WZ7A 3EFFK 4XROA 1GMJA 3FWNA 3VMYA 4WWIA 1J1DB 3G28A 1HUCA 3RGUA 3TGUE 3CX5D 1QRJA 2VLNA 1SP4A 1P84H 3BASA 2HG5D 1SQVG 1JCCA 5KJ7A 4GKGA 3L71D 3N7NA 4DCKA 5CCHD 1X9VA 4H13B 2B87A 5HGLA 1LJ2A 2A06G 2R5DA 1NVOA 3JCUH 1E6JP 2V7QH 1R5LA 1RO2A 1YYCA 1FOSE 1KMIZ 1Y47A 2FYUD 3U59A 2L22A 2W90A 1DD3A 2E76B 1DD4A 5KAFH 1RF0A 3GKLC 2Y0EA 1RH5B 4XFZA 2RKLA 1LWUC 2KSJA 4YPCA 3AECC 3CX5H 1FC2C 1NU1J 3L73D 1FZGA 3Q5SA 5CCGA 1RNIA 3I5CA 2AXTE 1LT9C 1NU1K 3RK2D 2JEEA 1QGKB 1U7MA 1KTMA 1HF9A 3NY7B 3V5BA 4QMAA 5CZDB 2FADA 3S9OA 2OTKE 4IOIH 2LMLA 1S9KE 3CMEP 1LTIC 1LTGC 1AUMA 3CXHD 1S72P 2CG5B 2GA1A 2WPQA 2K37A 3B8EB 2Y0CA 2K5XA 1EDKA 1KB9D 1BDCA 1OVRA 2K88A 5CCHC 3KYQA 1FZFA 1Q82Q 1YQ3C 3G3ZA 4NPEA 2Q3EA 3A5TA 1BGYG 3TNUA 3V2PA 2N5IA 2YIUB 2A06D 2E1MA 2KOOA 1U57A 1BCCG 3GMAA 2B87B 5BU5A 2RH0A 1DEEG 1N7SA 1W5CE 2OTJP 3WUTA 3F89A 3TGUJ 1KORA 3CXHH 3CCEP 4WY4D 2MD9A 2YKPA 2QJPC 3G4SP 3H1KG 3RL0B 1SLQA 2Q3IA 1KB9H 2NRGA 2N50A 2PEKA 3RK2C 3CCSP 2JU2A 2LPKA 1LTAC 2PNGA 1NTZE 2L4BA 2J59M 1ZMEC 1GK6A 2OARA 1PPJD 2KB7P 2KNCA 1IFMA 4GODA 1UNKA 2FAEA 1MKMA 3MUDC 2XZRA 1YHQP 3FGAD 3AEFC 2E74D 4DOJA 2WSCH 2FY8A 5APWA 1VPCA 5KLVD 2AFEA 1M74A 3U1AA 4RO0A 2Q5UA 2KOPA 5BS2A 2WMMA 4W7YA 5DJTB 3AE3C 2GZGA 2XXMA 2I8DA 1BGYD 2BHVA 1KD1Q 1FZCA 5EFWB 1NTMG
chains in the Genus database with same CATH topology
3G28A 5F2KA 1Q82Q 2XV6A 1VQ5P 3RG6C 2P9XA 1KC8Q 1QRJA 1ZMBA 2XT1A 3G29A 4COPA 1VQMP 2ONTA 3MGEA 3CCJP 1Q7YQ 3G1GA 4U0EA 3B5IA 2E1MA 2Z44A 3CC4P 3G26A 3CCLP 3DS2A 4WYMA 3I56P 3Q20A 1D1DA 1A43A 1KQSO 1PEUA 3I55P 1Q86Q 5HGLA 4XRQA 2PY8A 3G6EP 1VQ8P 3CCVP 4QNBA 3CCRP 2L6EA 1E6JP 2OTJP 3DS0A 1IUQA 5F2NA 2PENA 1PEMA 1PEOA 1K9MQ 1A8OA 3DTJA 3P05A 3DS3A 4COCA 3H4EA 1VQ4P 3CCEP 1RO2A 1VQNP 1NJIQ 1VQOP 4IPYA 4XFXA 1M1KQ 3G4SP 2KODA 2OTLP 2JO0A 3CCUP 2CWOA 3WBHA 2BQ1E 2PEKA 3DS5A 3G0VA 2DGYA 2PEJA 4XFZA 1QVFO 2PEQA 4M0IA 1EOQA 3CC2P 3CCSP 2M8NA 5HGOA 1K73Q 2PEOA 2PEIA 1N8RQ 2QEXP 5HGMA 2M8LA 4U0DA 3G71P 1RNIA 3CCQP 3LRYA 3M1MA 2OARA 1K8AQ 1VQKP 1VQ6P 1YJNP 1M6NA 2BUOA 5F2OA 3DS4A 2EFJA 1VQ9P 3CD6P 1YIJP 3G21A 1YHQP 4PH1A 3CXCO 5BS1A 4U0FA 3DS1A 2M8PA 3VRLC 3CPWO 3NTEA 4U0AA 2PEMA 3DPHA 3HZQA 1W2BO 3H0DA 2QA4P 3OW2O 1QVGO 3CC7P 2Z45A 1RO0A 1PEQA 4GR2A 3H47A 3CMAP 3CCMP 2JYGA 4U0CA 3CMEP 1VQPP 5HGNA 1Q81Q 1M74A 2JYLA 1BAJA 2EIAA 1AUMA 1EIAA 1JJ2O 2Z46A 1YITP 1YI2P 5I4TG 1S72P 3HYBA 1VQLP 2EG5A 1M90Q 2LF4A 5BS2A 1K30A 5JPAA 4PH0A 1VQ7P 5DCKA 2XXMA 3E2DA 4U0BA 2BHVA 4XROA 1YJ9P 1YJWP 1KD1Q 1M6EX 4GR6A 4XFYA 3G1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 Q;  1VQ5 P;  1K9M Q;  3G71 P;  3CCQ P;  3CCM P;  3CMA P;  1KC8 Q;  1VQ4 P;  1K8A Q;  1VQM P;  1VQK P;  1VQP P;  3CCE P;  1YJN P;  1Q81 Q;  3CME P;  1VQ6 P;  3CCJ P;  1VQN P;  1NJI Q;  1VQO P;  1Q7Y Q;  1JJ2 O;  1M1K Q;  3G4S P;  1VQ9 P;  1YIT P;  3CD6 P;  1YI2 P;  1S72 P;  3CC4 P;  1YIJ P;  3CCL P;  2OTL P;  1YHQ P;  3I56 P;  3CCU P;  1VQL P;  1M90 Q;  3CXC O;  2OTJ P;  1KQS O;  1VQ7 P;  3I55 P;  1Q86 Q;  1QVF O;  3CC2 P;  3CCS P;  3G6E P;  1VQ8 P;  3CPW O;  3CCV P;  3CCR P;  1YJ9 P;  1YJW P;  1W2B O;  2QA4 P;  3OW2 O;  1QVG O;  1K73 Q;  1N8R Q;  1KD1 Q;  2QEX P;  3CC7 P; 
#chains in the Genus database with same CATH topology
 3GZM A;  2XV6 A;  3TNU B;  1BCC D;  1KC8 Q;  3A7O A;  1L0N G;  1X8Y A;  3CC4 P;  3G26 A;  2YKO A;  1WRG A;  4WY4 C;  2R3C A;  1CEI A;  2GZI A;  3CWB E;  3G6E P;  3RK3 E;  2ZYA A;  1H8A A;  3H1K D;  1USE A;  4R4L A;  1H88 A;  2XDJ A;  3L72 D;  2JWA A;  2NO8 A;  4BWN A;  2HOD A;  1Q90 D;  2JO0 A;  1NGM B;  3HE5 A;  2WVR A;  4H2Y C;  2DGY A;  3CC2 P;  4H44 B;  4IZ6 A;  2PEI A;  2QEX P;  3LW5 J;  2E74 C;  2KNC B;  1G1J A;  2HFE D;  1GL2 D;  1SQX K;  1K8A Q;  3KZI H;  3SSU A;  2LOL A;  4EDF A;  3DS4 A;  5APY A;  4U7J A;  1AQT A;  4HYT B;  2G3A A;  5AW6 B;  4C7N A;  5AVT B;  4U0A A;  1NTZ J;  1LTJ A;  1W2B O;  2YNY A;  2ZAE B;  2QA4 P;  4XA4 A;  4GIF A;  1NTK D;  3BCC E;  3TYY A;  4I7Z C;  3CMA P;  1NTZ K;  1OMI A;  5GTI H;  1ZR4 A;  7CEI A;  1RHZ B;  1JB0 J;  5B66 H;  1EC5 A;  2E75 B;  4I1L A;  4A7P A;  1NTM D;  3P8M C;  3A2A A;  1FZC B;  1M6E X;  1L0N D;  3L75 D;  1T2K D;  3MGE A;  2PGD A;  1USD A;  2XKM A;  5TIS H;  1S3J A;  1HJ0 A;  2WT7 B;  3BVH A;  4QNB A;  3G9R A;  4KT0 J;  1URQ D;  2A45 I;  1KIL E;  1VQ4 P;  5KKZ B;  1VQN P;  1ZRT E;  1NH4 A;  4IPY A;  2HOD B;  1M1K Q;  5KTB A;  3HE5 B;  1RF1 A;  1GL2 C;  2OYH A;  1SQB E;  2FBW C;  2LL8 A;  1SQP G;  1GTW A;  5L8R J;  4Y28 J;  1FS0 E;  1LTT C;  2IYP A;  3LRY A;  1L4A A;  1ZN5 A;  1BE3 E;  1VQ9 P;  3CD6 P;  2W83 C;  1W2E A;  4U3F J;  4C7N B;  4PJ0 H;  3NMD A;  2N1T D;  4JPZ B;  4LLH A;  1IFP A;  2Q1K A;  1RE4 C;  2QJK C;  5BU8 B;  1VF5 D;  2M5A A;  1BAJ A;  2OQQ A;  2ZXE B;  2Z46 A;  4NEO A;  1YIT P;  1SQQ D;  1FE6 A;  2BAS A;  1H0T A;  1IFJ A;  1T2K C;  4U0B A;  3FWL A;  4N78 E;  2KWL A;  1GD2 E;  3GLM A;  1S2E A;  3BCC J;  3H1I D;  4I2L C;  4BRY A;  1AQ5 A;  4COP A;  4NPD A;  2QRX A;  2VLQ A;  1KYO D;  1URQ C;  2I1K A;  1XTC C;  1JOC A;  3C1L A;  2XZ1 C;  3HD7 D;  4JYC A;  2LXC B;  2N5H A;  2FYN C;  2JWD A;  1JY2 N;  2M5R A;  2NPS D;  1RF1 B;  1PP9 J;  1FJK A;  1YQ4 C;  1N7L A;  1SQP D;  2AXT H;  1RQV A;  2GDW A;  2QIW A;  2KP8 A;  4UB8 E;  1GXG A;  2BCC E;  2GUS A;  1L4A B;  4U0D A;  1NU1 E;  2H88 C;  3H1L E;  1OZH A;  2FVF A;  1KYO H;  2WQY C;  3WMM 0;  2N1T C;  5GTH E;  1VQ6 P;  1IFD A;  1LT9 B;  3QWO C;  4OWF A;  2POH A;  2XNX A;  3P32 A;  3UIA A;  1SQB J;  5KLI B;  1VF5 C;  1RE3 C;  3GHG C;  1L0H A;  2RMZ A;  3CWB G;  1MV8 A;  1FR2 A;  3CC7 P;  3H0D A;  1SS1 A;  2Z45 A;  2JBG A;  1EZV I;  1MFT A;  1PIX A;  3C9I A;  3L35 A;  4DZO A;  1JY3 N;  2M5A B;  2QG4 A;  1BE3 J;  1JJ2 O;  1FJP A;  2LIU A;  2M3B A;  1H0T B;  1FAV A;  2O1J A;  5E79 E;  1IFI A;  2BEQ D;  2HR3 A;  3L70 G;  3PRJ A;  2KGA A;  4YTP C;  3AE6 C;  4BRY B;  1P84 I;  2MKV A;  2DNW A;  1WT6 A;  2QM7 A;  1IFN A;  4N3Y B;  3GZL A;  5AW1 B;  3AEA C;  3HD7 C;  4L75 A;  1KIL A;  1QL1 A;  4OH8 B;  3B5I A;  1E79 H;  3O8Z A;  2JU1 A;  4NPF X;  1PGJ A;  2NPS C;  4RKU J;  4DG9 A;  5KLV K;  4Z1M H;  4WY4 A;  1Q86 Q;  2OYI A;  3SFE C;  1OW6 A;  3L74 E;  1NHL A;  5F2N A;  1X79 B;  2QJP B;  3V2Q A;  1VQO P;  3MHV A;  4IL6 X;  1SFC D;  2AXC A;  3CX5 I;  2AEF A;  1M1J C;  4DT0 A;  1QVF O;  3JC2 2;  4K35 A;  4ZNC A;  4ZMD A;  3AEG C;  1JNM A;  4UB6 E;  2W6B A;  4EOT A;  1VHN A;  4WB4 A;  3RL0 g;  2K9Y A;  2KZI A;  3AE9 C;  2E42 A;  1OX3 A;  2YMK A;  3VRL C;  1YBK A;  2BCC J;  2PEM A;  2ZT9 D;  2FXO A;  3H1L J;  2LXB A;  3HUS A;  5APS A;  3IAO A;  4TT3 H;  1LTB C;  3W68 A;  1IZN B;  3L70 D;  3H1J E;  1QX8 A;  1AVO A;  3M91 A;  2FQ1 A;  5I4T G;  2IZ0 A;  1GU5 A;  1M8O B;  3U1C A;  1PL5 A;  4ASW A;  2KG8 A;  4OVN F;  1EMV A;  1SQB G;  2FFD C;  4F37 A;  2N9B A;  2FVA A;  1HTL C;  4GR6 A;  3E7K A;  2P9X A;  1L0L D;  2QJY C;  1NAF A;  1KIL B;  1VQM P;  1FOS F;  2MVU A;  1BE3 G;  4QKO A;  2IFM A;  3CCL P;  2E5Y A;  1N86 A;  2FYZ A;  4WY4 B;  1NTK K;  2OYI B;  3VP9 A;  1X3O A;  1IMP A;  4N6J A;  3CXH I;  5K5G B;  2FXP A;  2DW3 A;  1VQ8 P;  1EDI A;  1SFC C;  2VRS A;  5AVR B;  3SWY A;  3H1H E;  3DS0 A;  2CGQ A;  2HPC A;  1SQV D;  3P05 A;  1KB9 I;  1ZLL A;  2E76 D;  5AVV B;  3L4F A;  2C9N Y;  1QEX A;  2NZ2 A;  5KAI H;  3IF4 A;  3D70 A;  1TU3 F;  1OR5 A;  2IBZ G;  3Q5R A;  3L74 J;  1K73 Q;  1SQX E;  2E74 B;  3SWK A;  3GJN A;  2KI7 B;  3AE2 C;  1VQK P;  1PZQ A;  1JO5 A;  2YXQ B;  5KP7 B;  4WBA A;  2ZXX A;  2L0Q A;  4XE5 B;  1JY2 O;  3MZW B;  1T3J A;  3HUS B;  3HZQ A;  3USS A;  1J1D C;  1N2D C;  4I7Z B;  3PTZ A;  1VQP P;  1Y8A A;  4Y99 C;  4IFM A;  1OW7 A;  5AW7 B;  2EG5 A;  3P8C E;  2IYO A;  3MTU E;  1P84 E;  2KG6 A;  1YJ9 P;  2H8P D;  3D6Z A;  5KJ7 D;  2IFN A;  1NU1 G;  3H1L G;  3H1J J;  2K0Y A;  1KN7 A;  4DJG A;  1IO4 A;  3JCU E;  1JY3 O;  2Q7C A;  1FZB A;  1S5L X;  2E76 C;  3NXS A;  2H43 A;  5AVY B;  2WSF H;  1K04 A;  1RQU A;  2E43 A;  2K1A A;  1ZV8 A;  2KXP B;  1Z6M A;  4D6T E;  2HPC B;  1SQQ K;  2SPZ A;  1PEO A;  5EW5 E;  5KAF E;  3RL0 D;  3IR9 A;  3DS3 A;  3H1I J;  1QLE D;  2IBZ D;  2AVA A;  2CQ8 A;  2LR2 A;  1T3U A;  1NKZ B;  1IK9 A;  2LKM A;  4N78 D;  1N73 A;  2KOR A;  5CCG D;  1PFI A;  4PV1 D;  2O1K A;  3L71 E;  1GDT A;  3H1H J;  4W7Z A;  2MR8 A;  2WT7 A;  3S4R A;  4L74 A;  5AW9 B;  1A02 F;  2MJZ A;  1FZA A;  5AVX B;  4U3F E;  3DS1 A;  2FYU E;  2MVV A;  1KV4 A;  1SQX J;  2RN0 A;  3B5N A;  1BSH A;  1PEQ A;  2A45 G;  3Q2Y A;  1DH3 A;  3H32 A;  3TGU G;  1QL2 A;  3L73 E;  5KJ7 C;  2EIA A;  1HGZ A;  2GZF A;  2C9L Y;  5CBO A;  4IL6 E;  1YTZ T;  1EDJ A;  1FU1 A;  1NU1 D;  2K0D X;  2ZYD A;  2N9Y B;  5TJH A;  1Q2N A;  1M56 D;  3OAK A;  1UII A;  4GDO A;  2XT1 A;  1AYI A;  1DEB A;  3JSV C;  1N7S D;  3RL0 C;  3SFD C;  1RF0 C;  4WYM A;  5CJ0 A;  1KQG B;  2KZJ A;  1D1D A;  1A43 A;  1KQS O;  4HKG A;  3I55 P;  2Q6Q A;  3M0D A;  5KP6 B;  3CCV P;  1NQ4 A;  3VMA A;  2L6E A;  1KB9 E;  5AVU B;  2R32 A;  4PV1 C;  1ZNV A;  3AEB C;  4UB8 H;  5HV8 A;  3GW6 A;  4L73 A;  1N73 B;  4PD4 D;  4LGD E;  4H44 D;  2V7Q J;  3WU2 H;  1LGH B;  1IMQ A;  1PP9 E;  1HJB A;  3H6P A;  2B9B A;  3KHU A;  2PEJ A;  1NAY A;  3P7K A;  1EOQ A;  1YTZ I;  2K3R A;  3AE7 C;  4D6T J;  5B5E E;  2J5U A;  1X22 A;  2YXR B;  3A3Y B;  5AW3 B;  1LP1 A;  1ACP A;  3M1M A;  1PGP A;  2IX7 C;  3E1I A;  4M3L A;  2FQ2 A;  2WSE J;  3L36 A;  4U0F A;  2ZJS E;  3L71 J;  2JGP A;  3B5N B;  1NYH A;  2JQ4 A;  3TGU D;  1HGV A;  2ZYG A;  1LWU A;  3H32 B;  4TLF A;  5E79 H;  4PD4 H;  2WTY A;  2KR5 A;  5HGN A;  1HWT C;  3V4W A;  1LT9 A;  1FDI A;  1PPJ E;  3BRT B;  1M90 Q;  2D2C B;  2FYU J;  4PH0 A;  2QE7 H;  2I1J A;  1N7S C;  2KS1 A;  5APT A;  3U43 A;  2KGC A;  1KFN A;  3Q3D A;  2FHS C;  1SQX G;  4H2W C;  2FYU K;  5AVQ B;  2IZ1 A;  2KLU A;  1VKU A;  3L73 J;  2V4H A;  2GZJ A;  4BPG A;  5KLV E;  2GUV A;  2Z44 A;  1L0I A;  2A45 H;  2UWJ E;  2NPS B;  5APX A;  1VDF A;  4H44 C;  2PY8 A;  3BRV B;  1NTZ G;  1BGY E;  5CCH A;  3LIE A;  2GZE A;  2AF8 A;  1NJI Q;  2P7J A;  2N6Y A;  3EJD A;  1BDD A;  4UB6 H;  1L0L K;  3G0V A;  3KZI E;  2ROQ A;  1KYO I;  1S9K D;  3O6Q B;  3FXE A;  2KUB A;  5H2F E;  2Y9Y A;  3M9Q A;  1LP1 B;  1KQL A;  2WPR A;  1JY2 P;  3CCQ P;  4EYY Q;  1JCD A;  2GDY A;  3H1K E;  3GF3 A;  5AW5 B;  2K93 A;  3L72 E;  1UIX A;  1NWQ A;  1S5L E;  1SQV K;  1FZC C;  1LWU B;  5GTI E;  4D6T G;  3D6Y A;  1OW8 A;  5B66 E;  5AVS B;  4BPF A;  2JB0 A;  2CNR A;  2GYK A;  2J58 A;  2Z5I A;  1E5W A;  2WSC J;  3HTK B;  1YI2 P;  1RY3 A;  2LF4 A;  2X2B A;  3MUD A;  3L37 A;  5JPA A;  2KS1 B;  1VQ7 P;  3AE1 C;  2JKV A;  3KDP B;  3L71 G;  2QVA A;  3R2P A;  3MD0 A;  5F2K A;  1JM0 A;  1MFZ A;  5KKZ C;  1GW4 A;  2ONT A;  3PLN A;  1NTK E;  1OIP A;  3BAT A;  2KIK A;  1Z56 A;  2PP6 A;  3I56 P;  2H7H A;  4H0L D;  2PFX A;  1NTZ D;  2AEJ A;  4U3F G;  4OGQ D;  3CCR P;  1NTM E;  2ZVO B;  2G8Y A;  2PEN A;  1A8O A;  2KOG A;  4CPG A;  5KLV J;  2AEM A;  3L75 E;  3OJA B;  4XFX A;  3LID A;  3LW5 H;  1JMB A;  3B4S A;  1J1E C;  5AW0 B;  1FDO A;  4B86 A;  1L4A D;  1LTJ C;  1JMM A;  2PEQ A;  2M8N A;  3EWK A;  1DNY A;  1E0H A;  2PEO A;  1L2P A;  2PRR A;  1BGY J;  3AE5 C;  1VL2 A;  1AF8 A;  3BCC G;  1YJN P;  1BCC J;  2O01 N;  1OWA A;  3PH0 A;  3M9B A;  1XTG B;  3CXC O;  2P58 A;  2KW2 A;  3WUU A;  3RK2 B;  4RJT A;  1MZ9 A;  2W6J H;  1MUU A;  3NTE A;  3A0B E;  2WIT A;  1GK4 A;  1HVV A;  1ZP0 C;  3Q5P A;  1NO4 A;  3B71 A;  3H1K J;  1IJD B;  4Y99 B;  1NKN A;  5AVW B;  1GU4 A;  2L91 A;  1EIA A;  3L72 J;  3CWB D;  3VP8 A;  1IC2 A;  3RK3 D;  1PP9 G;  2W27 A;  2FQ0 A;  4GOF A;  5HVC A;  1DIP A;  5KP8 B;  4H0L C;  3IFM A;  1G2C A;  1CZQ A;  2QM8 A;  4EIJ A;  5CJ4 A;  4OGQ C;  3W67 A;  1KZU B;  1RF1 C;  4U3F D;  3A0H E;  4U0E A;  2OYH C;  1HH0 A;  2K0X A;  1SQQ E;  2LIW A;  4ZKU A;  1OXZ A;  1L4A C;  3VYI A;  3EJB A;  2WSE H;  3H4E A;  1NTK J;  3VN0 A;  3H1I E;  1GZL A;  4KJM A;  2O01 J;  2Z5H A;  4H13 D;  2OTL P;  1PPJ G;  2ITA A;  2CWO A;  3EJE A;  2BQ1 E;  5KLI C;  3D71 A;  3HE4 A;  1KYO E;  3BCC D;  1NTM J;  2N98 A;  1AJY A;  5HGM A;  2VLO A;  2QSI A;  2CPB A;  1L0N J;  4RES B;  1NTM K;  3L75 J;  2BUO A;  5KLV G;  1BXI A;  1HY8 A;  1K05 A;  1L0N K;  4PH1 A;  1GL2 A;  4ZKP A;  1SQP E;  2P1J A;  3RK3 C;  5C39 A;  4IL6 H;  4HH2 A;  2KK7 A;  1GXH A;  2Y0D A;  3H47 A;  1PP9 D;  1M57 D;  1Q81 Q;  2R3S A;  2JR8 A;  2ZT9 C;  4BPH A;  1ZOY C;  2M0B A;  2WPS A;  3FXD A;  1SVF A;  1AV1 A;  1T8Z A;  5DCK A;  1R8E A;  1KIL D;  1G2C B;  3TDK A;  2YO3 A;  5EJD A;  1EZV E;  1ZRT D;  1ZMB A;  3T97 A;  2L5G B;  3KXD A;  1RE4 A;  2JAZ A;  3G1G A;  1SQB D;  2HYN A;  3VMX A;  3Q20 A;  3L72 G;  2YKQ A;  2ZVN B;  1EXJ A;  5AW8 B;  1PEU A;  3NTN A;  4H13 C;  3CE7 A;  4I6M C;  3CLQ A;  4KHX A;  2KGE A;  2EHS A;  2BCC G;  3MIW A;  4PV1 B;  1BE3 D;  3H25 A;  2P10 A;  3S1K A;  5B5E H;  1D7M A;  1Y9B A;  2FXM A;  5APV A;  1BSN A;  3HE4 B;  2K2Q A;  1URQ A;  1GPJ A;  3TF5 A;  1SQQ J;  2KOQ A;  3DS5 A;  2JJL A;  2R44 A;  3K5B A;  2N6Z A;  2WPT A;  1LTS C;  2KLV A;  2K9J A;  3G71 P;  2MY5 A;  2KG9 A;  3SWF A;  5F2O A;  3HRN A;  2PAJ A;  1NTK G;  2H89 C;  3CX5 E;  1GL2 B;  3G21 A;  4JF7 A;  2IBZ I;  2P67 A;  1DV5 A;  1PGQ A;  3CPW O;  3VOP A;  5CBN A;  3AEE C;  3OW2 O;  2M3E A;  4GR2 A;  1EXI A;  1KIL C;  5AW4 B;  2GM4 A;  1H89 A;  4AUW A;  2N1T A;  4R0M A;  3L75 G;  4YXW H;  2OYI C;  4EI2 A;  1N7S B;  4JBZ A;  1SQP J;  1RE3 A;  3GHG A;  3L74 G;  4XFY A;  1R5S A;  3T97 B;  5CHX A;  5DJU B;  1SQP K;  2QJK B;  4MRT C;  1X0T A;  3AED C;  3V2N A;  2YIU C;  3ABV C;  3L70 E;  3PHL A;  3CI9 A;  2BCC D;  3AE4 C;  3H1L D;  1CI6 A;  1FBM A;  1PEM A;  5KAI E;  4COC A;  2XND H;  5H2F H;  5AVZ B;  3HD7 A;  1L0L E;  1URQ B;  4HJG H;  2ERH A;  2C0X A;  3CXH E;  2NPS A;  2E5T A;  3KPE A;  2K9J B;  3HUS C;  1PGO A;  5CCG C;  2OYO A;  1S5L H;  1OVU A;  2FYN B;  2KSE A;  3V2R A;  1M6N A;  3TSI A;  1SQV E;  3H1J G;  1ZXG A;  2Y9Z A;  5BS1 A;  5GTH H;  4PD4 I;  2M8P A;  2A06 E;  4C7R A;  1SQQ G;  1ZW0 A;  1GW3 A;  1M1J A;  3EQ2 A;  3DPH A;  4UHP B;  3O6Q A;  1RO0 A;  5AW2 B;  1FZE A;  3V6I A;  2VSQ A;  3CCM P;  3KQG A;  2N1T B;  1LNQ A;  1IK7 A;  3R4Y A;  2JYL A;  1A02 J;  2JDI H;  4L76 A;  3H1I G;  2CK3 H;  3IN6 A;  3L74 D;  1VQL P;  2XZ0 D;  1K30 A;  1JTH A;  1VF5 B;  3GHG B;  4JQ0 D;  2AFD A;  1KQF B;  2O01 H;  4ASV A;  4C46 A;  3E1R A;  3H1H G;  4CA3 A;  2K94 A;  4K3A A;  2E75 D;  2ZFC A;  3CCJ P;  4R4M A;  4WVZ A;  1Q7Y Q;  2JO1 A;  2W8Z A;  1JUN A;  3DS2 A;  2MR7 A;  2LKI A;  1AVY A;  3HTK A;  4H2X C;  1T8K A;  3CWB J;  3PP5 A;  1CI6 B;  3M06 A;  2FFD A;  2FKW B;  2K92 A;  1IUQ A;  2QNW A;  1S1C X;  1OVV A;  1CSB A;  3HD7 B;  2XU6 A;  1EQ7 A;  2KOD A;  3L70 J;  1J1E B;  3CCU P;  4GOE A;  5M1B A;  3WUV A;  3CL3 D;  3LMO A;  1LT1 A;  1LTJ B;  2R5B A;  1CW5 A;  4PXH B;  4M0I A;  2IPP A;  2FVE A;  1N8R Q;  3NFQ A;  1SFC A;  1DX7 A;  3H1J D;  1EZV G;  3RBX A;  2KYV A;  3EFG A;  1L0L J;  3A0B H;  2B88 A;  2EFJ A;  2B89 A;  3B5N D;  1G1I A;  1BCC E;  3VMZ A;  1T6A A;  2JP3 A;  3RBZ A;  2IBZ E;  3MGN A;  1M1J B;  1F80 D;  5APQ A;  2OGU A;  2LTE A;  3MP7 B;  1HBW A;  2WWW A;  2JYG A;  3Q1M A;  4AQR D;  1S4X A;  2D2C D;  1SQV J;  3GF7 A;  3N4X A;  3B4Q A;  1JTH B;  3HYB A;  5CMZ A;  3VTP C;  4JYB A;  1NOH A;  2E75 C;  1EDL A;  2W6A A;  3H1H D;  1AFO A;  3E2D A;  2VLP A;  3A0H H;  1HQB A;  4YXD C;  1U7J A;  1YJW P;  4H0L B;  2BEZ F;  2HLO A;  3G1I A;  1VQ5 P;  4OGQ B;  3RG6 C;  4LC1 A;  3G29 A;  3PJS K;  3FX0 A;  3C8V A;  2OYH B;  1N73 C;  3OA7 A;  4IFD K;  1J2J B;  2M8R A;  2YMY A;  3QH9 A;  1SQX D;  2FFD B;  3II6 A;  4XRQ A;  1AA0 A;  4HKZ H;  2Z4E A;  4XFJ A;  4IFF A;  3M0A A;  3WU2 E;  1K9M Q;  3DTJ A;  2KGD A;  1JY3 P;  2QJY B;  3V4Q A;  5TIS E;  3M9H A;  2WSF J;  3AE8 C;  2KOS A;  1WMK A;  1FDM A;  2WPV B;  1PV3 A;  1MZ8 A;  4BXL A;  2Q9I A;  4MN4 C;  3WBH A;  1ZR2 A;  1EZV D;  3B5N C;  1JEK A;  2FYU G;  5HGO A;  1SFC B;  1SQB K;  4PWV B;  1OFC X;  1KFM A;  2M8L A;  4O9B A;  3RG2 A;  1KLP A;  5BVZ A;  1L0N E;  3L73 G;  3P8C D;  2MF4 A;  5APU A;  3TK1 A;  1YIJ P;  2YO2 A;  1P84 D;  2D2C C;  4PD4 E;  3ITK A;  2WSS H;  3RK3 B;  1QVG O;  4W80 A;  2FAC A;  4HB1 A;  1UJZ A;  4U0C A;  1M7L A;  2C0W A;  4PJ0 E;  3GG2 A;  2XV5 A;  2ZT9 B;  2P2U A;  4AYC A;  3ZDM A;  1L0L G;  2EHT A;  3F5H A;  4GT1 A;  2O3J A;  2GDX A;  4D6T D;  3M0D C;  2CPS A;  2L9F A;  2IDB A;  2WZ7 A;  3EFF K;  4XRO A;  1GMJ A;  3FWN A;  3VMY A;  4WWI A;  1J1D B;  3G28 A;  1HUC A;  3RGU A;  3TGU E;  3CX5 D;  1QRJ A;  2VLN A;  1SP4 A;  1P84 H;  3BAS A;  2HG5 D;  1SQV G;  1JCC A;  5KJ7 A;  4GKG A;  3L71 D;  3N7N A;  4DCK A;  5CCH D;  1X9V A;  4H13 B;  2B87 A;  5HGL A;  1LJ2 A;  2A06 G;  2R5D A;  1NVO A;  3JCU H;  1E6J P;  2V7Q H;  1R5L A;  1RO2 A;  1YYC A;  1FOS E;  1KMI Z;  1Y47 A;  2FYU D;  3U59 A;  2L22 A;  2W90 A;  1DD3 A;  2E76 B;  1DD4 A;  5KAF H;  1RF0 A;  3GKL C;  2Y0E A;  1RH5 B;  4XFZ A;  2RKL A;  1LWU C;  2KSJ A;  4YPC A;  3AEC C;  3CX5 H;  1FC2 C;  1NU1 J;  3L73 D;  1FZG A;  3Q5S A;  5CCG A;  1RNI A;  3I5C A;  2AXT E;  1LT9 C;  1NU1 K;  3RK2 D;  2JEE A;  1QGK B;  1U7M A;  1KTM A;  1HF9 A;  3NY7 B;  3V5B A;  4QMA A;  5CZD B;  2FAD A;  3S9O A;  2OTK E;  4IOI H;  2LML A;  1S9K E;  3CME P;  1LTI C;  1LTG C;  1AUM A;  3CXH D;  1S72 P;  2CG5 B;  2GA1 A;  2WPQ A;  2K37 A;  3B8E B;  2Y0C A;  2K5X A;  1EDK A;  1KB9 D;  1BDC A;  1OVR A;  2K88 A;  5CCH C;  3KYQ A;  1FZF A;  1Q82 Q;  1YQ3 C;  3G3Z A;  4NPE A;  2Q3E A;  3A5T A;  1BGY G;  3TNU A;  3V2P A;  2N5I A;  2YIU B;  2A06 D;  2E1M A;  2KOO A;  1U57 A;  1BCC G;  3GMA A;  2B87 B;  5BU5 A;  2RH0 A;  1DEE G;  1N7S A;  1W5C E;  2OTJ P;  3WUT A;  3F89 A;  3TGU J;  1KOR A;  3CXH H;  3CCE P;  4WY4 D;  2MD9 A;  2YKP A;  2QJP C;  3G4S P;  3H1K G;  3RL0 B;  1SLQ A;  2Q3I A;  1KB9 H;  2NRG A;  2N50 A;  2PEK A;  3RK2 C;  3CCS P;  2JU2 A;  2LPK A;  1LTA C;  2PNG A;  1NTZ E;  2L4B A;  2J59 M;  1ZME C;  1GK6 A;  2OAR A;  1PPJ D;  2KB7 P;  2KNC A;  1IFM A;  4GOD A;  1UNK A;  2FAE A;  1MKM A;  3MUD C;  2XZR A;  1YHQ P;  3FGA D;  3AEF C;  2E74 D;  4DOJ A;  2WSC H;  2FY8 A;  5APW A;  1VPC A;  5KLV D;  2AFE A;  1M74 A;  3U1A A;  4RO0 A;  2Q5U A;  2KOP A;  5BS2 A;  2WMM A;  4W7Y A;  5DJT B;  3AE3 C;  2GZG A;  2XXM A;  2I8D A;  1BGY D;  2BHV A;  1KD1 Q;  1FZC A;  5EFW B;  1NTM G; 
#chains in the Genus database with same CATH homology
 3G28 A;  5F2K A;  1Q82 Q;  2XV6 A;  1VQ5 P;  3RG6 C;  2P9X A;  1KC8 Q;  1QRJ A;  1ZMB A;  2XT1 A;  3G29 A;  4COP A;  1VQM P;  2ONT A;  3MGE A;  3CCJ P;  1Q7Y Q;  3G1G A;  4U0E A;  3B5I A;  2E1M A;  2Z44 A;  3CC4 P;  3G26 A;  3CCL P;  3DS2 A;  4WYM A;  3I56 P;  3Q20 A;  1D1D A;  1A43 A;  1KQS O;  1PEU A;  3I55 P;  1Q86 Q;  5HGL A;  4XRQ A;  2PY8 A;  3G6E P;  1VQ8 P;  3CCV P;  4QNB A;  3CCR P;  2L6E A;  1E6J P;  2OTJ P;  3DS0 A;  1IUQ A;  5F2N A;  2PEN A;  1PEM A;  1PEO A;  1K9M Q;  1A8O A;  3DTJ A;  3P05 A;  3DS3 A;  4COC A;  3H4E A;  1VQ4 P;  3CCE P;  1RO2 A;  1VQN P;  1NJI Q;  1VQO P;  4IPY A;  4XFX A;  1M1K Q;  3G4S P;  2KOD A;  2OTL P;  2JO0 A;  3CCU P;  2CWO A;  3WBH A;  2BQ1 E;  2PEK A;  3DS5 A;  3G0V A;  2DGY A;  2PEJ A;  4XFZ A;  1QVF O;  2PEQ A;  4M0I A;  1EOQ A;  3CC2 P;  3CCS P;  2M8N A;  5HGO A;  1K73 Q;  2PEO A;  2PEI A;  1N8R Q;  2QEX P;  5HGM A;  2M8L A;  4U0D A;  3G71 P;  1RNI A;  3CCQ P;  3LRY A;  3M1M A;  2OAR A;  1K8A Q;  1VQK P;  1VQ6 P;  1YJN P;  1M6N A;  2BUO A;  5F2O A;  3DS4 A;  2EFJ A;  1VQ9 P;  3CD6 P;  1YIJ P;  3G21 A;  1YHQ P;  4PH1 A;  3CXC O;  5BS1 A;  4U0F A;  3DS1 A;  2M8P A;  3VRL C;  3CPW O;  3NTE A;  4U0A A;  2PEM A;  3DPH A;  3HZQ A;  1W2B O;  3H0D A;  2QA4 P;  3OW2 O;  1QVG O;  3CC7 P;  2Z45 A;  1RO0 A;  1PEQ A;  4GR2 A;  3H47 A;  3CMA P;  3CCM P;  2JYG A;  4U0C A;  3CME P;  1VQP P;  5HGN A;  1Q81 Q;  1M74 A;  2JYL A;  1BAJ A;  2EIA A;  1AUM A;  1EIA A;  1JJ2 O;  2Z46 A;  1YIT P;  1YI2 P;  5I4T G;  1S72 P;  3HYB A;  1VQL P;  2EG5 A;  1M90 Q;  2LF4 A;  5BS2 A;  1K30 A;  5JPA A;  4PH0 A;  1VQ7 P;  5DCK A;  2XXM A;  3E2D A;  4U0B A;  2BHV A;  4XRO A;  1YJ9 P;  1YJW P;  1KD1 Q;  1M6E X;  4GR6 A;  4XFY A;  3G1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...