1Q86Q

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 46
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1q86Q03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1q86Q01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1q86Q02
1M90Q 1VQOP 1YIJP 3CCLP 1K9MQ 3CCQP 1N8RQ 3I56P 1KQSO 1S72P 1YI2P 1VQLP 3CCMP 1YHQP 1YITP 1Q81Q 1QVGO 3CC7P 1QVFO 1KC8Q 3CD6P 1YJ9P 1VQ6P 3CC4P 1VQ9P 1Q7YQ 2OTLP 1VQMP 3G4SP 1YJNP 3CCVP 1W2BO 2QA4P 3G71P 1YJWP 1Q86Q 1M1KQ 1VQ7P 3CMEP 2OTJP 1VQ8P 3I55P 3CCEP 1VQ4P 1K8AQ 3CXCO 1NJIQ 3CCSP 3CCUP 1VQ5P 1VQKP 1VQPP 1KD1Q 3CCRP 1JJ2O 3G6EP 1Q82Q 2QEXP 3OW2O 1VQNP 3CC2P 3CCJP 1K73Q 3CMAP 3CPWO
chains in the Genus database with same CATH superfamily
2W90A 3M9HA 2R3CA 1MFTA 1OW8A 3L70J 2W6BA 1IC2A 2P10A 5TJHA 1JM0A 2M3BA 1QLED 3IF4A 5KP7B 2K9YA 2KR5A 4IPYA 1TU3F 3AE8C 1T3JA 2LKIA 1PEMA 1GXGA 2HR3A 3KYQA 2I1JA 3IFMA 5AVZB 2LMLA 1LT9C 1QVFO 3CD6P 1BCCD 4RESB 2KG9A 1KB9H 2OYHA 1RF1B 2E42A 3R4YA 4H2WC 3QWOC 3P8MC 3JC22 4C7NB 2YMYA 2KS1A 1R5LA 3V4WA 2E75B 2E76C 5AW5B 1SQBD 1EDIA 1SQBG 3OJAB 2JR8A 1IFDA 5HGLA 3DTJA 1SQVJ 2XU6A 2KZIA 4IFFA 2JU1A 3RK3B 3DPHA 2K94A 2FFDB 3D71A 1H0TA 4DZOA 1M7LA 1KILA 2DNWA 2BUOA 2E74C 3LW5H 3O6QB 4D6TG 2WTYA 1VL2A 3L70G 1NTZK 1ZMEC 1JY3N 4NPFX 2WPRA 3HTKA 1NU1K 2WITA 2QM7A 2KSJA 1BCCE 4PH0A 1RE3C 2WSCJ 1D7MA 3L71D 1RF1C 2N6ZA 4IZ6A 3HE5A 2I8DA 2H43A 2Z44A 3UIAA 1T6AA 2E75C 2MY5A 3HD7C 2W6AA 1VPCA 4I1LA 3VTPC 5CCGC 2GZEA 5CCHA 2B89A 1UIIA 1NKNA 3VMAA 1PP9E 1YTZI 2N1TD 3RK3C 2FFDC 1SQVG 1GK4A 4PV1D 2XKMA 3GHGB 5CJ0A 2L22A 3TYYA 4O9BA 2XT1A 1PEUA 1N7LA 3H0DA 3CC7P 1EZVE 2YKPA 5AVXB 3NTEA 5H2FE 2WPVB 2H88C 2L9FA 4UHPB 1NKZB 3L71E 4Y28J 2Y0DA 3CC2P 1JCDA 4H2YC 4W7ZA 1OVVA 1Q81Q 1IJDB 3H1ID 4KHXA 2PEMA 1NAFA 2PY8A 2A45H 3I55P 1AVOA 2GZFA 4MN4C 1FS0E 1NJIQ 3RBXA 3TK1A 1JJ2O 2GDXA 5AW3B 3KDPB 3VMXA 2MR8A 4BRYA 1VF5B 5BS1A 2XZ0D 3H1HJ 1MKMA 2KUBA 5JPAA 2W8ZA 2N5HA 3GHGC 3D6ZA 2PRRA 3FWLA 5AVYB 2IYPA 4IOIH 2Z4EA 5AVQB 2VRSA 2KLVA 1P84E 2HG5D 2KG6A 3I56P 1VQLP 2WWWA 2KXPB 1OXZA 1EC5A 4DCKA 2WPQA 1N86A 2YO2A 3Q5RA 2M8RA 2G3AA 1Y47A 2H89C 2O1JA 1PPJG 3V2QA 2FQ1A 2K3RA 3H1IE 1RE4C 2QJYB 5KJ7C 2FXPA 2CG5B 3AE5C 1D1DA 1EDLA 1NO4A 2ONTA 4ASWA 2KNCA 4U3FJ 1LT9A 1J1EB 2OYHB 2P2UA 4U7JA 2OQQA 2QJKB 3SWYA 2KS1B 1ZLLA 4GR2A 5KLIB 1K9MQ 2V4HA 3H1HG 1IFJA 1LGHB 2ZT9B 2EHTA 4I2LC 4ASVA 2IX7C 1HGVA 1W2EA 2Q1KA 2W83C 1NTKK 4Z1MH 2FVEA 3AECC 1SQPK 1MUUA 1EDJA 2B87A 1FU1A 3L37A 1VQOP 4CPGA 1VKUA 1KILB 3RBZA 2GA1A 2XV5A 3N4XA 3RK2B 3HZQA 2E74D 3CL3D 2POHA 2UWJE 3E1RA 1YQ4C 3KPEA 2R44A 3PHLA 3VP8A 3KZIE 3L73J 2QJYC 1AQTA 3M0AA 1BDDA 1QL1A 2NPSA 2A06G 3PLNA 3LW5J 2OYHC 1YITP 1KC8Q 2P1JA 1E6JP 3NXSA 5KLVK 2MF4A 2BEZF 3HE5B 4U3FG 1GL2A 2QJKC 3TF5A 1QX8A 2KOPA 1WRGA 2KGCA 2FQ0A 2Y0CA 1ZXGA 2HFED 2ERHA 2E75D 3AEAC 2ZT9C 3M06A 2JWDA 3BASA 3HD7D 4RO0A 2N9BA 2KODA 3HD7A 3V4QA 1YHQP 1KMIZ 5HVCA 1IFNA 1HQBA 5CCGD 4IL6E 5CCGA 1K30A 3U1AA 3QH9A 1KB9D 1P84H 1AF8A 2OTJP 1L0NK 4PD4I 3RK3D 2L6EA 2PEKA 1LP1B 4QKOA 1KILC 2CPBA 1L4AB 3A2AA 1ACPA 3O8ZA 1NTMJ 3RG6C 3RK2C 2M8PA 2ZXXA 4BWNA 3Q5SA 5HGOA 4A7PA 4PJ0E 1FDMA 1SQQD 3AE7C 2X2BA 1ZNVA 1JCCA 2AF8A 3S9OA 3AEEC 1BSNA 3L73G 1KZUB 2K5XA 1VQ4P 3JSVC 3AEBC 1H8AA 2ZVOB 2GUSA 3B71A 2KOQA 4DJGA 2Y0EA 3GKLC 1R8EA 3M91A 2NZ2A 1M74A 4YTPC 2MVUA 4I6MC 2OYOA 2GUVA 3W67A 3D6YA 3KHUA 1JO5A 2QIWA 5CCHC 5DCKA 1OIPA 2HPCA 5APVA 4BRYB 3CCLP 2CWOA 2FXMA 1GW3A 3TGUE 3USSA 4NPEA 4XA4A 3RK3E 1HF9A 3CC4P 2MR7A 3L72E 1L4AC 2N98A 2KG8A 3DS5A 3CX5I 3CCEP 1AFOA 1SQXJ 3CCSP 3HUSA 1KYOD 2KIKA 1FZEA 3G6EP 1FZBA 1NTMD 5F2KA 1NTMG 3KZIH 1SQQE 1RO0A 1N8RQ 2VLQA 1S5LX 5APSA 1IK7A 3GMAA 2WSSH 4TT3H 2JAZA 2ZFCA 1FE6A 1JMBA 2N50A 5AW0B 2YMKA 1PZQA 2WSEH 1ZMBA 5B5EE 1S1CX 5KP6B 2YXRB 4L75A 2AVAA 2IBZD 2KB7P 2IBZG 1RE4A 2CK3H 4JPZB 4XFXA 5KJ7D 1FBMA 3VMYA 2FYUK 3I5CA 2XZ1C 1YYCA 4IL6H 2V7QH 4RKUJ 1HJBA 2IFMA 5F2NA 2K2QA 3AEGC 2WVRA 3MP7B 1USEA 1IFPA 3TDKA 4ZNCA 1JEKA 4WBAA 5CMZA 1E79H 2CQ8A 1KYOE 1UIXA 4HYTB 4NEOA 1X79B 4PJ0H 1SQXD 1BXIA 1S2EA 2A45G 1SQXG 2ZJSE 1PP9J 2ZAEB 2K0XA 5B66E 4N6JA 4R4MA 2B87B 1M8OB 1YBKA 1X3OA 2PEQA 1JOCA 5I4TG 5F2OA 1VDFA 3F5HA 4DT0A 2E74B 2XZRA 3H25A 3U43A 4DG9A 3OW2O 2IBZE 3R2PA 2NPSB 1G1IA 2GM4A 3L71J 1BCCG 1PGPA 3BRTB 1M1JA 3KQGA 5AW4B 1GL2B 1Q90D 3FGAD 3TSIA 2Y9ZA 4U0AA 2AXTE 3DS0A 3LRYA 1N7SC 3P8CD 4EI2A 3MIWA 1VHNA 3HD7B 4L74A 1SQXE 2ZT9D 3A0BH 3MHVA 1FJKA 4GKGA 1BE3D 1AV1A 1PP9D 1PP9G 1KD1Q 1JMMA 3RL0B 2HODA 3E2DA 1MZ8A 3MGNA 1KFNA 3IAOA 1RO2A 1KILD 2W27A 1EXIA 2C0XA 3ZDMA 1KFMA 3RK2D 2L91A 5B5EH 5DJUB 5KTBA 1NTZD 4BPHA 3MGEA 2KOSA 1LTTC 1BDCA 4H44B 1FJPA 1X22A 1EZVD 5EW5E 2NPSC 1L0LK 1EZVG 1IMPA 4L73A 2FVAA 5APUA 2JJLA 2L4BA 1KQLA 4W7YA 2Q9IA 3L71G 1GL2C 2PEIA 4C7RA 2RH0A 5C39A 3N7NA 3H1IJ 1RH5B 1RNIA 2QA4P 2Y9YA 3P8CE 2R32A 4H0LB 1KYOH 2LR2A 3RGUA 5KAFE 1DX7A 3FWNA 4TLFA 2IZ1A 5CCHD 2HPCB 1BE3E 1G2CA 5B66H 5BU5A 4ZKUA 3RL0C 1KN7A 3G28A 1KILE 1L4AD 1LP1A 3HUSB 5AW1B 1L4AA 4C46A 5GTIE 4ZKPA 1EXJA 1NTZE 3EFFK 3M9QA 4H44C 4R4LA 3DS3A 1SQVK 1L2PA 1NU1E 1P84D 3AE9C 1R5SA 1S3JA 3C1LA 1ZV8A 2O01N 1T2KC 3L74D 1JB0J 1U57A 4YXDC 1MV8A 3CWBJ 1KV4A 2C9NY 2YIUB 4WVZA 3CCQP 2AXTH 1AYIA 1U7JA 4H0LC 2NO8A 1LNQA 4U0DA 3H1IG 1FR2A 3CCVP 2OARA 4F37A 1Q86Q 1PIXA 1VQ5P 3MUDC 3BVHA 5AVWB 1OR5A 3WUVA 1ZR4A 2BCCD 2WSEJ 4QMAA 1AVYA 3CMAP 1DD4A 1M56D 1RHZB 1DD3A 3OAKA 1KQGB 4COPA 3HRNA 2K92A 2HYNA 3HUSC 1YJNP 4N78D 1A43A 2KI7B 2L5GB 1N2DC 1NOHA 1NTKJ 2QEXP 1SQPJ 2V7QJ 2KYVA 3H1LD 3AEFC 1LTJA 1QRJA 3P05A 1FZAA 2FY8A 1BGYJ 3P32A 4UB8H 2KOOA 4XFYA 3C9IA 1Q7YQ 1J2JB 2Z5IA 2QNWA 3L74E 4GODA 4PWVB 1OVUA 2YIUC 1LJ2A 2VLPA 2LKMA 2WMMA 2MVVA 5CBOA 2JYGA 2E1MA 1K04A 3CWBD 2SPZA 1H88A 3CWBG 2Z46A 4XFZA 3G1IA 2O01H 5KAFH 3G4SP 1M1JB 1UJZA 2BCCE 5CJ4A 1OFCX 4K35A 1OX3A 2JB0A 5HV8A 2ZYGA 2O1KA 1Z56A 4WWIA 2ZXEB 1N7SD 4N78E 5GTIH 1N7SA 3SFEC 1VQ6P 1HJ0A 3DS1A 4WYMA 2IYOA 3H1LE 3TGUJ 3EJEA 1FZGA 4GIFA 3VN0A 1NTKD 1NTKG 3L72J 1SQPD 2HODB 1SQPG 3CPWO 1PEQA 1ZR2A 2AXCA 1BGYD 4WY4C 1URQA 1BGYG 1IUQA 4YXWH 4AQRD 5CBNA 3H1KJ 1A02J 4CA3A 1SQQJ 1SVFA 1L0HA 1LWUA 1E0HA 1E5WA 3CWBE 5APYA 3VRLC 1WT6A 3SWFA 3AE2C 2NPSD 2MKVA 4IFMA 2JDIH 1KQFB 1EIAA 1M1JC 2M0BA 2KOGA 1DNYA 2XV6A 5KLVD 3Q2YA 1GDTA 3V6IA 2M5RA 1W2BO 1JY2O 1GL2D 4ZMDA 3BRVB 5BS2A 1JNMA 1VQKP 2QJPC 3C8VA 4GDOA 1JY2P 1RF0A 3VP9A 1IK9A 4N3YB 3U59A 1PL5A 2D2CC 1G2CB 4GOEA 3SWKA 2KP8A 1NTKE 4HB1A 5CZDB 1SQPE 2EFJA 3TGUD 3TGUG 1EDKA 1L0ND 3H1JD 3RL0D 1BGYE 3L72D 3L72G 2GZIA 1Y8AA 3SFDC 3D70A 1OW7A 3W68A 2YXQB 4H13B 3Q3DA 3H1KD 2J58A 2GDWA 3H1KG 1HUCA 2KZJA 5DJTB 1SQQG 2QRXA 2QE7H 4H44D 4JBZA 1ZP0C 3V2PA 1K8AQ 2LTEA 1S4XA 1DIPA 2AEFA 3GF3A 2JKVA 4L76A 3A5TA 1NVOA 4GR6A 2H7HA 5KLVE 3WMM0 2WSFH 4BPFA 3LIDA 3FXEA 1T2KD 5AW9B 1EQ7A 2IDBA 1IO4A 2PNGA 4PH1A 4H0LD 2Q5UA 1AA0A 2AFEA 3HE4A 2MJZA 2P9XA 3A0HH 3E7KA 5KKZB 1M6EX 3NMDA 1K73Q 2FHSC 2FVFA 1GTWA 4OGQC 1X0TA 3MUDA 1AUMA 4EOTA 5AW2B 1L0NE 3H1JE 2R3SA 2N9YB 4IFDK 3H6PA 4KT0J 1S9KD 2C9LY 3M0DA 1Q82Q 4H13C 5TISE 3H1KE 4WB4A 3A0BE 1RQUA 1LTJB 1Z6MA 4LGDE 2I1KA 1GU4A 1LTIC 2EIAA 4OVNF 3WUTA 1FOSE 2EG5A 1EMVA 3PJSK 2E5YA 5BVZA 1VQPP 2R5BA 1FC2C 4GT1A 2BQ1E 3FXDA 2GYKA 5EFWB 1AQ5A 1JUNA 3AEDC 5AVUB 1PEOA 3JCUE 1LTSC 4LC1A 5KKZC 2QG4A 3V2RA 2W6JH 4B86A 3NY7B 2AEMA 2FYUD 3AE6C 5AVVB 1SFCC 2K0DX 1M57D 2IPPA 3SSUA 3Q1MA 1S9KE 4YPCA 2O01J 3MTUE 3B5NB 1N7SB 3II6A 3G26A 1BE3J 1LTJC 1FDOA 2M8NA 1SLQA 5AVTB 3TNUA 1T3UA 4IL6X 2BHVA 1URQB 3RG2A 3E1IA 2JQ4A 4WY4D 4AYCA 4WY4A 1NTZJ 3KXDA 1Q2NA 2AFDA 1LWUB 2PFXA 1L0LJ 1VQNP 1NU1J 2BEQD 5APTA 3CXHI 4D6TJ 2FACA 2XDJA 2LXBA 3H47A 2OYIA 2FYUE 5AW6B 4PD4D 1N73A 3T97B 2K37A 4XFJA 3B5NC 1KQSO 5TISH 4MRTC 2P58A 2Z5HA 2M8LA 2IFNA 1CI6A 1GXHA 2D2CD 1XTGB 1BE3G 1RY3A 2GZGA 1ZW0A 2QVAA 5AW8B 1GK6A 1LTGC 1URQC 4AUWA 3CI9A 4DOJA 2C0WA 1RQVA 2KGEA 1SQBK 1FZCB 2FBWC 1LWUC 1YJ9P 3L75E 1QEXA 2JO1A 1A02F 2RKLA 1NTZG 2NRGA 3JCUH 3CCUP 1L0LD 3RL0g 2KSEA 1L0LG 2M3EA 3P7KA 1FAVA 4EIJA 1FOSF 1NU1D 5KAIE 1NU1G 4UB8E 4JF7A 1IFIA 3EQ2A 1OVRA 3L74J 4D6TD 1YIJP 2FADA 2JGPA 3L70D 3LIEA 4PD4E 3GF7A 1YQ3C 3WUUA 4COCA 4LLHA 2RN0A 3BCCJ 1RF0C 3CX5D 5AW7B 3B5IA 3HE4B 4JYCA 1KTMA 1LT1A 3G1GA 2WQYC 1A8OA 3L36A 2BCCJ 3HYBA 2LL8A 2WSFJ 2P7JA 2Q6QA 2ZYDA 1BAJA 5K5GB 4OGQD 4EDFA 5AVSB 4I7ZB 4PXHB 3VOPA 4UB6E 1SQBE 1FZCC 3H1LJ 4HKZH 4H13D 2QSIA 1JY2N 3V5BA 5APXA 4U0BA 2N1TA 1SQVD 1L0LE 2JU2A 2PEJA 4QNBA 2ROQA 2P67A 5M1BA 4D6TE 3DS4A 3ABVC 1HTLC 3L70E 2G8YA 1NYHA 3H4EA 3L74G 1K05A 5HGMA 2KGDA 1QVGO 1CSBA 2PAJA 3CX5E 1BSHA 1KB9I 3BCCD 4XE5B 3S4RA 3BCCG 2N5IA 1PGJA 4OH8B 1FDIA 2KW2A 1NQ4A 3IN6A 1LTAC 2J59M 1M6NA 2E5TA 2BCCG 3G9RA 4H2XC 1DH3A 1SFCD 1SFCA 4I7ZC 3VMZA 1H89A 2OTLP 1DEEG 1MFZA 3M0DC 1VQ7P 1PGQA 1M1KQ 1FZFA 3A3YB 3Q20A 2L0QA 2K1AA 3AE1C 3TNUB 3H1LG 3CXHD 2JO0A 1SQVE 5AVRB 2O3JA 5KAIH 3U1CA 2K9JB 4WY4B 3G71P 2YO3A 2Z45A 2JWAA 4PD4H 4BPGA 2YKOA 5E79E 2YNYA 7CEIA 3GJNA 3Q5PA 1GU5A 1KLPA 3BCCE 3CCMP 3DS2A 3NFQA 2LF4A 2VSQA 2OYIB 3PP5A 5KLVJ 5L8RJ 1XTCC 2PENA 1PPJD 2WT7A 1N73B 2KWLA 1KYOI 1ZOYC 5GTHE 1U7MA 2OTKE 2LXCB 1CEIA 1CW5A 2WZ7A 1HVVA 4UB6H 2QJPB 3B5ND 2YKQA 2LPKA 1NGMB 3OA7A 3B5NA 3ITKA 4NPDA 2WPTA 4HKGA 3A7OA 3A0HE 2FQ2A 2M5AA 1CI6B 3EWKA 3B4QA 1QL2A 4U0FA 1LTBC 2D2CB 1L0NJ 1VF5C 1JY3O 1WMKA 3CXHE 3H1JJ 3MZWB 1DEBA 2KORA 2GDYA 3CE7A 1NHLA 3MD0A 3H1HD 1URQD 1JY3P 2IBZI 2IZ0A 3CLQA 2E76D 4R0MA 1EOQA 2ZVNB 3AE3C 1VQMP 5APWA 3AE4C 1S5LE 1VQ8P 1OW6A 3H32A 3EFGA 2JYLA 3CX5H 1GMJA 2DGYA 3GZMA 1IMQA 1JTHA 1H0TB 5BU8B 5CHXA 5H2FH 2OYIC 4KJMA 3EJDA 3GW6A 2CGQA 1NWQA 2VLNA 1PPJE 1N73C 5KLVG 1PV3A 1QGKB 3PRJA 1ZRTD 2A45I 3WU2E 1L0IA 1HY8A 3T97A 2RMZA 5HGNA 1NH4A 3HTKB 3GZLA 2B88A 2A06D 1NAYA 1KORA 1J1EC 1DV5A 1Y9BA 3VYIA 1RE3A 4U3FD 1AJYA 1VQ9P 2CPSA 1ZN5A 1RF1A 4OGQB 1GPJA 2FKWB 2BASA 2XNXA 5KLIC 4C7NA 1L0NG 2Q3EA 3H1HE 3H1JG 3M9BA 5EJDA 3CCRP 2MD9A 4HJGH 3G29A 1M90Q 4U0EA 2J5UA 1FZCA 5E79H 1F80D 3S1KA 1OWAA 1GW4A 2N1TB 4Y99B 3CMEP 1PGOA 1HBWA 1GZLA 2JEEA 2FFDA 3V2NA 3G0VA 4PV1B 3LMOA 2CNRA 3CCJP 2WSCH 3O6QA 5GTHH 2K0YA 4M0IA 1IFMA 1ZRTE 1SQQK 1X9VA 1UNKA 2PGDA 2PP6A 3L73D 2JP3A 2A06E 2GZJA 2FAEA 2FYUJ 1YTZT 2H8PD 4U3FE 3FX0A 3CXHH 4BXLA 3GLMA 3G3ZA 2PEOA 4RJTA 1SFCB 2R5DA 1T8ZA 1CZQA 2FYNB 3IR9A 1EZVI 2LIWA 2XNDH 1PFIA 1IZNB 2B9BA 1S5LH 1GD2E 1SS1A 2DW3A 4XRQA 1KB9E 2N1TC 4Y99C 2QM8A 1S72P 2LIUA 4K3AA 1OMIA 2JBGA 1SP4A 2AEJA 4PV1C 4M3LA 3L4FA 2VLOA 4EYYQ 5KP8B 2XXMA 3GHGA 3L75J 1NTMK 2KK7A 3PTZA 3WU2H 2Q3IA 1HH0A 3K5BA 1J1DB 3L73E 1YI2P 2WPSA 4HH2A 1MZ9A 2Q7CA 2E43A 4OWFA 2KLUA 3GG2A 3BATA 2HLOA 2WT7B 2FYUG 2FYZA 2K88A 1W5CE 1G1JA 4JQ0D 1T8KA 2FYNC 3PH0A 4W80A 1BCCJ 4XROA 2KNCB 5KJ7A 1P84I 1LT9B 1YJWP 2M5AB 2ITAA 4U0CA 3F89A 1OZHA 1VF5D 3G21A 4GOFA 3NTNA 1SQBJ 2K93A 3EJBA 1X8YA 1HWTC 2N6YA 2K9JA 2FXOA 2OGUA 4JYBA 2LOLA 2E76B 1NTME 1HGZA 1SQXK 3B8EB 3L35A 3WBHA 1USDA 3B4SA 2KGAA 1J1DC 3CXCO 3H32B 2ZYAA 3L75D 3M1MA 3L75G 5APQA 2EHSA 1JTHB
chains in the Genus database with same CATH topology
1RO2A 1VQOP 4XRQA 2BQ1E 3CCQP 5BS1A 1KQSO 1S72P 3CCMP 1PEOA 3DS2A 5JPAA 4U0BA 2LF4A 1VQ6P 2M8LA 3HZQA 1VQ9P 4U0DA 1M74A 3DS1A 4WYMA 5F2NA 3CCVP 3MGEA 2OARA 2Z44A 2PEJA 2PENA 4QNBA 1Q86Q 4IPYA 1K8AQ 2XXMA 3DS4A 1VQ5P 3CCRP 5DCKA 1PEMA 3G29A 3CMAP 3CPWO 4GR6A 1M90Q 3H4EA 1PEQA 4U0EA 3CCLP 2CWOA 3I56P 1IUQA 2PEQA 5HGMA 1YI2P 1VQLP 1YITP 1QVFO 1QVGO 3CD6P 1KC8Q 1E6JP 2PEIA 5I4TG 4COPA 1YJ9P 3CC4P 5F2OA 1YJNP 1RNIA 4PH1A 2QA4P 3CMEP 1A43A 3DS5A 3G26A 3CCEP 3VRLC 4U0FA 2P9XA 3CCSP 3CCUP 3G0VA 3G6EP 1M6EX 2M8NA 2QEXP 3OW2O 5F2KA 3CCJP 1M6NA 1K73Q 1QRJA 1RO0A 2XT1A 1EIAA 1YIJP 3P05A 1PEUA 2BHVA 4M0IA 3H0DA 1N8RQ 1AUMA 2KODA 1YHQP 3CC7P 2XV6A 4XFYA 4XROA 1D1DA 2ONTA 1EOQA 4COCA 5HGLA 1VQMP 1Q7YQ 2OTLP 1K30A 3DTJA 1W2BO 1YJWP 1VQ7P 1M1KQ 2OTJP 3G28A 3NTEA 1VQ8P 3Q20A 2L6EA 2JYLA 4U0CA 3B5IA 5BS2A 2PEKA 2DGYA 4U0AA 1VQKP 3DPHA 3DS0A 1Q82Q 3G1GA 1ZMBA 1VQNP 3CC2P 3LRYA 2JYGA 1A8OA 2E1MA 3RG6C 3G21A 3HYBA 4GR2A 2M8PA 2JO0A 1K9MQ 2BUOA 2Z46A 3H47A 5HGOA 4XFZA 3G1IA 1Q81Q 1BAJA 2EIAA 2PEOA 3DS3A 4XFXA 3G4SP 2PEMA 2PY8A 3G71P 2EFJA 3WBHA 3I55P 2Z45A 2EG5A 1VQ4P 5HGNA 3CXCO 1NJIQ 3M1MA 1VQPP 1KD1Q 1JJ2O 3E2DA 4PH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 Q;  1VQO P;  1YIJ P;  3CCL P;  1K9M Q;  3CCQ P;  1N8R Q;  3I56 P;  1KQS O;  1S72 P;  1YI2 P;  1VQL P;  3CCM P;  1YHQ P;  1YIT P;  1Q81 Q;  1QVG O;  3CC7 P;  1QVF O;  1KC8 Q;  3CD6 P;  1YJ9 P;  1VQ6 P;  3CC4 P;  1VQ9 P;  1Q7Y Q;  2OTL P;  1VQM P;  3G4S P;  1YJN P;  3CCV P;  1W2B O;  2QA4 P;  3G71 P;  1YJW P;  1Q86 Q;  1M1K Q;  1VQ7 P;  3CME P;  2OTJ P;  1VQ8 P;  3I55 P;  3CCE P;  1VQ4 P;  1K8A Q;  3CXC O;  1NJI Q;  3CCS P;  3CCU P;  1VQ5 P;  1VQK P;  1VQP P;  1KD1 Q;  3CCR P;  1JJ2 O;  3G6E P;  1Q82 Q;  2QEX P;  3OW2 O;  1VQN P;  3CC2 P;  3CCJ P;  1K73 Q;  3CMA P;  3CPW O; 
#chains in the Genus database with same CATH topology
 2W90 A;  3M9H A;  2R3C A;  1MFT A;  1OW8 A;  3L70 J;  2W6B A;  1IC2 A;  2P10 A;  5TJH A;  1JM0 A;  2M3B A;  1QLE D;  3IF4 A;  5KP7 B;  2K9Y A;  2KR5 A;  4IPY A;  1TU3 F;  3AE8 C;  1T3J A;  2LKI A;  1PEM A;  1GXG A;  2HR3 A;  3KYQ A;  2I1J A;  3IFM A;  5AVZ B;  2LML A;  1LT9 C;  1QVF O;  3CD6 P;  1BCC D;  4RES B;  2KG9 A;  1KB9 H;  2OYH A;  1RF1 B;  2E42 A;  3R4Y A;  4H2W C;  3QWO C;  3P8M C;  3JC2 2;  4C7N B;  2YMY A;  2KS1 A;  1R5L A;  3V4W A;  2E75 B;  2E76 C;  5AW5 B;  1SQB D;  1EDI A;  1SQB G;  3OJA B;  2JR8 A;  1IFD A;  5HGL A;  3DTJ A;  1SQV J;  2XU6 A;  2KZI A;  4IFF A;  2JU1 A;  3RK3 B;  3DPH A;  2K94 A;  2FFD B;  3D71 A;  1H0T A;  4DZO A;  1M7L A;  1KIL A;  2DNW A;  2BUO A;  2E74 C;  3LW5 H;  3O6Q B;  4D6T G;  2WTY A;  1VL2 A;  3L70 G;  1NTZ K;  1ZME C;  1JY3 N;  4NPF X;  2WPR A;  3HTK A;  1NU1 K;  2WIT A;  2QM7 A;  2KSJ A;  1BCC E;  4PH0 A;  1RE3 C;  2WSC J;  1D7M A;  3L71 D;  1RF1 C;  2N6Z A;  4IZ6 A;  3HE5 A;  2I8D A;  2H43 A;  2Z44 A;  3UIA A;  1T6A A;  2E75 C;  2MY5 A;  3HD7 C;  2W6A A;  1VPC A;  4I1L A;  3VTP C;  5CCG C;  2GZE A;  5CCH A;  2B89 A;  1UII A;  1NKN A;  3VMA A;  1PP9 E;  1YTZ I;  2N1T D;  3RK3 C;  2FFD C;  1SQV G;  1GK4 A;  4PV1 D;  2XKM A;  3GHG B;  5CJ0 A;  2L22 A;  3TYY A;  4O9B A;  2XT1 A;  1PEU A;  1N7L A;  3H0D A;  3CC7 P;  1EZV E;  2YKP A;  5AVX B;  3NTE A;  5H2F E;  2WPV B;  2H88 C;  2L9F A;  4UHP B;  1NKZ B;  3L71 E;  4Y28 J;  2Y0D A;  3CC2 P;  1JCD A;  4H2Y C;  4W7Z A;  1OVV A;  1Q81 Q;  1IJD B;  3H1I D;  4KHX A;  2PEM A;  1NAF A;  2PY8 A;  2A45 H;  3I55 P;  1AVO A;  2GZF A;  4MN4 C;  1FS0 E;  1NJI Q;  3RBX A;  3TK1 A;  1JJ2 O;  2GDX A;  5AW3 B;  3KDP B;  3VMX A;  2MR8 A;  4BRY A;  1VF5 B;  5BS1 A;  2XZ0 D;  3H1H J;  1MKM A;  2KUB A;  5JPA A;  2W8Z A;  2N5H A;  3GHG C;  3D6Z A;  2PRR A;  3FWL A;  5AVY B;  2IYP A;  4IOI H;  2Z4E A;  5AVQ B;  2VRS A;  2KLV A;  1P84 E;  2HG5 D;  2KG6 A;  3I56 P;  1VQL P;  2WWW A;  2KXP B;  1OXZ A;  1EC5 A;  4DCK A;  2WPQ A;  1N86 A;  2YO2 A;  3Q5R A;  2M8R A;  2G3A A;  1Y47 A;  2H89 C;  2O1J A;  1PPJ G;  3V2Q A;  2FQ1 A;  2K3R A;  3H1I E;  1RE4 C;  2QJY B;  5KJ7 C;  2FXP A;  2CG5 B;  3AE5 C;  1D1D A;  1EDL A;  1NO4 A;  2ONT A;  4ASW A;  2KNC A;  4U3F J;  1LT9 A;  1J1E B;  2OYH B;  2P2U A;  4U7J A;  2OQQ A;  2QJK B;  3SWY A;  2KS1 B;  1ZLL A;  4GR2 A;  5KLI B;  1K9M Q;  2V4H A;  3H1H G;  1IFJ A;  1LGH B;  2ZT9 B;  2EHT A;  4I2L C;  4ASV A;  2IX7 C;  1HGV A;  1W2E A;  2Q1K A;  2W83 C;  1NTK K;  4Z1M H;  2FVE A;  3AEC C;  1SQP K;  1MUU A;  1EDJ A;  2B87 A;  1FU1 A;  3L37 A;  1VQO P;  4CPG A;  1VKU A;  1KIL B;  3RBZ A;  2GA1 A;  2XV5 A;  3N4X A;  3RK2 B;  3HZQ A;  2E74 D;  3CL3 D;  2POH A;  2UWJ E;  3E1R A;  1YQ4 C;  3KPE A;  2R44 A;  3PHL A;  3VP8 A;  3KZI E;  3L73 J;  2QJY C;  1AQT A;  3M0A A;  1BDD A;  1QL1 A;  2NPS A;  2A06 G;  3PLN A;  3LW5 J;  2OYH C;  1YIT P;  1KC8 Q;  2P1J A;  1E6J P;  3NXS A;  5KLV K;  2MF4 A;  2BEZ F;  3HE5 B;  4U3F G;  1GL2 A;  2QJK C;  3TF5 A;  1QX8 A;  2KOP A;  1WRG A;  2KGC A;  2FQ0 A;  2Y0C A;  1ZXG A;  2HFE D;  2ERH A;  2E75 D;  3AEA C;  2ZT9 C;  3M06 A;  2JWD A;  3BAS A;  3HD7 D;  4RO0 A;  2N9B A;  2KOD A;  3HD7 A;  3V4Q A;  1YHQ P;  1KMI Z;  5HVC A;  1IFN A;  1HQB A;  5CCG D;  4IL6 E;  5CCG A;  1K30 A;  3U1A A;  3QH9 A;  1KB9 D;  1P84 H;  1AF8 A;  2OTJ P;  1L0N K;  4PD4 I;  3RK3 D;  2L6E A;  2PEK A;  1LP1 B;  4QKO A;  1KIL C;  2CPB A;  1L4A B;  3A2A A;  1ACP A;  3O8Z A;  1NTM J;  3RG6 C;  3RK2 C;  2M8P A;  2ZXX A;  4BWN A;  3Q5S A;  5HGO A;  4A7P A;  4PJ0 E;  1FDM A;  1SQQ D;  3AE7 C;  2X2B A;  1ZNV A;  1JCC A;  2AF8 A;  3S9O A;  3AEE C;  1BSN A;  3L73 G;  1KZU B;  2K5X A;  1VQ4 P;  3JSV C;  3AEB C;  1H8A A;  2ZVO B;  2GUS A;  3B71 A;  2KOQ A;  4DJG A;  2Y0E A;  3GKL C;  1R8E A;  3M91 A;  2NZ2 A;  1M74 A;  4YTP C;  2MVU A;  4I6M C;  2OYO A;  2GUV A;  3W67 A;  3D6Y A;  3KHU A;  1JO5 A;  2QIW A;  5CCH C;  5DCK A;  1OIP A;  2HPC A;  5APV A;  4BRY B;  3CCL P;  2CWO A;  2FXM A;  1GW3 A;  3TGU E;  3USS A;  4NPE A;  4XA4 A;  3RK3 E;  1HF9 A;  3CC4 P;  2MR7 A;  3L72 E;  1L4A C;  2N98 A;  2KG8 A;  3DS5 A;  3CX5 I;  3CCE P;  1AFO A;  1SQX J;  3CCS P;  3HUS A;  1KYO D;  2KIK A;  1FZE A;  3G6E P;  1FZB A;  1NTM D;  5F2K A;  1NTM G;  3KZI H;  1SQQ E;  1RO0 A;  1N8R Q;  2VLQ A;  1S5L X;  5APS A;  1IK7 A;  3GMA A;  2WSS H;  4TT3 H;  2JAZ A;  2ZFC A;  1FE6 A;  1JMB A;  2N50 A;  5AW0 B;  2YMK A;  1PZQ A;  2WSE H;  1ZMB A;  5B5E E;  1S1C X;  5KP6 B;  2YXR B;  4L75 A;  2AVA A;  2IBZ D;  2KB7 P;  2IBZ G;  1RE4 A;  2CK3 H;  4JPZ B;  4XFX A;  5KJ7 D;  1FBM A;  3VMY A;  2FYU K;  3I5C A;  2XZ1 C;  1YYC A;  4IL6 H;  2V7Q H;  4RKU J;  1HJB A;  2IFM A;  5F2N A;  2K2Q A;  3AEG C;  2WVR A;  3MP7 B;  1USE A;  1IFP A;  3TDK A;  4ZNC A;  1JEK A;  4WBA A;  5CMZ A;  1E79 H;  2CQ8 A;  1KYO E;  1UIX A;  4HYT B;  4NEO A;  1X79 B;  4PJ0 H;  1SQX D;  1BXI A;  1S2E A;  2A45 G;  1SQX G;  2ZJS E;  1PP9 J;  2ZAE B;  2K0X A;  5B66 E;  4N6J A;  4R4M A;  2B87 B;  1M8O B;  1YBK A;  1X3O A;  2PEQ A;  1JOC A;  5I4T G;  5F2O A;  1VDF A;  3F5H A;  4DT0 A;  2E74 B;  2XZR A;  3H25 A;  3U43 A;  4DG9 A;  3OW2 O;  2IBZ E;  3R2P A;  2NPS B;  1G1I A;  2GM4 A;  3L71 J;  1BCC G;  1PGP A;  3BRT B;  1M1J A;  3KQG A;  5AW4 B;  1GL2 B;  1Q90 D;  3FGA D;  3TSI A;  2Y9Z A;  4U0A A;  2AXT E;  3DS0 A;  3LRY A;  1N7S C;  3P8C D;  4EI2 A;  3MIW A;  1VHN A;  3HD7 B;  4L74 A;  1SQX E;  2ZT9 D;  3A0B H;  3MHV A;  1FJK A;  4GKG A;  1BE3 D;  1AV1 A;  1PP9 D;  1PP9 G;  1KD1 Q;  1JMM A;  3RL0 B;  2HOD A;  3E2D A;  1MZ8 A;  3MGN A;  1KFN A;  3IAO A;  1RO2 A;  1KIL D;  2W27 A;  1EXI A;  2C0X A;  3ZDM A;  1KFM A;  3RK2 D;  2L91 A;  5B5E H;  5DJU B;  5KTB A;  1NTZ D;  4BPH A;  3MGE A;  2KOS A;  1LTT C;  1BDC A;  4H44 B;  1FJP A;  1X22 A;  1EZV D;  5EW5 E;  2NPS C;  1L0L K;  1EZV G;  1IMP A;  4L73 A;  2FVA A;  5APU A;  2JJL A;  2L4B A;  1KQL A;  4W7Y A;  2Q9I A;  3L71 G;  1GL2 C;  2PEI A;  4C7R A;  2RH0 A;  5C39 A;  3N7N A;  3H1I J;  1RH5 B;  1RNI A;  2QA4 P;  2Y9Y A;  3P8C E;  2R32 A;  4H0L B;  1KYO H;  2LR2 A;  3RGU A;  5KAF E;  1DX7 A;  3FWN A;  4TLF A;  2IZ1 A;  5CCH D;  2HPC B;  1BE3 E;  1G2C A;  5B66 H;  5BU5 A;  4ZKU A;  3RL0 C;  1KN7 A;  3G28 A;  1KIL E;  1L4A D;  1LP1 A;  3HUS B;  5AW1 B;  1L4A A;  4C46 A;  5GTI E;  4ZKP A;  1EXJ A;  1NTZ E;  3EFF K;  3M9Q A;  4H44 C;  4R4L A;  3DS3 A;  1SQV K;  1L2P A;  1NU1 E;  1P84 D;  3AE9 C;  1R5S A;  1S3J A;  3C1L A;  1ZV8 A;  2O01 N;  1T2K C;  3L74 D;  1JB0 J;  1U57 A;  4YXD C;  1MV8 A;  3CWB J;  1KV4 A;  2C9N Y;  2YIU B;  4WVZ A;  3CCQ P;  2AXT H;  1AYI A;  1U7J A;  4H0L C;  2NO8 A;  1LNQ A;  4U0D A;  3H1I G;  1FR2 A;  3CCV P;  2OAR A;  4F37 A;  1Q86 Q;  1PIX A;  1VQ5 P;  3MUD C;  3BVH A;  5AVW B;  1OR5 A;  3WUV A;  1ZR4 A;  2BCC D;  2WSE J;  4QMA A;  1AVY A;  3CMA P;  1DD4 A;  1M56 D;  1RHZ B;  1DD3 A;  3OAK A;  1KQG B;  4COP A;  3HRN A;  2K92 A;  2HYN A;  3HUS C;  1YJN P;  4N78 D;  1A43 A;  2KI7 B;  2L5G B;  1N2D C;  1NOH A;  1NTK J;  2QEX P;  1SQP J;  2V7Q J;  2KYV A;  3H1L D;  3AEF C;  1LTJ A;  1QRJ A;  3P05 A;  1FZA A;  2FY8 A;  1BGY J;  3P32 A;  4UB8 H;  2KOO A;  4XFY A;  3C9I A;  1Q7Y Q;  1J2J B;  2Z5I A;  2QNW A;  3L74 E;  4GOD A;  4PWV B;  1OVU A;  2YIU C;  1LJ2 A;  2VLP A;  2LKM A;  2WMM A;  2MVV A;  5CBO A;  2JYG A;  2E1M A;  1K04 A;  3CWB D;  2SPZ A;  1H88 A;  3CWB G;  2Z46 A;  4XFZ A;  3G1I A;  2O01 H;  5KAF H;  3G4S P;  1M1J B;  1UJZ A;  2BCC E;  5CJ4 A;  1OFC X;  4K35 A;  1OX3 A;  2JB0 A;  5HV8 A;  2ZYG A;  2O1K A;  1Z56 A;  4WWI A;  2ZXE B;  1N7S D;  4N78 E;  5GTI H;  1N7S A;  3SFE C;  1VQ6 P;  1HJ0 A;  3DS1 A;  4WYM A;  2IYO A;  3H1L E;  3TGU J;  3EJE A;  1FZG A;  4GIF A;  3VN0 A;  1NTK D;  1NTK G;  3L72 J;  1SQP D;  2HOD B;  1SQP G;  3CPW O;  1PEQ A;  1ZR2 A;  2AXC A;  1BGY D;  4WY4 C;  1URQ A;  1BGY G;  1IUQ A;  4YXW H;  4AQR D;  5CBN A;  3H1K J;  1A02 J;  4CA3 A;  1SQQ J;  1SVF A;  1L0H A;  1LWU A;  1E0H A;  1E5W A;  3CWB E;  5APY A;  3VRL C;  1WT6 A;  3SWF A;  3AE2 C;  2NPS D;  2MKV A;  4IFM A;  2JDI H;  1KQF B;  1EIA A;  1M1J C;  2M0B A;  2KOG A;  1DNY A;  2XV6 A;  5KLV D;  3Q2Y A;  1GDT A;  3V6I A;  2M5R A;  1W2B O;  1JY2 O;  1GL2 D;  4ZMD A;  3BRV B;  5BS2 A;  1JNM A;  1VQK P;  2QJP C;  3C8V A;  4GDO A;  1JY2 P;  1RF0 A;  3VP9 A;  1IK9 A;  4N3Y B;  3U59 A;  1PL5 A;  2D2C C;  1G2C B;  4GOE A;  3SWK A;  2KP8 A;  1NTK E;  4HB1 A;  5CZD B;  1SQP E;  2EFJ A;  3TGU D;  3TGU G;  1EDK A;  1L0N D;  3H1J D;  3RL0 D;  1BGY E;  3L72 D;  3L72 G;  2GZI A;  1Y8A A;  3SFD C;  3D70 A;  1OW7 A;  3W68 A;  2YXQ B;  4H13 B;  3Q3D A;  3H1K D;  2J58 A;  2GDW A;  3H1K G;  1HUC A;  2KZJ A;  5DJT B;  1SQQ G;  2QRX A;  2QE7 H;  4H44 D;  4JBZ A;  1ZP0 C;  3V2P A;  1K8A Q;  2LTE A;  1S4X A;  1DIP A;  2AEF A;  3GF3 A;  2JKV A;  4L76 A;  3A5T A;  1NVO A;  4GR6 A;  2H7H A;  5KLV E;  3WMM 0;  2WSF H;  4BPF A;  3LID A;  3FXE A;  1T2K D;  5AW9 B;  1EQ7 A;  2IDB A;  1IO4 A;  2PNG A;  4PH1 A;  4H0L D;  2Q5U A;  1AA0 A;  2AFE A;  3HE4 A;  2MJZ A;  2P9X A;  3A0H H;  3E7K A;  5KKZ B;  1M6E X;  3NMD A;  1K73 Q;  2FHS C;  2FVF A;  1GTW A;  4OGQ C;  1X0T A;  3MUD A;  1AUM A;  4EOT A;  5AW2 B;  1L0N E;  3H1J E;  2R3S A;  2N9Y B;  4IFD K;  3H6P A;  4KT0 J;  1S9K D;  2C9L Y;  3M0D A;  1Q82 Q;  4H13 C;  5TIS E;  3H1K E;  4WB4 A;  3A0B E;  1RQU A;  1LTJ B;  1Z6M A;  4LGD E;  2I1K A;  1GU4 A;  1LTI C;  2EIA A;  4OVN F;  3WUT A;  1FOS E;  2EG5 A;  1EMV A;  3PJS K;  2E5Y A;  5BVZ A;  1VQP P;  2R5B A;  1FC2 C;  4GT1 A;  2BQ1 E;  3FXD A;  2GYK A;  5EFW B;  1AQ5 A;  1JUN A;  3AED C;  5AVU B;  1PEO A;  3JCU E;  1LTS C;  4LC1 A;  5KKZ C;  2QG4 A;  3V2R A;  2W6J H;  4B86 A;  3NY7 B;  2AEM A;  2FYU D;  3AE6 C;  5AVV B;  1SFC C;  2K0D X;  1M57 D;  2IPP A;  3SSU A;  3Q1M A;  1S9K E;  4YPC A;  2O01 J;  3MTU E;  3B5N B;  1N7S B;  3II6 A;  3G26 A;  1BE3 J;  1LTJ C;  1FDO A;  2M8N A;  1SLQ A;  5AVT B;  3TNU A;  1T3U A;  4IL6 X;  2BHV A;  1URQ B;  3RG2 A;  3E1I A;  2JQ4 A;  4WY4 D;  4AYC A;  4WY4 A;  1NTZ J;  3KXD A;  1Q2N A;  2AFD A;  1LWU B;  2PFX A;  1L0L J;  1VQN P;  1NU1 J;  2BEQ D;  5APT A;  3CXH I;  4D6T J;  2FAC A;  2XDJ A;  2LXB A;  3H47 A;  2OYI A;  2FYU E;  5AW6 B;  4PD4 D;  1N73 A;  3T97 B;  2K37 A;  4XFJ A;  3B5N C;  1KQS O;  5TIS H;  4MRT C;  2P58 A;  2Z5H A;  2M8L A;  2IFN A;  1CI6 A;  1GXH A;  2D2C D;  1XTG B;  1BE3 G;  1RY3 A;  2GZG A;  1ZW0 A;  2QVA A;  5AW8 B;  1GK6 A;  1LTG C;  1URQ C;  4AUW A;  3CI9 A;  4DOJ A;  2C0W A;  1RQV A;  2KGE A;  1SQB K;  1FZC B;  2FBW C;  1LWU C;  1YJ9 P;  3L75 E;  1QEX A;  2JO1 A;  1A02 F;  2RKL A;  1NTZ G;  2NRG A;  3JCU H;  3CCU P;  1L0L D;  3RL0 g;  2KSE A;  1L0L G;  2M3E A;  3P7K A;  1FAV A;  4EIJ A;  1FOS F;  1NU1 D;  5KAI E;  1NU1 G;  4UB8 E;  4JF7 A;  1IFI A;  3EQ2 A;  1OVR A;  3L74 J;  4D6T D;  1YIJ P;  2FAD A;  2JGP A;  3L70 D;  3LIE A;  4PD4 E;  3GF7 A;  1YQ3 C;  3WUU A;  4COC A;  4LLH A;  2RN0 A;  3BCC J;  1RF0 C;  3CX5 D;  5AW7 B;  3B5I A;  3HE4 B;  4JYC A;  1KTM A;  1LT1 A;  3G1G A;  2WQY C;  1A8O A;  3L36 A;  2BCC J;  3HYB A;  2LL8 A;  2WSF J;  2P7J A;  2Q6Q A;  2ZYD A;  1BAJ A;  5K5G B;  4OGQ D;  4EDF A;  5AVS B;  4I7Z B;  4PXH B;  3VOP A;  4UB6 E;  1SQB E;  1FZC C;  3H1L J;  4HKZ H;  4H13 D;  2QSI A;  1JY2 N;  3V5B A;  5APX A;  4U0B A;  2N1T A;  1SQV D;  1L0L E;  2JU2 A;  2PEJ A;  4QNB A;  2ROQ A;  2P67 A;  5M1B A;  4D6T E;  3DS4 A;  3ABV C;  1HTL C;  3L70 E;  2G8Y A;  1NYH A;  3H4E A;  3L74 G;  1K05 A;  5HGM A;  2KGD A;  1QVG O;  1CSB A;  2PAJ A;  3CX5 E;  1BSH A;  1KB9 I;  3BCC D;  4XE5 B;  3S4R A;  3BCC G;  2N5I A;  1PGJ A;  4OH8 B;  1FDI A;  2KW2 A;  1NQ4 A;  3IN6 A;  1LTA C;  2J59 M;  1M6N A;  2E5T A;  2BCC G;  3G9R A;  4H2X C;  1DH3 A;  1SFC D;  1SFC A;  4I7Z C;  3VMZ A;  1H89 A;  2OTL P;  1DEE G;  1MFZ A;  3M0D C;  1VQ7 P;  1PGQ A;  1M1K Q;  1FZF A;  3A3Y B;  3Q20 A;  2L0Q A;  2K1A A;  3AE1 C;  3TNU B;  3H1L G;  3CXH D;  2JO0 A;  1SQV E;  5AVR B;  2O3J A;  5KAI H;  3U1C A;  2K9J B;  4WY4 B;  3G71 P;  2YO3 A;  2Z45 A;  2JWA A;  4PD4 H;  4BPG A;  2YKO A;  5E79 E;  2YNY A;  7CEI A;  3GJN A;  3Q5P A;  1GU5 A;  1KLP A;  3BCC E;  3CCM P;  3DS2 A;  3NFQ A;  2LF4 A;  2VSQ A;  2OYI B;  3PP5 A;  5KLV J;  5L8R J;  1XTC C;  2PEN A;  1PPJ D;  2WT7 A;  1N73 B;  2KWL A;  1KYO I;  1ZOY C;  5GTH E;  1U7M A;  2OTK E;  2LXC B;  1CEI A;  1CW5 A;  2WZ7 A;  1HVV A;  4UB6 H;  2QJP B;  3B5N D;  2YKQ A;  2LPK A;  1NGM B;  3OA7 A;  3B5N A;  3ITK A;  4NPD A;  2WPT A;  4HKG A;  3A7O A;  3A0H E;  2FQ2 A;  2M5A A;  1CI6 B;  3EWK A;  3B4Q A;  1QL2 A;  4U0F A;  1LTB C;  2D2C B;  1L0N J;  1VF5 C;  1JY3 O;  1WMK A;  3CXH E;  3H1J J;  3MZW B;  1DEB A;  2KOR A;  2GDY A;  3CE7 A;  1NHL A;  3MD0 A;  3H1H D;  1URQ D;  1JY3 P;  2IBZ I;  2IZ0 A;  3CLQ A;  2E76 D;  4R0M A;  1EOQ A;  2ZVN B;  3AE3 C;  1VQM P;  5APW A;  3AE4 C;  1S5L E;  1VQ8 P;  1OW6 A;  3H32 A;  3EFG A;  2JYL A;  3CX5 H;  1GMJ A;  2DGY A;  3GZM A;  1IMQ A;  1JTH A;  1H0T B;  5BU8 B;  5CHX A;  5H2F H;  2OYI C;  4KJM A;  3EJD A;  3GW6 A;  2CGQ A;  1NWQ A;  2VLN A;  1PPJ E;  1N73 C;  5KLV G;  1PV3 A;  1QGK B;  3PRJ A;  1ZRT D;  2A45 I;  3WU2 E;  1L0I A;  1HY8 A;  3T97 A;  2RMZ A;  5HGN A;  1NH4 A;  3HTK B;  3GZL A;  2B88 A;  2A06 D;  1NAY A;  1KOR A;  1J1E C;  1DV5 A;  1Y9B A;  3VYI A;  1RE3 A;  4U3F D;  1AJY A;  1VQ9 P;  2CPS A;  1ZN5 A;  1RF1 A;  4OGQ B;  1GPJ A;  2FKW B;  2BAS A;  2XNX A;  5KLI C;  4C7N A;  1L0N G;  2Q3E A;  3H1H E;  3H1J G;  3M9B A;  5EJD A;  3CCR P;  2MD9 A;  4HJG H;  3G29 A;  1M90 Q;  4U0E A;  2J5U A;  1FZC A;  5E79 H;  1F80 D;  3S1K A;  1OWA A;  1GW4 A;  2N1T B;  4Y99 B;  3CME P;  1PGO A;  1HBW A;  1GZL A;  2JEE A;  2FFD A;  3V2N A;  3G0V A;  4PV1 B;  3LMO A;  2CNR A;  3CCJ P;  2WSC H;  3O6Q A;  5GTH H;  2K0Y A;  4M0I A;  1IFM A;  1ZRT E;  1SQQ K;  1X9V A;  1UNK A;  2PGD A;  2PP6 A;  3L73 D;  2JP3 A;  2A06 E;  2GZJ A;  2FAE A;  2FYU J;  1YTZ T;  2H8P D;  4U3F E;  3FX0 A;  3CXH H;  4BXL A;  3GLM A;  3G3Z A;  2PEO A;  4RJT A;  1SFC B;  2R5D A;  1T8Z A;  1CZQ A;  2FYN B;  3IR9 A;  1EZV I;  2LIW A;  2XND H;  1PFI A;  1IZN B;  2B9B A;  1S5L H;  1GD2 E;  1SS1 A;  2DW3 A;  4XRQ A;  1KB9 E;  2N1T C;  4Y99 C;  2QM8 A;  1S72 P;  2LIU A;  4K3A A;  1OMI A;  2JBG A;  1SP4 A;  2AEJ A;  4PV1 C;  4M3L A;  3L4F A;  2VLO A;  4EYY Q;  5KP8 B;  2XXM A;  3GHG A;  3L75 J;  1NTM K;  2KK7 A;  3PTZ A;  3WU2 H;  2Q3I A;  1HH0 A;  3K5B A;  1J1D B;  3L73 E;  1YI2 P;  2WPS A;  4HH2 A;  1MZ9 A;  2Q7C A;  2E43 A;  4OWF A;  2KLU A;  3GG2 A;  3BAT A;  2HLO A;  2WT7 B;  2FYU G;  2FYZ A;  2K88 A;  1W5C E;  1G1J A;  4JQ0 D;  1T8K A;  2FYN C;  3PH0 A;  4W80 A;  1BCC J;  4XRO A;  2KNC B;  5KJ7 A;  1P84 I;  1LT9 B;  1YJW P;  2M5A B;  2ITA A;  4U0C A;  3F89 A;  1OZH A;  1VF5 D;  3G21 A;  4GOF A;  3NTN A;  1SQB J;  2K93 A;  3EJB A;  1X8Y A;  1HWT C;  2N6Y A;  2K9J A;  2FXO A;  2OGU A;  4JYB A;  2LOL A;  2E76 B;  1NTM E;  1HGZ A;  1SQX K;  3B8E B;  3L35 A;  3WBH A;  1USD A;  3B4S A;  2KGA A;  1J1D C;  3CXC O;  3H32 B;  2ZYA A;  3L75 D;  3M1M A;  3L75 G;  5APQ A;  2EHS A;  1JTH B; 
#chains in the Genus database with same CATH homology
 1RO2 A;  1VQO P;  4XRQ A;  2BQ1 E;  3CCQ P;  5BS1 A;  1KQS O;  1S72 P;  3CCM P;  1PEO A;  3DS2 A;  5JPA A;  4U0B A;  2LF4 A;  1VQ6 P;  2M8L A;  3HZQ A;  1VQ9 P;  4U0D A;  1M74 A;  3DS1 A;  4WYM A;  5F2N A;  3CCV P;  3MGE A;  2OAR A;  2Z44 A;  2PEJ A;  2PEN A;  4QNB A;  1Q86 Q;  4IPY A;  1K8A Q;  2XXM A;  3DS4 A;  1VQ5 P;  3CCR P;  5DCK A;  1PEM A;  3G29 A;  3CMA P;  3CPW O;  4GR6 A;  1M90 Q;  3H4E A;  1PEQ A;  4U0E A;  3CCL P;  2CWO A;  3I56 P;  1IUQ A;  2PEQ A;  5HGM A;  1YI2 P;  1VQL P;  1YIT P;  1QVF O;  1QVG O;  3CD6 P;  1KC8 Q;  1E6J P;  2PEI A;  5I4T G;  4COP A;  1YJ9 P;  3CC4 P;  5F2O A;  1YJN P;  1RNI A;  4PH1 A;  2QA4 P;  3CME P;  1A43 A;  3DS5 A;  3G26 A;  3CCE P;  3VRL C;  4U0F A;  2P9X A;  3CCS P;  3CCU P;  3G0V A;  3G6E P;  1M6E X;  2M8N A;  2QEX P;  3OW2 O;  5F2K A;  3CCJ P;  1M6N A;  1K73 Q;  1QRJ A;  1RO0 A;  2XT1 A;  1EIA A;  1YIJ P;  3P05 A;  1PEU A;  2BHV A;  4M0I A;  3H0D A;  1N8R Q;  1AUM A;  2KOD A;  1YHQ P;  3CC7 P;  2XV6 A;  4XFY A;  4XRO A;  1D1D A;  2ONT A;  1EOQ A;  4COC A;  5HGL A;  1VQM P;  1Q7Y Q;  2OTL P;  1K30 A;  3DTJ A;  1W2B O;  1YJW P;  1VQ7 P;  1M1K Q;  2OTJ P;  3G28 A;  3NTE A;  1VQ8 P;  3Q20 A;  2L6E A;  2JYL A;  4U0C A;  3B5I A;  5BS2 A;  2PEK A;  2DGY A;  4U0A A;  1VQK P;  3DPH A;  3DS0 A;  1Q82 Q;  3G1G A;  1ZMB A;  1VQN P;  3CC2 P;  3LRY A;  2JYG A;  1A8O A;  2E1M A;  3RG6 C;  3G21 A;  3HYB A;  4GR2 A;  2M8P A;  2JO0 A;  1K9M Q;  2BUO A;  2Z46 A;  3H47 A;  5HGO A;  4XFZ A;  3G1I A;  1Q81 Q;  1BAJ A;  2EIA A;  2PEO A;  3DS3 A;  4XFX A;  3G4S P;  2PEM A;  2PY8 A;  3G71 P;  2EFJ A;  3WBH A;  3I55 P;  2Z45 A;  2EG5 A;  1VQ4 P;  5HGN A;  3CXC O;  1NJI Q;  3M1M A;  1VQP P;  1KD1 Q;  1JJ2 O;  3E2D A;  4PH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...