1Q86Q

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q86Q03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q86Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q86Q02
3CMAP 1K8AQ 1M90Q 3CD6P 3CPWO 3G71P 3CCQP 1M1KQ 1VQ5P 1Q81Q 1YI2P 1N8RQ 1VQ6P 1VQ8P 3CCRP 1Q7YQ 3I56P 1VQPP 3CCLP 3CC7P 1KC8Q 3CCMP 3CMEP 1JJ2O 3CC4P 1VQNP 1Q86Q 3G6EP 3CCSP 1W2BO 1NJIQ 1YIJP 1VQLP 1QVFO 3CXCO 3I55P 1QVGO 1YJWP 1VQ9P 3CC2P 1K9MQ 3CCVP 1Q82Q 1KQSO 1VQ4P 2QA4P 1VQ7P 1K73Q 3OW2O 1YJNP 2OTLP 3CCEP 1VQOP 2OTJP 1YITP 3G4SP 3CCJP 1YJ9P 1VQMP 1S72P 1VQKP 3CCUP 2QEXP 1YHQP 1KD1Q
chains in the Genus database with same CATH superfamily
3ZDMA 1L4AA 3G29A 1U7JA 2K1AA 3M9HA 1NU1G 2K9YA 3C8VA 1VQ9P 5HVCA 1RE4A 2J58A 2RH0A 1EOQA 3IAOA 2Y0EA 2ZYGA 1ZP0C 4M3LA 4Y28J 3NXSA 1RY3A 1VHNA 2XV6A 3NMDA 2H89C 1AVYA 1AQTA 3JCUE 2E74C 1R8EA 1KZUB 1SQQE 3M9QA 1M8OB 3TYYA 1N7SA 3L74J 1A43A 3F89A 2QA4P 1OXZA 5AW9B 4BRYB 2ZXXA 1PGQA 1ZLLA 2QE7H 2N1TA 3B4SA 3H32B 3G1GA 2N1TD 1PL5A 3CCRP 3H1IG 3D6YA 1RQUA 1ZRTD 3L73J 2PNGA 3KZIH 3QWOC 1IMQA 4WY4C 3B5NA 1MZ9A 1KN7A 1ZR2A 1SQBD 2ZXEB 2FYNC 1PPJG 2HG5D 1ZMBA 2K92A 3HYBA 3RK3B 3PLNA 3TF5A 1OFCX 2YKPA 3AEBC 2PAJA 2L22A 5CCGC 1KQLA 1M6NA 1SQBG 4C7RA 2AFEA 3TNUB 1L0NJ 4I2LC 1PZQA 3N4XA 4GT1A 4D6TJ 4MRTC 2ERHA 1FZAA 2W83C 3P32A 3V2RA 1S9KE 1KFMA 1MZ8A 2Z45A 3G1IA 2C0XA 4UB8E 5AW2B 3FGAD 1D1DA 2OYIB 1OVRA 1VKUA 1S5LE 3L72J 2JO0A 3HE5B 3JC22 1BE3J 4RKUJ 2CPSA 1M74A 4BPGA 5KLVJ 1IO4A 1VQPP 2P7JA 2KS1B 1KLPA 1NKNA 2BEQD 1KILE 3R4YA 1J1EB 2Z4EA 3SFDC 3O8ZA 2AXTH 5CCGA 3U59A 3G21A 1HGVA 4ZKUA 2HPCB 4UB6H 1Z6MA 4WYMA 5AW6B 2N9YB 2XU6A 1GL2C 4H2XC 1NJIQ 2WT7B 2FVAA 3VMAA 3L71D 5TJHA 1YQ4C 4IFMA 1SQXE 2ZAEB 3L37A 2D2CD 1QX8A 1SQVJ 2KOGA 1ZW0A 2GA1A 5AW8B 2KW2A 3CWBE 1T8ZA 1PP9D 1HF9A 1QVFO 2KORA 3L70E 3MHVA 3D70A 4PV1D 2EG5A 1PEMA 4I7ZB 2QJKC 2QEXP 3O6QB 3L75E 1QLED 3V2PA 1M56D 1Q81Q 1G1IA 1P84D 2RN0A 3ITKA 1RF1B 1NH4A 5APSA 2R44A 3HD7C 4JF7A 1GL2A 1S5LX 1L0LK 3H6PA 1HWTC 3G71P 3U1CA 2K93A 5BS1A 1JMMA 4EYYQ 3UIAA 2K0YA 3VMZA 4ZKPA 2O01N 1LP1A 3L73D 5AVUB 3EJEA 2K9JB 1GW3A 2QG4A 3GHGB 3MIWA 5GTHH 3LW5H 1NTMK 4Z1MH 2C0WA 3S1KA 1EC5A 1RO0A 2CWOA 1IFMA 4NPFX 2Q3EA 3NFQA 1VQNP 4U0AA 3CX5E 2P58A 1HBWA 4U0EA 4KJMA 1HJ0A 1EDIA 3H1JE 1JOCA 1R5LA 3T97B 3Q5RA 1UJZA 2M5AA 2FFDB 1YYCA 2Y0CA 2Q6QA 2KSEA 1LTTC 2AFDA 3I56P 2LKIA 2M8NA 1FZBA 5HGMA 4PH0A 4N78E 3RK2B 5TISH 3HE4A 1NKZB 1VF5C 2WPTA 2KLUA 5AW1B 4H13B 4H13D 1JY3P 5AVRB 1OR5A 3LIDA 1SQPJ 1CZQA 1J2JB 4C7NB 3V6IA 1GU5A 1URQD 4GOFA 3H1LJ 3TGUJ 2KNCA 1BE3D 2IZ0A 5B66H 4IFDK 2WPQA 3RG2A 1VQ7P 1T3UA 3AEAC 3KXDA 3LW5J 3G9RA 3AE6C 2YMYA 1GD2E 2O01H 2IBZG 5E79H 5B5EH 2IFMA 3CMAP 4H44C 2KGAA 3CXHD 2K94A 2PGDA 3L36A 3BCCG 1YJWP 1NU1J 1K9MQ 1VQ4P 2LXBA 4DT0A 2E42A 2LMLA 2OYHB 2GZFA 1NYHA 2M3EA 2YMKA 3SFEC 2KOPA 1SQVD 4R4LA 2R5DA 1EDLA 1NTZD 4U0FA 1EZVE 4L74A 2IFNA 2E75B 1JTHA 5HGLA 2E5TA 4TLFA 1IFPA 3A7OA 1NTZG 4OGQC 1OZHA 2W8ZA 1IMPA 3P8CD 1DV5A 2KR5A 1AF8A 4PXHB 3H1IJ 2JAZA 1RH5B 3M0AA 3RG6C 2O01J 5KLVE 2YKOA 3DTJA 2MVVA 4U7JA 2PFXA 2WMMA 1LJ2A 1HUCA 4H2WC 5APQA 2Y9YA 4B86A 2K3RA 2P1JA 2KOQA 1N8RQ 1NOHA 3KHUA 3VOPA 2YIUB 3Q20A 1USEA 1OW6A 4PH1A 1YIJP 2WPSA 1KB9I 1SQBJ 3JSVC 3AE8C 1FE6A 3A0HH 3WU2H 4AYCA 1IC2A 2MF4A 2C9LY 4YXWH 4K3AA 1L0IA 3BRTB 3RBZA 1G2CB 3WBHA 3SWYA 1VQLP 1DEBA 2GZJA 3BATA 2PP6A 5CJ0A 2N6ZA 2CQ8A 4H0LC 2FYUG 1LTGC 2AXCA 1T8KA 1PEQA 3HUSB 3CL3D 3V2QA 5KAIH 3CCMP 3CI9A 1FJKA 2HR3A 3CXCO 3PP5A 2ROQA 1KQSO 1BDDA 1VDFA 1H88A 2IZ1A 1L0LE 2W90A 2AXTE 2HODA 4DZOA 4U3FE 1JCCA 2A06E 1LNQA 2OYOA 3A3YB 1M90Q 1HTLC 3MTUE 4UB6E 3II6A 3H1HE 2E5YA 3MP7B 1SVFA 2YKQA 3AE1C 1P84H 2XV5A 3USSA 5EJDA 2HLOA 4GOEA 2KLVA 4XFZA 2KYVA 1W5CE 2GZIA 2JGPA 3OAKA 1NTME 5AVZB 1U7MA 1MFZA 2RMZA 1SQQD 3AEFC 2N1TC 3NTNA 3CC7P 2EHSA 2YXRB 2JWDA 3L71J 1GPJA 3WMM0 2VLPA 1K73Q 1SQQG 2WSSH 4WWIA 2XT1A 1EZVI 3F5HA 2PENA 3RK3C 2BASA 1PP9J 3BVHA 3AEDC 3U1AA 5DJUB 4GKGA 2VRSA 2NRGA 3CCEP 2ZT9B 2KP8A 1ZR4A 1YBKA 2N98A 3P05A 1ZN5A 2ZYDA 3DS0A 2N50A 2PEQA 5CHXA 5APTA 2AEJA 3TSIA 5KLIB 3Q2YA 1SQPE 4BRYA 4I1LA 3H1ID 2XZ0D 3H1LE 2LF4A 3TGUE 1HH0A 2KUBA 3GJNA 3H32A 4PD4D 2KZJA 1AFOA 3NY7B 3CXHI 3G0VA 2KI7B 2PEOA 2E1MA 1LTJB 3V4QA 2GUVA 5GTHE 3OJAB 1NTKD 4OWFA 1PPJD 3DS5A 2YO2A 2H43A 1E0HA 4XRQA 2X2BA 2QJPB 2JYGA 1BGYE 1QVGO 3L4FA 1X79B 3W67A 1J1EC 1N86A 1H0TB 1YJ9P 1NTKG 2E43A 2B9BA 2FQ1A 1PGOA 1NU1E 3N7NA 2I1KA 3RK3D 1GXGA 1KILD 1KILB 5CMZA 4IZ6A 2XDJA 2FYZA 1DD3A 1KORA 3TNUA 3CXHH 1LT9B 1AV1A 2PEKA 2RKLA 1E6JP 1LT1A 1FDIA 5TISE 2LL8A 2XNDH 1JNMA 2OYIA 2D2CC 1IFJA 1L0NK 4AQRD 2W27A 1QL1A 3HE5A 1Q86Q 1SQXD 1CI6B 2BEZF 1MUUA 2J59M 2M8PA 5KP8B 1FC2C 4PV1C 2WVRA 2K5XA 2W6BA 4I7ZC 3CWBD 2FKWB 2KS1A 2KGEA 1K8AQ 2E74B 5E79E 1SQXG 3EJDA 5HGNA 1Y9BA 5GTIH 2GDWA 1KYOD 1M1JC 3BCCJ 2PRRA 2HPCA 2IPPA 5CZDB 3CWBG 1RF1C 5KLVK 3L70G 2BUOA 1E79H 1KD1Q 4DJGA 4CA3A 3GF7A 2WT7A 4WY4B 1WMKA 1G1JA 5H2FE 1BXIA 1SFCB 1SFCD 1MFTA 3L75G 2W6JH 1BCCD 3MUDA 3GG2A 2QJYC 2KB7P 3GHGC 1JY2N 3HTKB 1N73B 3B4QA 1R5SA 2C9NY 2ZFCA 1IJDB 1GXHA 1NTZJ 3AE9C 1YI2P 1BCCG 2KG8A 2P9XA 2G8YA 2V7QH 2JO1A 2ZVOB 5BU8B 1CW5A 2PEJA 3OW2O 1M57D 2OTJP 2XZ1C 1SQVK 1DEEG 2CG5B 1QL2A 4U0DA 1M1JA 3CPWO 3CX5D 4HKGA 2KGDA 4R0MA 2FFDC 1RF1A 4COCA 1LWUB 3L35A 4C46A 1PV3A 1WRGA 4H13C 2AEFA 1ZXGA 2MR8A 1DNYA 2KWLA 1FR2A 3Q1MA 3CCUP 1X9VA 3H1JG 3WU2E 1URQC 4WVZA 2LKMA 2QM7A 2K9JA 2XKMA 2P10A 3GHGA 1W2EA 4WBAA 3B8EB 5JPAA 1RNIA 1OW7A 5AVQB 2LXCB 2R3CA 3L71E 2FHSC 2M3BA 2FVFA 1L2PA 2OGUA 2FYUJ 2JKVA 1KB9E 2GZEA 2O1JA 2V7QJ 2IDBA 2K0DX 3BRVB 5APYA 3H47A 2CNRA 3T97A 2MKVA 5KAIE 2BHVA 2MR7A 3H25A 1OMIA 1PP9E 4TT3H 2FFDA 1S72P 2OYHC 2LTEA 3CD6P 2IYOA 4F37A 3AE2C 2XZRA 3RK2D 4PD4I 2FBWC 1EMVA 2L0QA 4C7NA 1PFIA 1RF0C 4Y99C 2JP3A 4U0CA 1URQA 2KXPB 2E75C 1BDCA 2EIAA 1VQMP 3RL0B 3RL0D 1FOSE 1VQ6P 2A45G 4BPFA 2R32A 3L74E 3DS4A 1BAJA 2H88C 3GMAA 4GIFA 1VQ5P 2IBZD 3VP8A 5AW4B 2JWAA 3G6EP 3CCSP 3HD7B 4LLHA 1A02F 1SQPK 1H8AA 5HV8A 5EFWB 3BCCD 4PD4H 3L73E 1SQQJ 3HRNA 1L0HA 2BCCD 3C9IA 2WZ7A 3CMEP 3RL0g 1NGMB 4XA4A 3AEGC 1D7MA 2OYHA 2Q7CA 1NAFA 2OTLP 1XTCC 3EFGA 1RQVA 2MVUA 2BCCG 2YXQB 1NHLA 1L0NE 1RF0A 1JM0A 4D6TE 3DS3A 1N2DC 4CPGA 1NU1K 2IYPA 3MGEA 4QKOA 2Q3IA 1NO4A 2E75D 1FBMA 3EFFK 3LIEA 3PJSK 2B87B 1H89A 3CE7A 4L73A 3VYIA 3L72E 2WTYA 1DX7A 1F80D 3HUSC 1IK7A 1KYOI 1IFNA 3H4EA 3G3ZA 1FZFA 1IZNB 3FXEA 3Q5PA 1BE3E 1GU4A 3KZIE 2M8LA 1T6AA 3P8MC 2CGQA 1GMJA 4HH2A 1NAYA 5L8RJ 1JTHB 2PEMA 3BASA 2HYNA 3K5BA 1NTKJ 4OH8B 3A2AA 3CCQP 4M0IA 3B5IA 1T3JA 3CXHE 4U3FD 2Y0DA 1HGZA 1KYOH 2KODA 2GZGA 3H1HD 1UNKA 3H1KD 1G2CA 1Y8AA 1L0LG 4U3FG 3KPEA 5F2NA 2FYUD 1SQBK 4NPDA 1W2BO 4IL6H 1NTMD 3DS1A 3CC2P 4GR2A 1SQVE 2WWWA 3H1HG 5KKZC 5BS2A 3FX0A 3H1KG 1LTBC 2LPKA 2OQQA 3HUSA 5CCHA 2PY8A 4KT0J 2V4HA 3GKLC 2GDXA 2NO8A 1MV8A 3WUVA 1JUNA 3M1MA 5CCHD 1P84I 1K04A 1NTMG 1BSHA 1SQXJ 4NEOA 1KC8Q 2OTKE 3GW6A 1J1DB 2JU1A 4HB1A 2O1KA 2NPSD 2NPSB 2WPRA 3MGNA 2OARA 1FU1A 2KZIA 3CWBJ 5KJ7D 2LIWA 4OGQB 3B71A 5KP6B 5F2KA 3CX5H 4PJ0H 2O3JA 5KLIC 2KK7A 3SWKA 4DOJA 1T2KD 1QRJA 2DGYA 2B89A 1KQGB 3E2DA 3VMXA 4DG9A 3FWNA 5KTBA 1ZMEC 2B88A 3IF4A 4BWNA 1RO2A 1FZCB 1E5WA 1JY2O 5KP7B 1LTJC 2GM4A 2N9BA 1BCCJ 3KDPB 1SQPG 1VL2A 5AVTB 2E76B 2E76D 1K05A 3CCJP 5AW0B 2Q9IA 3TGUG 4I6MC 1BGYD 1KILC 5DJTB 3CCLP 1LTAC 5AVYB 4DCKA 4LGDE 2LOLA 1YTZI 2BQ1E 2ZT9D 4QNBA 1BGYG 1AA0A 2IX7C 1EDKA 3AECC 4EDFA 2IBZI 4ASWA 1KFNA 3H1JJ 1VQ8P 1EXJA 1DD4A 5EW5E 1L4AB 1L4AD 2A45H 1GTWA 2FADA 1X3OA 2OYIC 2QIWA 1S9KD 1LTJA 4PWVB 4HJGH 5KAFH 4IFFA 1GDTA 1FZEA 3H0DA 4W7ZA 4YPCA 7CEIA 1H0TA 2MJZA 3PRJA 5CBNA 4BXLA 4MN4C 4IPYA 2FQ2A 3AEEC 3V5BA 3PH0A 2GDYA 5AW7B 1N7SB 1N7SD 1KILA 3W68A 4GODA 4IOIH 4AUWA 1LTSC 5AVWB 1LT9A 3C1LA 2N1TB 4XFYA 2JDIH 3WUUA 4W80A 3E1RA 5AVSB 2N5HA 1A8OA 2KSJA 1SFCC 2AF8A 3AE7C 2QSIA 2QNWA 3V2NA 1HQBA 1UIIA 3B5ND 3B5NB 2FXMA 2P67A 4QMAA 3KYQA 4U0BA 2ONTA 2L91A 3MUDC 1JB0J 1N73C 2K0XA 1CI6A 5CBOA 5HGOA 2KIKA 3WUTA 2Z5HA 1FS0E 1S1CX 2FY8A 5B66E 1A02J 1VQOP 1YITP 2K37A 3CLQA 3H1IE 2I1JA 5F2OA 1YHQP 4OVNF 4PD4E 5APVA 2Q1KA 2E74D 5B5EE 3L70D 1JY3N 1IK9A 1AQ5A 4KHXA 3S9OA 2KG6A 3DS2A 1NTKE 1NWQA 1LWUC 1PPJE 1KMIZ 1ZRTE 3E1IA 1FDMA 1LGHB 1EIAA 4LC1A 2JQ4A 3L75D 1GK6A 1Q90D 1VQKP 2BCCJ 4WY4A 3AE3C 2ITAA 1SQBE 1SFCA 3G28A 1RE3C 4WY4D 3RK3E 2KG9A 3A0BH 3Q5SA 3HTKA 1N73A 2FYNB 2Z44A 3FXDA 2EFJA 5DCKA 2YNYA 2VLOA 2FXOA 3SWFA 2M5RA 5CCGD 2M8RA 1Q7YQ 2L6EA 3TDKA 4HYTB 2UWJE 3ABVC 4ZNCA 4ZMDA 1EDJA 1TU3F 1KB9D 1GK4A 1X8YA 1FZGA 3O6QA 2N5IA 2D2CB 2JU2A 1NTZK 1ZV8A 4COPA 1LWUA 4YTPC 4XFXA 3L71G 5APWA 1DH3A 5AW5B 5BVZA 3H1JD 3RK2C 4UHPB 4PV1B 3GLMA 1RE3A 1KYOE 1KTMA 1WT6A 3RBXA 1PEUA 1PP9G 3RL0C 3A0HE 4N78D 1M1KQ 1OVVA 1L0LJ 2WQYC 1HVVA 1SS1A 1M1JB 4U3FJ 1RHZB 3GZMA 1X0TA 5AW3B 2H7HA 1AUMA 4IL6E 3H1HJ 3L74D 2QM8A 2XNXA 3H1KJ 1PEOA 4W7YA 3QH9A 1ZOYC 1BCCE 2SPZA 3JCUH 2K2QA 2JR8A 3U43A 1KQFB 3P7KA 1GL2B 1GL2D 2WSFH 1FOSF 1Y47A 1NTMJ 3KQGA 4H2YC 1JJ2O 1S2EA 3L74G 2QJYB 1OX3A 4BPHA 2DW3A 2FAEA 3GF3A 3S4RA 3TK1A 1LP1B 2FYUK 1S3JA 5C39A 3MZWB 2MD9A 1OIPA 2Z5IA 2CK3H 1CEIA 3L73G 2ZYAA 3Q3DA 1YTZT 3RGUA 4PJ0E 3V4WA 3I55P 1GW4A 1P84E 2QJKB 1L0ND 2PEIA 1JMBA 1JCDA 2JEEA 5I4TG 4D6TD 3EQ2A 4EIJA 1SP4A 2HFED 1EZVD 3HZQA 1ZNVA 1OVUA 3HD7A 3PTZA 2M5AB 3M9BA 1AJYA 1L0NG 5AVXB 3HD7D 4JQ0D 4D6TG 3L72D 1YJNP 3HE4B 2R3SA 1EZVG 2WSFJ 1LTIC 4UB8H 1URQB 4EOTA 1S5LH 1JEKA 5KLVD 3IFMA 3L72G 1VPCA 3AE5C 3VTPC 2DNWA 2KNCB 2YIUC 3SSUA 1UIXA 1Z56A 4XROA 4ASVA 2KOOA 1SQQK 3D6ZA 5AVVB 1IUQA 1S4XA 3R2PA 1KV4A 1BE3G 1BGYJ 5KLVG 3I5CA 3LRYA 4K35A 4IL6X 2JB0A 1JY2P 5CJ4A 3EJBA 2GUSA 2QVAA 2WSCH 2G3AA 3DPHA 2W6AA 2B87A 2L5GB 3E7KA 4N6JA 1QEXA 1FJPA 1M6EX 2JYLA 2Q5UA 4L75A 5KAFE 1DIPA 5H2FH 4RO0A 1USDA 5CCHC 2L9FA 4WB4A 2XXMA 1VF5D 1VF5B 2VLQA 1AVOA 4Y99B 2Y9ZA 2IBZE 1N7LA 3M06A 1J1DC 2K88A 2KOSA 2NPSC 1SQVG 2VLNA 5KJ7C 1IFDA 2H8PD 2LR2A 2JJLA 3BCCE 2J5UA 2YO3A 2FVEA 3M91A 4RESB 1K30A 2BCCE 1L0LD 3GZLA 3PHLA 1T2KC 2A06D 3M0DC 5M1BA 4NPEA 4N3YB 1NTKK 3IR9A 4R4MA 1NVOA 1PIXA 2FQ0A 4H44B 4H44D 2WPVB 2WSCJ 1FZCC 1CSBA 2VSQA 1PGPA 4XE5B 2A06G 3IN6A 2P2UA 3VN0A 2MY5A 4O9BA 1HY8A 3CCVP 1NTZE 5BU5A 4JPZB 3D71A 3VMYA 2E76C 3CX5I 4HKZH 2GYKA 2ZVNB 2I8DA 3A5TA 1SLQA 2WSEH 1Q2NA 2NPSA 4GDOA 1JY3O 2LIUA 3MD0A 5APUA 5KJ7A 1FAVA 3P8CE 5GTIE 3AE4C 5K5GB 4JYCA 1KB9H 1GZLA 2KGCA 2ZT9C 4OGQD 1SQXK 3L70J 4YXDC 1PGJA 3M0DA 4EI2A 4L76A 3NTEA 2EHTA 3G26A 1XTGB 3EWKA 1L4AC 1X22A 4XFJA 3LMOA 1Q82Q 1FZCA 3L75J 2N6YA 4JYBA 1AYIA 2QRXA 2ZJSE 3A0BE 1EXIA 1ACPA 1IFIA 1U57A 1SQPD 1RE4C 1JO5A 2WITA 2HODB 1M7LA 2POHA 3H1KE 3H1LD 3FWLA 3TGUD 2FACA 2NZ2A 3CC4P 1HJBA 3OA7A 2FYUE 2QJPC 1EQ7A 1OWAA 2JBGA 1NQ4A 1N7SC 2WSEJ 2Z46A 2AVAA 3H1LG 4A7PA 1BSNA 4JBZA 2A45I 1FDOA 5APXA 1YQ3C 4RJTA 1MKMA 1OW8A 5KKZB 1LT9C 2AEMA 2CPBA 1NU1D 4H0LB 4H0LD 4GR6A 2FXPA 3G4SP 3VRLC 2R5BA 3VP9A 3B5NC 1QGKB 2M0BA 2L4BA
chains in the Genus database with same CATH topology
2Z45A 3CD6P 3G29A 3H0DA 3G1IA 3G28A 3LRYA 5F2KA 1Q81Q 1YI2P 1N8RQ 3Q20A 3CC7P 1D1DA 2P9XA 3H4EA 1JJ2O 1QRJA 2PEKA 2DGYA 4PH1A 1YIJP 1E6JP 3DPHA 2JO0A 1VQ9P 2PEJA 4IPYA 1VQ7P 1EOQA 3E2DA 1K73Q 2M8LA 3OW2O 4U0CA 2Z44A 2OTJP 1M6EX 2EFJA 5DCKA 2JYLA 2EIAA 1VQMP 1RO2A 2XT1A 2PEMA 4U0DA 1VQ6P 3CMAP 3DS4A 1BAJA 1M74A 3G71P 3CPWO 2PENA 3CCQP 2XV6A 5BS1A 1VQ5P 1Q7YQ 1VQPP 4XFYA 4M0IA 2L6EA 2XXMA 4COCA 3WBHA 3B5IA 3G26A 3NTEA 3G6EP 3CCSP 1Q86Q 1VQLP 3I55P 1A8OA 1YJWP 1A43A 1K9MQ 1Q82Q 1VQ4P 2QA4P 2M8PA 3CCEP 2KODA 2PEIA 5I4TG 3CCJP 3G21A 3P05A 3DS0A 3CCUP 3G1GA 2PEQA 4WYMA 4COPA 1PEQA 1K8AQ 4U0BA 2ONTA 3HZQA 4XFXA 5HGOA 1RO0A 3CCRP 2CWOA 3CCLP 5F2NA 5HGNA 3CCMP 3CMEP 3CC4P 4U0FA 1VQNP 4U0AA 1K30A 1W2BO 1NJIQ 3DS1A 3CXCO 4GR2A 3CC2P 4U0EA 2OTLP 1KQSO 2LF4A 5BS2A 1YJNP 5JPAA 5HGLA 1RNIA 1VQOP 2PY8A 2BQ1E 4QNBA 1YITP 1PEUA 2Z46A 3G0VA 2BUOA 2PEOA 3HYBA 1ZMBA 2E1MA 5F2OA 1YHQP 1KD1Q 1M90Q 3M1MA 1M1KQ 1VQ8P 3I56P 3DS5A 3DS3A 2M8NA 1KC8Q 4XRQA 5HGMA 4PH0A 3MGEA 1M6NA 2JYGA 3DS2A 3H47A 1QVFO 1QVGO 2BHVA 3RG6C 4XFZA 3CCVP 4XROA 1AUMA 3DTJA 1EIAA 1IUQA 2EG5A 4GR6A 1PEMA 2OARA 1PEOA 3G4SP 1YJ9P 3VRLC 1S72P 1VQKP 2QEXP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA P;  1K8A Q;  1M90 Q;  3CD6 P;  3CPW O;  3G71 P;  3CCQ P;  1M1K Q;  1VQ5 P;  1Q81 Q;  1YI2 P;  1N8R Q;  1VQ6 P;  1VQ8 P;  3CCR P;  1Q7Y Q;  3I56 P;  1VQP P;  3CCL P;  3CC7 P;  1KC8 Q;  3CCM P;  3CME P;  1JJ2 O;  3CC4 P;  1VQN P;  1Q86 Q;  3G6E P;  3CCS P;  1W2B O;  1NJI Q;  1YIJ P;  1VQL P;  1QVF O;  3CXC O;  3I55 P;  1QVG O;  1YJW P;  1VQ9 P;  3CC2 P;  1K9M Q;  3CCV P;  1Q82 Q;  1KQS O;  1VQ4 P;  2QA4 P;  1VQ7 P;  1K73 Q;  3OW2 O;  1YJN P;  2OTL P;  3CCE P;  1VQO P;  2OTJ P;  1YIT P;  3G4S P;  3CCJ P;  1YJ9 P;  1VQM P;  1S72 P;  1VQK P;  3CCU P;  2QEX P;  1YHQ P;  1KD1 Q; 
#chains in the Genus database with same CATH topology
 3ZDM A;  1L4A A;  3G29 A;  1U7J A;  2K1A A;  3M9H A;  1NU1 G;  2K9Y A;  3C8V A;  1VQ9 P;  5HVC A;  1RE4 A;  2J58 A;  2RH0 A;  1EOQ A;  3IAO A;  2Y0E A;  2ZYG A;  1ZP0 C;  4M3L A;  4Y28 J;  3NXS A;  1RY3 A;  1VHN A;  2XV6 A;  3NMD A;  2H89 C;  1AVY A;  1AQT A;  3JCU E;  2E74 C;  1R8E A;  1KZU B;  1SQQ E;  3M9Q A;  1M8O B;  3TYY A;  1N7S A;  3L74 J;  1A43 A;  3F89 A;  2QA4 P;  1OXZ A;  5AW9 B;  4BRY B;  2ZXX A;  1PGQ A;  1ZLL A;  2QE7 H;  2N1T A;  3B4S A;  3H32 B;  3G1G A;  2N1T D;  1PL5 A;  3CCR P;  3H1I G;  3D6Y A;  1RQU A;  1ZRT D;  3L73 J;  2PNG A;  3KZI H;  3QWO C;  1IMQ A;  4WY4 C;  3B5N A;  1MZ9 A;  1KN7 A;  1ZR2 A;  1SQB D;  2ZXE B;  2FYN C;  1PPJ G;  2HG5 D;  1ZMB A;  2K92 A;  3HYB A;  3RK3 B;  3PLN A;  3TF5 A;  1OFC X;  2YKP A;  3AEB C;  2PAJ A;  2L22 A;  5CCG C;  1KQL A;  1M6N A;  1SQB G;  4C7R A;  2AFE A;  3TNU B;  1L0N J;  4I2L C;  1PZQ A;  3N4X A;  4GT1 A;  4D6T J;  4MRT C;  2ERH A;  1FZA A;  2W83 C;  3P32 A;  3V2R A;  1S9K E;  1KFM A;  1MZ8 A;  2Z45 A;  3G1I A;  2C0X A;  4UB8 E;  5AW2 B;  3FGA D;  1D1D A;  2OYI B;  1OVR A;  1VKU A;  1S5L E;  3L72 J;  2JO0 A;  3HE5 B;  3JC2 2;  1BE3 J;  4RKU J;  2CPS A;  1M74 A;  4BPG A;  5KLV J;  1IO4 A;  1VQP P;  2P7J A;  2KS1 B;  1KLP A;  1NKN A;  2BEQ D;  1KIL E;  3R4Y A;  1J1E B;  2Z4E A;  3SFD C;  3O8Z A;  2AXT H;  5CCG A;  3U59 A;  3G21 A;  1HGV A;  4ZKU A;  2HPC B;  4UB6 H;  1Z6M A;  4WYM A;  5AW6 B;  2N9Y B;  2XU6 A;  1GL2 C;  4H2X C;  1NJI Q;  2WT7 B;  2FVA A;  3VMA A;  3L71 D;  5TJH A;  1YQ4 C;  4IFM A;  1SQX E;  2ZAE B;  3L37 A;  2D2C D;  1QX8 A;  1SQV J;  2KOG A;  1ZW0 A;  2GA1 A;  5AW8 B;  2KW2 A;  3CWB E;  1T8Z A;  1PP9 D;  1HF9 A;  1QVF O;  2KOR A;  3L70 E;  3MHV A;  3D70 A;  4PV1 D;  2EG5 A;  1PEM A;  4I7Z B;  2QJK C;  2QEX P;  3O6Q B;  3L75 E;  1QLE D;  3V2P A;  1M56 D;  1Q81 Q;  1G1I A;  1P84 D;  2RN0 A;  3ITK A;  1RF1 B;  1NH4 A;  5APS A;  2R44 A;  3HD7 C;  4JF7 A;  1GL2 A;  1S5L X;  1L0L K;  3H6P A;  1HWT C;  3G71 P;  3U1C A;  2K93 A;  5BS1 A;  1JMM A;  4EYY Q;  3UIA A;  2K0Y A;  3VMZ A;  4ZKP A;  2O01 N;  1LP1 A;  3L73 D;  5AVU B;  3EJE A;  2K9J B;  1GW3 A;  2QG4 A;  3GHG B;  3MIW A;  5GTH H;  3LW5 H;  1NTM K;  4Z1M H;  2C0W A;  3S1K A;  1EC5 A;  1RO0 A;  2CWO A;  1IFM A;  4NPF X;  2Q3E A;  3NFQ A;  1VQN P;  4U0A A;  3CX5 E;  2P58 A;  1HBW A;  4U0E A;  4KJM A;  1HJ0 A;  1EDI A;  3H1J E;  1JOC A;  1R5L A;  3T97 B;  3Q5R A;  1UJZ A;  2M5A A;  2FFD B;  1YYC A;  2Y0C A;  2Q6Q A;  2KSE A;  1LTT C;  2AFD A;  3I56 P;  2LKI A;  2M8N A;  1FZB A;  5HGM A;  4PH0 A;  4N78 E;  3RK2 B;  5TIS H;  3HE4 A;  1NKZ B;  1VF5 C;  2WPT A;  2KLU A;  5AW1 B;  4H13 B;  4H13 D;  1JY3 P;  5AVR B;  1OR5 A;  3LID A;  1SQP J;  1CZQ A;  1J2J B;  4C7N B;  3V6I A;  1GU5 A;  1URQ D;  4GOF A;  3H1L J;  3TGU J;  2KNC A;  1BE3 D;  2IZ0 A;  5B66 H;  4IFD K;  2WPQ A;  3RG2 A;  1VQ7 P;  1T3U A;  3AEA C;  3KXD A;  3LW5 J;  3G9R A;  3AE6 C;  2YMY A;  1GD2 E;  2O01 H;  2IBZ G;  5E79 H;  5B5E H;  2IFM A;  3CMA P;  4H44 C;  2KGA A;  3CXH D;  2K94 A;  2PGD A;  3L36 A;  3BCC G;  1YJW P;  1NU1 J;  1K9M Q;  1VQ4 P;  2LXB A;  4DT0 A;  2E42 A;  2LML A;  2OYH B;  2GZF A;  1NYH A;  2M3E A;  2YMK A;  3SFE C;  2KOP A;  1SQV D;  4R4L A;  2R5D A;  1EDL A;  1NTZ D;  4U0F A;  1EZV E;  4L74 A;  2IFN A;  2E75 B;  1JTH A;  5HGL A;  2E5T A;  4TLF A;  1IFP A;  3A7O A;  1NTZ G;  4OGQ C;  1OZH A;  2W8Z A;  1IMP A;  3P8C D;  1DV5 A;  2KR5 A;  1AF8 A;  4PXH B;  3H1I J;  2JAZ A;  1RH5 B;  3M0A A;  3RG6 C;  2O01 J;  5KLV E;  2YKO A;  3DTJ A;  2MVV A;  4U7J A;  2PFX A;  2WMM A;  1LJ2 A;  1HUC A;  4H2W C;  5APQ A;  2Y9Y A;  4B86 A;  2K3R A;  2P1J A;  2KOQ A;  1N8R Q;  1NOH A;  3KHU A;  3VOP A;  2YIU B;  3Q20 A;  1USE A;  1OW6 A;  4PH1 A;  1YIJ P;  2WPS A;  1KB9 I;  1SQB J;  3JSV C;  3AE8 C;  1FE6 A;  3A0H H;  3WU2 H;  4AYC A;  1IC2 A;  2MF4 A;  2C9L Y;  4YXW H;  4K3A A;  1L0I A;  3BRT B;  3RBZ A;  1G2C B;  3WBH A;  3SWY A;  1VQL P;  1DEB A;  2GZJ A;  3BAT A;  2PP6 A;  5CJ0 A;  2N6Z A;  2CQ8 A;  4H0L C;  2FYU G;  1LTG C;  2AXC A;  1T8K A;  1PEQ A;  3HUS B;  3CL3 D;  3V2Q A;  5KAI H;  3CCM P;  3CI9 A;  1FJK A;  2HR3 A;  3CXC O;  3PP5 A;  2ROQ A;  1KQS O;  1BDD A;  1VDF A;  1H88 A;  2IZ1 A;  1L0L E;  2W90 A;  2AXT E;  2HOD A;  4DZO A;  4U3F E;  1JCC A;  2A06 E;  1LNQ A;  2OYO A;  3A3Y B;  1M90 Q;  1HTL C;  3MTU E;  4UB6 E;  3II6 A;  3H1H E;  2E5Y A;  3MP7 B;  1SVF A;  2YKQ A;  3AE1 C;  1P84 H;  2XV5 A;  3USS A;  5EJD A;  2HLO A;  4GOE A;  2KLV A;  4XFZ A;  2KYV A;  1W5C E;  2GZI A;  2JGP A;  3OAK A;  1NTM E;  5AVZ B;  1U7M A;  1MFZ A;  2RMZ A;  1SQQ D;  3AEF C;  2N1T C;  3NTN A;  3CC7 P;  2EHS A;  2YXR B;  2JWD A;  3L71 J;  1GPJ A;  3WMM 0;  2VLP A;  1K73 Q;  1SQQ G;  2WSS H;  4WWI A;  2XT1 A;  1EZV I;  3F5H A;  2PEN A;  3RK3 C;  2BAS A;  1PP9 J;  3BVH A;  3AED C;  3U1A A;  5DJU B;  4GKG A;  2VRS A;  2NRG A;  3CCE P;  2ZT9 B;  2KP8 A;  1ZR4 A;  1YBK A;  2N98 A;  3P05 A;  1ZN5 A;  2ZYD A;  3DS0 A;  2N50 A;  2PEQ A;  5CHX A;  5APT A;  2AEJ A;  3TSI A;  5KLI B;  3Q2Y A;  1SQP E;  4BRY A;  4I1L A;  3H1I D;  2XZ0 D;  3H1L E;  2LF4 A;  3TGU E;  1HH0 A;  2KUB A;  3GJN A;  3H32 A;  4PD4 D;  2KZJ A;  1AFO A;  3NY7 B;  3CXH I;  3G0V A;  2KI7 B;  2PEO A;  2E1M A;  1LTJ B;  3V4Q A;  2GUV A;  5GTH E;  3OJA B;  1NTK D;  4OWF A;  1PPJ D;  3DS5 A;  2YO2 A;  2H43 A;  1E0H A;  4XRQ A;  2X2B A;  2QJP B;  2JYG A;  1BGY E;  1QVG O;  3L4F A;  1X79 B;  3W67 A;  1J1E C;  1N86 A;  1H0T B;  1YJ9 P;  1NTK G;  2E43 A;  2B9B A;  2FQ1 A;  1PGO A;  1NU1 E;  3N7N A;  2I1K A;  3RK3 D;  1GXG A;  1KIL D;  1KIL B;  5CMZ A;  4IZ6 A;  2XDJ A;  2FYZ A;  1DD3 A;  1KOR A;  3TNU A;  3CXH H;  1LT9 B;  1AV1 A;  2PEK A;  2RKL A;  1E6J P;  1LT1 A;  1FDI A;  5TIS E;  2LL8 A;  2XND H;  1JNM A;  2OYI A;  2D2C C;  1IFJ A;  1L0N K;  4AQR D;  2W27 A;  1QL1 A;  3HE5 A;  1Q86 Q;  1SQX D;  1CI6 B;  2BEZ F;  1MUU A;  2J59 M;  2M8P A;  5KP8 B;  1FC2 C;  4PV1 C;  2WVR A;  2K5X A;  2W6B A;  4I7Z C;  3CWB D;  2FKW B;  2KS1 A;  2KGE A;  1K8A Q;  2E74 B;  5E79 E;  1SQX G;  3EJD A;  5HGN A;  1Y9B A;  5GTI H;  2GDW A;  1KYO D;  1M1J C;  3BCC J;  2PRR A;  2HPC A;  2IPP A;  5CZD B;  3CWB G;  1RF1 C;  5KLV K;  3L70 G;  2BUO A;  1E79 H;  1KD1 Q;  4DJG A;  4CA3 A;  3GF7 A;  2WT7 A;  4WY4 B;  1WMK A;  1G1J A;  5H2F E;  1BXI A;  1SFC B;  1SFC D;  1MFT A;  3L75 G;  2W6J H;  1BCC D;  3MUD A;  3GG2 A;  2QJY C;  2KB7 P;  3GHG C;  1JY2 N;  3HTK B;  1N73 B;  3B4Q A;  1R5S A;  2C9N Y;  2ZFC A;  1IJD B;  1GXH A;  1NTZ J;  3AE9 C;  1YI2 P;  1BCC G;  2KG8 A;  2P9X A;  2G8Y A;  2V7Q H;  2JO1 A;  2ZVO B;  5BU8 B;  1CW5 A;  2PEJ A;  3OW2 O;  1M57 D;  2OTJ P;  2XZ1 C;  1SQV K;  1DEE G;  2CG5 B;  1QL2 A;  4U0D A;  1M1J A;  3CPW O;  3CX5 D;  4HKG A;  2KGD A;  4R0M A;  2FFD C;  1RF1 A;  4COC A;  1LWU B;  3L35 A;  4C46 A;  1PV3 A;  1WRG A;  4H13 C;  2AEF A;  1ZXG A;  2MR8 A;  1DNY A;  2KWL A;  1FR2 A;  3Q1M A;  3CCU P;  1X9V A;  3H1J G;  3WU2 E;  1URQ C;  4WVZ A;  2LKM A;  2QM7 A;  2K9J A;  2XKM A;  2P10 A;  3GHG A;  1W2E A;  4WBA A;  3B8E B;  5JPA A;  1RNI A;  1OW7 A;  5AVQ B;  2LXC B;  2R3C A;  3L71 E;  2FHS C;  2M3B A;  2FVF A;  1L2P A;  2OGU A;  2FYU J;  2JKV A;  1KB9 E;  2GZE A;  2O1J A;  2V7Q J;  2IDB A;  2K0D X;  3BRV B;  5APY A;  3H47 A;  2CNR A;  3T97 A;  2MKV A;  5KAI E;  2BHV A;  2MR7 A;  3H25 A;  1OMI A;  1PP9 E;  4TT3 H;  2FFD A;  1S72 P;  2OYH C;  2LTE A;  3CD6 P;  2IYO A;  4F37 A;  3AE2 C;  2XZR A;  3RK2 D;  4PD4 I;  2FBW C;  1EMV A;  2L0Q A;  4C7N A;  1PFI A;  1RF0 C;  4Y99 C;  2JP3 A;  4U0C A;  1URQ A;  2KXP B;  2E75 C;  1BDC A;  2EIA A;  1VQM P;  3RL0 B;  3RL0 D;  1FOS E;  1VQ6 P;  2A45 G;  4BPF A;  2R32 A;  3L74 E;  3DS4 A;  1BAJ A;  2H88 C;  3GMA A;  4GIF A;  1VQ5 P;  2IBZ D;  3VP8 A;  5AW4 B;  2JWA A;  3G6E P;  3CCS P;  3HD7 B;  4LLH A;  1A02 F;  1SQP K;  1H8A A;  5HV8 A;  5EFW B;  3BCC D;  4PD4 H;  3L73 E;  1SQQ J;  3HRN A;  1L0H A;  2BCC D;  3C9I A;  2WZ7 A;  3CME P;  3RL0 g;  1NGM B;  4XA4 A;  3AEG C;  1D7M A;  2OYH A;  2Q7C A;  1NAF A;  2OTL P;  1XTC C;  3EFG A;  1RQV A;  2MVU A;  2BCC G;  2YXQ B;  1NHL A;  1L0N E;  1RF0 A;  1JM0 A;  4D6T E;  3DS3 A;  1N2D C;  4CPG A;  1NU1 K;  2IYP A;  3MGE A;  4QKO A;  2Q3I A;  1NO4 A;  2E75 D;  1FBM A;  3EFF K;  3LIE A;  3PJS K;  2B87 B;  1H89 A;  3CE7 A;  4L73 A;  3VYI A;  3L72 E;  2WTY A;  1DX7 A;  1F80 D;  3HUS C;  1IK7 A;  1KYO I;  1IFN A;  3H4E A;  3G3Z A;  1FZF A;  1IZN B;  3FXE A;  3Q5P A;  1BE3 E;  1GU4 A;  3KZI E;  2M8L A;  1T6A A;  3P8M C;  2CGQ A;  1GMJ A;  4HH2 A;  1NAY A;  5L8R J;  1JTH B;  2PEM A;  3BAS A;  2HYN A;  3K5B A;  1NTK J;  4OH8 B;  3A2A A;  3CCQ P;  4M0I A;  3B5I A;  1T3J A;  3CXH E;  4U3F D;  2Y0D A;  1HGZ A;  1KYO H;  2KOD A;  2GZG A;  3H1H D;  1UNK A;  3H1K D;  1G2C A;  1Y8A A;  1L0L G;  4U3F G;  3KPE A;  5F2N A;  2FYU D;  1SQB K;  4NPD A;  1W2B O;  4IL6 H;  1NTM D;  3DS1 A;  3CC2 P;  4GR2 A;  1SQV E;  2WWW A;  3H1H G;  5KKZ C;  5BS2 A;  3FX0 A;  3H1K G;  1LTB C;  2LPK A;  2OQQ A;  3HUS A;  5CCH A;  2PY8 A;  4KT0 J;  2V4H A;  3GKL C;  2GDX A;  2NO8 A;  1MV8 A;  3WUV A;  1JUN A;  3M1M A;  5CCH D;  1P84 I;  1K04 A;  1NTM G;  1BSH A;  1SQX J;  4NEO A;  1KC8 Q;  2OTK E;  3GW6 A;  1J1D B;  2JU1 A;  4HB1 A;  2O1K A;  2NPS D;  2NPS B;  2WPR A;  3MGN A;  2OAR A;  1FU1 A;  2KZI A;  3CWB J;  5KJ7 D;  2LIW A;  4OGQ B;  3B71 A;  5KP6 B;  5F2K A;  3CX5 H;  4PJ0 H;  2O3J A;  5KLI C;  2KK7 A;  3SWK A;  4DOJ A;  1T2K D;  1QRJ A;  2DGY A;  2B89 A;  1KQG B;  3E2D A;  3VMX A;  4DG9 A;  3FWN A;  5KTB A;  1ZME C;  2B88 A;  3IF4 A;  4BWN A;  1RO2 A;  1FZC B;  1E5W A;  1JY2 O;  5KP7 B;  1LTJ C;  2GM4 A;  2N9B A;  1BCC J;  3KDP B;  1SQP G;  1VL2 A;  5AVT B;  2E76 B;  2E76 D;  1K05 A;  3CCJ P;  5AW0 B;  2Q9I A;  3TGU G;  4I6M C;  1BGY D;  1KIL C;  5DJT B;  3CCL P;  1LTA C;  5AVY B;  4DCK A;  4LGD E;  2LOL A;  1YTZ I;  2BQ1 E;  2ZT9 D;  4QNB A;  1BGY G;  1AA0 A;  2IX7 C;  1EDK A;  3AEC C;  4EDF A;  2IBZ I;  4ASW A;  1KFN A;  3H1J J;  1VQ8 P;  1EXJ A;  1DD4 A;  5EW5 E;  1L4A B;  1L4A D;  2A45 H;  1GTW A;  2FAD A;  1X3O A;  2OYI C;  2QIW A;  1S9K D;  1LTJ A;  4PWV B;  4HJG H;  5KAF H;  4IFF A;  1GDT A;  1FZE A;  3H0D A;  4W7Z A;  4YPC A;  7CEI A;  1H0T A;  2MJZ A;  3PRJ A;  5CBN A;  4BXL A;  4MN4 C;  4IPY A;  2FQ2 A;  3AEE C;  3V5B A;  3PH0 A;  2GDY A;  5AW7 B;  1N7S B;  1N7S D;  1KIL A;  3W68 A;  4GOD A;  4IOI H;  4AUW A;  1LTS C;  5AVW B;  1LT9 A;  3C1L A;  2N1T B;  4XFY A;  2JDI H;  3WUU A;  4W80 A;  3E1R A;  5AVS B;  2N5H A;  1A8O A;  2KSJ A;  1SFC C;  2AF8 A;  3AE7 C;  2QSI A;  2QNW A;  3V2N A;  1HQB A;  1UII A;  3B5N D;  3B5N B;  2FXM A;  2P67 A;  4QMA A;  3KYQ A;  4U0B A;  2ONT A;  2L91 A;  3MUD C;  1JB0 J;  1N73 C;  2K0X A;  1CI6 A;  5CBO A;  5HGO A;  2KIK A;  3WUT A;  2Z5H A;  1FS0 E;  1S1C X;  2FY8 A;  5B66 E;  1A02 J;  1VQO P;  1YIT P;  2K37 A;  3CLQ A;  3H1I E;  2I1J A;  5F2O A;  1YHQ P;  4OVN F;  4PD4 E;  5APV A;  2Q1K A;  2E74 D;  5B5E E;  3L70 D;  1JY3 N;  1IK9 A;  1AQ5 A;  4KHX A;  3S9O A;  2KG6 A;  3DS2 A;  1NTK E;  1NWQ A;  1LWU C;  1PPJ E;  1KMI Z;  1ZRT E;  3E1I A;  1FDM A;  1LGH B;  1EIA A;  4LC1 A;  2JQ4 A;  3L75 D;  1GK6 A;  1Q90 D;  1VQK P;  2BCC J;  4WY4 A;  3AE3 C;  2ITA A;  1SQB E;  1SFC A;  3G28 A;  1RE3 C;  4WY4 D;  3RK3 E;  2KG9 A;  3A0B H;  3Q5S A;  3HTK A;  1N73 A;  2FYN B;  2Z44 A;  3FXD A;  2EFJ A;  5DCK A;  2YNY A;  2VLO A;  2FXO A;  3SWF A;  2M5R A;  5CCG D;  2M8R A;  1Q7Y Q;  2L6E A;  3TDK A;  4HYT B;  2UWJ E;  3ABV C;  4ZNC A;  4ZMD A;  1EDJ A;  1TU3 F;  1KB9 D;  1GK4 A;  1X8Y A;  1FZG A;  3O6Q A;  2N5I A;  2D2C B;  2JU2 A;  1NTZ K;  1ZV8 A;  4COP A;  1LWU A;  4YTP C;  4XFX A;  3L71 G;  5APW A;  1DH3 A;  5AW5 B;  5BVZ A;  3H1J D;  3RK2 C;  4UHP B;  4PV1 B;  3GLM A;  1RE3 A;  1KYO E;  1KTM A;  1WT6 A;  3RBX A;  1PEU A;  1PP9 G;  3RL0 C;  3A0H E;  4N78 D;  1M1K Q;  1OVV A;  1L0L J;  2WQY C;  1HVV A;  1SS1 A;  1M1J B;  4U3F J;  1RHZ B;  3GZM A;  1X0T A;  5AW3 B;  2H7H A;  1AUM A;  4IL6 E;  3H1H J;  3L74 D;  2QM8 A;  2XNX A;  3H1K J;  1PEO A;  4W7Y A;  3QH9 A;  1ZOY C;  1BCC E;  2SPZ A;  3JCU H;  2K2Q A;  2JR8 A;  3U43 A;  1KQF B;  3P7K A;  1GL2 B;  1GL2 D;  2WSF H;  1FOS F;  1Y47 A;  1NTM J;  3KQG A;  4H2Y C;  1JJ2 O;  1S2E A;  3L74 G;  2QJY B;  1OX3 A;  4BPH A;  2DW3 A;  2FAE A;  3GF3 A;  3S4R A;  3TK1 A;  1LP1 B;  2FYU K;  1S3J A;  5C39 A;  3MZW B;  2MD9 A;  1OIP A;  2Z5I A;  2CK3 H;  1CEI A;  3L73 G;  2ZYA A;  3Q3D A;  1YTZ T;  3RGU A;  4PJ0 E;  3V4W A;  3I55 P;  1GW4 A;  1P84 E;  2QJK B;  1L0N D;  2PEI A;  1JMB A;  1JCD A;  2JEE A;  5I4T G;  4D6T D;  3EQ2 A;  4EIJ A;  1SP4 A;  2HFE D;  1EZV D;  3HZQ A;  1ZNV A;  1OVU A;  3HD7 A;  3PTZ A;  2M5A B;  3M9B A;  1AJY A;  1L0N G;  5AVX B;  3HD7 D;  4JQ0 D;  4D6T G;  3L72 D;  1YJN P;  3HE4 B;  2R3S A;  1EZV G;  2WSF J;  1LTI C;  4UB8 H;  1URQ B;  4EOT A;  1S5L H;  1JEK A;  5KLV D;  3IFM A;  3L72 G;  1VPC A;  3AE5 C;  3VTP C;  2DNW A;  2KNC B;  2YIU C;  3SSU A;  1UIX A;  1Z56 A;  4XRO A;  4ASV A;  2KOO A;  1SQQ K;  3D6Z A;  5AVV B;  1IUQ A;  1S4X A;  3R2P A;  1KV4 A;  1BE3 G;  1BGY J;  5KLV G;  3I5C A;  3LRY A;  4K35 A;  4IL6 X;  2JB0 A;  1JY2 P;  5CJ4 A;  3EJB A;  2GUS A;  2QVA A;  2WSC H;  2G3A A;  3DPH A;  2W6A A;  2B87 A;  2L5G B;  3E7K A;  4N6J A;  1QEX A;  1FJP A;  1M6E X;  2JYL A;  2Q5U A;  4L75 A;  5KAF E;  1DIP A;  5H2F H;  4RO0 A;  1USD A;  5CCH C;  2L9F A;  4WB4 A;  2XXM A;  1VF5 D;  1VF5 B;  2VLQ A;  1AVO A;  4Y99 B;  2Y9Z A;  2IBZ E;  1N7L A;  3M06 A;  1J1D C;  2K88 A;  2KOS A;  2NPS C;  1SQV G;  2VLN A;  5KJ7 C;  1IFD A;  2H8P D;  2LR2 A;  2JJL A;  3BCC E;  2J5U A;  2YO3 A;  2FVE A;  3M91 A;  4RES B;  1K30 A;  2BCC E;  1L0L D;  3GZL A;  3PHL A;  1T2K C;  2A06 D;  3M0D C;  5M1B A;  4NPE A;  4N3Y B;  1NTK K;  3IR9 A;  4R4M A;  1NVO A;  1PIX A;  2FQ0 A;  4H44 B;  4H44 D;  2WPV B;  2WSC J;  1FZC C;  1CSB A;  2VSQ A;  1PGP A;  4XE5 B;  2A06 G;  3IN6 A;  2P2U A;  3VN0 A;  2MY5 A;  4O9B A;  1HY8 A;  3CCV P;  1NTZ E;  5BU5 A;  4JPZ B;  3D71 A;  3VMY A;  2E76 C;  3CX5 I;  4HKZ H;  2GYK A;  2ZVN B;  2I8D A;  3A5T A;  1SLQ A;  2WSE H;  1Q2N A;  2NPS A;  4GDO A;  1JY3 O;  2LIU A;  3MD0 A;  5APU A;  5KJ7 A;  1FAV A;  3P8C E;  5GTI E;  3AE4 C;  5K5G B;  4JYC A;  1KB9 H;  1GZL A;  2KGC A;  2ZT9 C;  4OGQ D;  1SQX K;  3L70 J;  4YXD C;  1PGJ A;  3M0D A;  4EI2 A;  4L76 A;  3NTE A;  2EHT A;  3G26 A;  1XTG B;  3EWK A;  1L4A C;  1X22 A;  4XFJ A;  3LMO A;  1Q82 Q;  1FZC A;  3L75 J;  2N6Y A;  4JYB A;  1AYI A;  2QRX A;  2ZJS E;  3A0B E;  1EXI A;  1ACP A;  1IFI A;  1U57 A;  1SQP D;  1RE4 C;  1JO5 A;  2WIT A;  2HOD B;  1M7L A;  2POH A;  3H1K E;  3H1L D;  3FWL A;  3TGU D;  2FAC A;  2NZ2 A;  3CC4 P;  1HJB A;  3OA7 A;  2FYU E;  2QJP C;  1EQ7 A;  1OWA A;  2JBG A;  1NQ4 A;  1N7S C;  2WSE J;  2Z46 A;  2AVA A;  3H1L G;  4A7P A;  1BSN A;  4JBZ A;  2A45 I;  1FDO A;  5APX A;  1YQ3 C;  4RJT A;  1MKM A;  1OW8 A;  5KKZ B;  1LT9 C;  2AEM A;  2CPB A;  1NU1 D;  4H0L B;  4H0L D;  4GR6 A;  2FXP A;  3G4S P;  3VRL C;  2R5B A;  3VP9 A;  3B5N C;  1QGK B;  2M0B A;  2L4B A; 
#chains in the Genus database with same CATH homology
 2Z45 A;  3CD6 P;  3G29 A;  3H0D A;  3G1I A;  3G28 A;  3LRY A;  5F2K A;  1Q81 Q;  1YI2 P;  1N8R Q;  3Q20 A;  3CC7 P;  1D1D A;  2P9X A;  3H4E A;  1JJ2 O;  1QRJ A;  2PEK A;  2DGY A;  4PH1 A;  1YIJ P;  1E6J P;  3DPH A;  2JO0 A;  1VQ9 P;  2PEJ A;  4IPY A;  1VQ7 P;  1EOQ A;  3E2D A;  1K73 Q;  2M8L A;  3OW2 O;  4U0C A;  2Z44 A;  2OTJ P;  1M6E X;  2EFJ A;  5DCK A;  2JYL A;  2EIA A;  1VQM P;  1RO2 A;  2XT1 A;  2PEM A;  4U0D A;  1VQ6 P;  3CMA P;  3DS4 A;  1BAJ A;  1M74 A;  3G71 P;  3CPW O;  2PEN A;  3CCQ P;  2XV6 A;  5BS1 A;  1VQ5 P;  1Q7Y Q;  1VQP P;  4XFY A;  4M0I A;  2L6E A;  2XXM A;  4COC A;  3WBH A;  3B5I A;  3G26 A;  3NTE A;  3G6E P;  3CCS P;  1Q86 Q;  1VQL P;  3I55 P;  1A8O A;  1YJW P;  1A43 A;  1K9M Q;  1Q82 Q;  1VQ4 P;  2QA4 P;  2M8P A;  3CCE P;  2KOD A;  2PEI A;  5I4T G;  3CCJ P;  3G21 A;  3P05 A;  3DS0 A;  3CCU P;  3G1G A;  2PEQ A;  4WYM A;  4COP A;  1PEQ A;  1K8A Q;  4U0B A;  2ONT A;  3HZQ A;  4XFX A;  5HGO A;  1RO0 A;  3CCR P;  2CWO A;  3CCL P;  5F2N A;  5HGN A;  3CCM P;  3CME P;  3CC4 P;  4U0F A;  1VQN P;  4U0A A;  1K30 A;  1W2B O;  1NJI Q;  3DS1 A;  3CXC O;  4GR2 A;  3CC2 P;  4U0E A;  2OTL P;  1KQS O;  2LF4 A;  5BS2 A;  1YJN P;  5JPA A;  5HGL A;  1RNI A;  1VQO P;  2PY8 A;  2BQ1 E;  4QNB A;  1YIT P;  1PEU A;  2Z46 A;  3G0V A;  2BUO A;  2PEO A;  3HYB A;  1ZMB A;  2E1M A;  5F2O A;  1YHQ P;  1KD1 Q;  1M90 Q;  3M1M A;  1M1K Q;  1VQ8 P;  3I56 P;  3DS5 A;  3DS3 A;  2M8N A;  1KC8 Q;  4XRQ A;  5HGM A;  4PH0 A;  3MGE A;  1M6N A;  2JYG A;  3DS2 A;  3H47 A;  1QVF O;  1QVG O;  2BHV A;  3RG6 C;  4XFZ A;  3CCV P;  4XRO A;  1AUM A;  3DTJ A;  1EIA A;  1IUQ A;  2EG5 A;  4GR6 A;  1PEM A;  2OAR A;  1PEO A;  3G4S P;  1YJ9 P;  3VRL C;  1S72 P;  1VQK P;  2QEX P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...