2MD9A

Solution structure of an active site mutant pepitdyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
PVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHALKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrocidine synthase 3
publication title Crystal Structure of a PCP/Sfp Complex Reveals the Structural Basis for Carrier Protein Posttranslational Modification.
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2md9A00
2AF8A 2XZ1C 2AVAA 3EJBA 2MF4A 3EJEA 2FACA 1L0HA 2KGEA 2FQ1A 1F80D 4BPFA 2JGPA 2VSQA 2KOQA 2LL8A 2LPKA 3EJDA 1X3OA 2L4BA 2FVFA 2K93A 2KR5A 2L9FA 2K2QA 2JQ4A 2LMLA 2K0YA 2LIUA 1DV5A 2JU1A 2JU2A 4BPGA 5KP7B 4NEOA 1NQ4A 3GZMA 2X2BA 2DNWA 5HVCA 2AFDA 2MY5A 1VKUA 1L0IA 2FHSC 2K92A 4H2XC 2KOPA 2FVEA 2MR8A 2L22A 4H2YC 1HY8A 2MD9A 4PWVB 2GDXA 2KORA 2PNGA 2N6ZA 2KG9A 2CQ8A 5HV8A 4H2WC 5KP6B 1HQBA 2KOSA 4DG9A 2QNWA 2KW2A 4CA3A 5EJDA 2KGCA 2N98A 2N5HA 2GDWA 2L0QA 2K0XA 4MRTC 5KP8B 1DNYA 2KGDA 2K94A 2AFEA 4PXHB 2KWLA 2MR7A 3LMOA 2M5RA 2N6YA 2LTEA 1T8KA 2MVUA 3GZLA 4R0MA 2KG8A 2FAEA 2MVVA 3RG2A 2CGQA 1OR5A 2LKIA 4IZ6A 2KGAA 2XZ0D 2FADA 2ROQA 2GDYA 2CG5B 2FVAA 2EHTA 1KLPA 2N50A 5CZDB 2N5IA 2FQ2A 2KOOA 2FQ0A 3CE7A 2CNRA 2LIWA 4HKGA 2EHSA 3NY7B 2KG6A 2LOLA 1AF8A 4BPHA 1ACPA
chains in the Genus database with same CATH superfamily
2XV6A 1GXHA 2FACA 2KGEA 2FQ1A 1F80D 2JGPA 5EW5E 1EOQA 4PH1A 2OTLP 2Z44A 2K93A 3P05A 3CC2P 2JAZA 2JQ4A 2K0YA 2LIUA 2JU2A 3MGEA 2GZEA 5KP7B 2EFJA 1Q81Q 1NJIQ 2DNWA 3HZQA 5HVCA 1YI2P 3OW2O 2K92A 2MR8A 4H2YC 2L22A 3DTJA 2JO0A 2MD9A 1VQ4P 2GDXA 2KG9A 2CQ8A 3CCVP 2QNWA 1KQSO 5F2KA 2M8PA 1FR2A 2L0QA 2K0XA 4MRTC 1VQKP 1BXIA 1DNYA 2KWLA 2MR7A 4XFZA 4XROA 5HGMA 4UHPB 5DCKA 3RG6C 2Z45A 3HYBA 4U0BA 3CPWO 1GPJA 1VQ8P 5BS1A 2LKIA 3CXCO 1KC8Q 3B4QA 2FADA 1K8AQ 2VLPA 3CC4P 3G28A 3CE7A 2LIWA 3NY7B 2XZ1C 1IMPA 2VLOA 4U0EA 2WPTA 2QA4P 1Q7YQ 1A8OA 2OTJP 5HGNA 2KOQA 2LL8A 2XT1A 1K73Q 4WYMA 3WBHA 1ZNVA 2M8NA 1X3OA 2KR5A 1YJ9P 2K2QA 2EIAA 1ZMBA 1GXGA 3U43A 3G29A 1A43A 1AUMA 3CCLP 4NEOA 3I56P 2GZFA 3G1GA 1W2BO 1BAJA 1VQ7P 2Z46A 1MZ8A 2PEQA 1L0IA 1UJZA 5I4TG 1E0HA 1UNKA 3G21A 4GR6A 4PWVB 2EG5A 3GKLC 3NTEA 2KORA 3CCJP 2QEXP 4XRQA 5HV8A 1QVGO 4DG9A 2VLQA 1QRJA 1RNIA 2N98A 2GZIA 2BUOA 4COPA 2GZGA 3M1MA 4PXHB 3CCUP 3G4SP 2GYKA 2OARA 3H4EA 3LMOA 2M5RA 2LF4A 2NO8A 1T8KA 4QNBA 2CGQA 3DS2A 2KGAA 1Q82Q 2ROQA 2M8LA 1QVFO 2VLNA 2FVAA 1KLPA 2N50A 3G26A 2N5IA 2FQ0A 2CNRA 3G6EP 5JPAA 2PEKA 3G1IA 5F2NA 3CMEP 1M74A 1AYIA 2P9XA 1VQLP 4BPFA 2VSQA 1VQMP 2PY8A 4QKOA 4GR2A 4U0FA 3DS0A 2FVFA 2L9FA 1VQPP 3G0VA 2JYGA 1K9MQ 1DV5A 2JU1A 3CCRP 4BPGA 1YITP 2CWOA 1K30A 1NQ4A 1N8RQ 4U0CA 3GZMA 1KD1Q 2X2BA 1VQ5P 4XFXA 1EMVA 4U0AA 2AFDA 2MY5A 2L6EA 2DGYA 3CMAP 2FHSC 2KOPA 2K0DX 3B5IA 1VQ6P 2JBGA 2GZJA 2PNGA 3E2DA 4H2WC 2KOSA 1VQ9P 4CA3A 3DPHA 5EJDA 2N5HA 3DS3A 1JJ2O 3LRYA 3CCSP 2K94A 2AFEA 1YJNP 2K5XA 2N6YA 2LTEA 3CCQP 2MVUA 3GZLA 4R0MA 2KG8A 2MVVA 3RG2A 4IPYA 1OR5A 4IZ6A 2GDYA 1M1KQ 1E6JP 4XFYA 2FQ2A 3DS1A 2EHSA 5BS2A 2KG6A 5HGLA 1AF8A 4BPHA 2ERHA 3Q20A 1ACPA 4M0IA 2AF8A 2AVAA 2ONTA 2MF4A 3DS4A 3EJBA 3EJEA 1VQOP 1L0HA 1CEIA 1VQNP 1YHQP 1Q86Q 2LPKA 3EJDA 2PENA 3G71P 3CCEP 2L4BA 1EIAA 2LMLA 1VHNA 1D1DA 2PEMA 3DS5A 3CD6P 3I55P 1S72P 1VKUA 1RO0A 4H2XC 2FVEA 1HY8A 2KODA 4COCA 4F37A 2JB0A 2N6ZA 1Z6MA 5KP6B 1HQBA 2KW2A 2KGCA 1YIJP 2XXMA 2GDWA 4PH0A 3VRLC 5KP8B 4U0DA 2E1MA 1M6NA 2BHVA 2KGDA 1IMQA 1RO2A 5HGOA 3GJNA 1M90Q 2FAEA 2PEJA 2PEIA 2JYLA 3CCMP 2XZ0D 3H47A 2CG5B 1IUQA 7CEIA 2EHTA 1YJWP 5CZDB 2KOOA 2PEOA 3CC7P 1M6EX 4HKGA 3H0DA 5F2OA 2LOLA
chains in the Genus database with same CATH topology
2AF8A 2XZ1C 2AVAA 3EJBA 2MF4A 3EJEA 2FACA 1L0HA 2KGEA 2FQ1A 1F80D 4BPFA 2JGPA 2VSQA 2KOQA 2LL8A 2LPKA 3EJDA 1X3OA 2L4BA 2FVFA 2K93A 2KR5A 2L9FA 2K2QA 2JQ4A 2LMLA 2K0YA 2LIUA 1DV5A 2JU1A 2JU2A 4BPGA 5KP7B 4NEOA 1NQ4A 3GZMA 2X2BA 2DNWA 5HVCA 2AFDA 2MY5A 1VKUA 1L0IA 2FHSC 2K92A 4H2XC 2KOPA 2FVEA 2MR8A 2L22A 4H2YC 1HY8A 2MD9A 4PWVB 2GDXA 2KORA 2PNGA 2N6ZA 2KG9A 2CQ8A 5HV8A 4H2WC 5KP6B 1HQBA 2KOSA 4DG9A 2QNWA 2KW2A 4CA3A 5EJDA 2KGCA 2N98A 2N5HA 2GDWA 2L0QA 2K0XA 4MRTC 5KP8B 1DNYA 2KGDA 2K94A 2AFEA 4PXHB 2KWLA 2MR7A 3LMOA 2M5RA 2N6YA 2LTEA 1T8KA 2MVUA 3GZLA 4R0MA 2KG8A 2FAEA 2MVVA 3RG2A 2CGQA 1OR5A 2LKIA 4IZ6A 2KGAA 2XZ0D 2FADA 2ROQA 2GDYA 2CG5B 2FVAA 2EHTA 1KLPA 2N50A 5CZDB 2N5IA 2FQ2A 2KOOA 2FQ0A 3CE7A 2CNRA 2LIWA 4HKGA 2EHSA 3NY7B 2KG6A 2LOLA 1AF8A 4BPHA 1ACPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AF8 A;  2XZ1 C;  2AVA A;  3EJB A;  2MF4 A;  3EJE A;  2FAC A;  1L0H A;  2KGE A;  2FQ1 A;  1F80 D;  4BPF A;  2JGP A;  2VSQ A;  2KOQ A;  2LL8 A;  2LPK A;  3EJD A;  1X3O A;  2L4B A;  2FVF A;  2K93 A;  2KR5 A;  2L9F A;  2K2Q A;  2JQ4 A;  2LML A;  2K0Y A;  2LIU A;  1DV5 A;  2JU1 A;  2JU2 A;  4BPG A;  5KP7 B;  4NEO A;  1NQ4 A;  3GZM A;  2X2B A;  2DNW A;  5HVC A;  2AFD A;  2MY5 A;  1VKU A;  1L0I A;  2FHS C;  2K92 A;  4H2X C;  2KOP A;  2FVE A;  2MR8 A;  2L22 A;  4H2Y C;  1HY8 A;  2MD9 A;  4PWV B;  2GDX A;  2KOR A;  2PNG A;  2N6Z A;  2KG9 A;  2CQ8 A;  5HV8 A;  4H2W C;  5KP6 B;  1HQB A;  2KOS A;  4DG9 A;  2QNW A;  2KW2 A;  4CA3 A;  5EJD A;  2KGC A;  2N98 A;  2N5H A;  2GDW A;  2L0Q A;  2K0X A;  4MRT C;  5KP8 B;  1DNY A;  2KGD A;  2K94 A;  2AFE A;  4PXH B;  2KWL A;  2MR7 A;  3LMO A;  2M5R A;  2N6Y A;  2LTE A;  1T8K A;  2MVU A;  3GZL A;  4R0M A;  2KG8 A;  2FAE A;  2MVV A;  3RG2 A;  2CGQ A;  1OR5 A;  2LKI A;  4IZ6 A;  2KGA A;  2XZ0 D;  2FAD A;  2ROQ A;  2GDY A;  2CG5 B;  2FVA A;  2EHT A;  1KLP A;  2N50 A;  5CZD B;  2N5I A;  2FQ2 A;  2KOO A;  2FQ0 A;  3CE7 A;  2CNR A;  2LIW A;  4HKG A;  2EHS A;  3NY7 B;  2KG6 A;  2LOL A;  1AF8 A;  4BPH A;  1ACP A; 
#chains in the Genus database with same CATH topology
 2XV6 A;  1GXH A;  2FAC A;  2KGE A;  2FQ1 A;  1F80 D;  2JGP A;  5EW5 E;  1EOQ A;  4PH1 A;  2OTL P;  2Z44 A;  2K93 A;  3P05 A;  3CC2 P;  2JAZ A;  2JQ4 A;  2K0Y A;  2LIU A;  2JU2 A;  3MGE A;  2GZE A;  5KP7 B;  2EFJ A;  1Q81 Q;  1NJI Q;  2DNW A;  3HZQ A;  5HVC A;  1YI2 P;  3OW2 O;  2K92 A;  2MR8 A;  4H2Y C;  2L22 A;  3DTJ A;  2JO0 A;  2MD9 A;  1VQ4 P;  2GDX A;  2KG9 A;  2CQ8 A;  3CCV P;  2QNW A;  1KQS O;  5F2K A;  2M8P A;  1FR2 A;  2L0Q A;  2K0X A;  4MRT C;  1VQK P;  1BXI A;  1DNY A;  2KWL A;  2MR7 A;  4XFZ A;  4XRO A;  5HGM A;  4UHP B;  5DCK A;  3RG6 C;  2Z45 A;  3HYB A;  4U0B A;  3CPW O;  1GPJ A;  1VQ8 P;  5BS1 A;  2LKI A;  3CXC O;  1KC8 Q;  3B4Q A;  2FAD A;  1K8A Q;  2VLP A;  3CC4 P;  3G28 A;  3CE7 A;  2LIW A;  3NY7 B;  2XZ1 C;  1IMP A;  2VLO A;  4U0E A;  2WPT A;  2QA4 P;  1Q7Y Q;  1A8O A;  2OTJ P;  5HGN A;  2KOQ A;  2LL8 A;  2XT1 A;  1K73 Q;  4WYM A;  3WBH A;  1ZNV A;  2M8N A;  1X3O A;  2KR5 A;  1YJ9 P;  2K2Q A;  2EIA A;  1ZMB A;  1GXG A;  3U43 A;  3G29 A;  1A43 A;  1AUM A;  3CCL P;  4NEO A;  3I56 P;  2GZF A;  3G1G A;  1W2B O;  1BAJ A;  1VQ7 P;  2Z46 A;  1MZ8 A;  2PEQ A;  1L0I A;  1UJZ A;  5I4T G;  1E0H A;  1UNK A;  3G21 A;  4GR6 A;  4PWV B;  2EG5 A;  3GKL C;  3NTE A;  2KOR A;  3CCJ P;  2QEX P;  4XRQ A;  5HV8 A;  1QVG O;  4DG9 A;  2VLQ A;  1QRJ A;  1RNI A;  2N98 A;  2GZI A;  2BUO A;  4COP A;  2GZG A;  3M1M A;  4PXH B;  3CCU P;  3G4S P;  2GYK A;  2OAR A;  3H4E A;  3LMO A;  2M5R A;  2LF4 A;  2NO8 A;  1T8K A;  4QNB A;  2CGQ A;  3DS2 A;  2KGA A;  1Q82 Q;  2ROQ A;  2M8L A;  1QVF O;  2VLN A;  2FVA A;  1KLP A;  2N50 A;  3G26 A;  2N5I A;  2FQ0 A;  2CNR A;  3G6E P;  5JPA A;  2PEK A;  3G1I A;  5F2N A;  3CME P;  1M74 A;  1AYI A;  2P9X A;  1VQL P;  4BPF A;  2VSQ A;  1VQM P;  2PY8 A;  4QKO A;  4GR2 A;  4U0F A;  3DS0 A;  2FVF A;  2L9F A;  1VQP P;  3G0V A;  2JYG A;  1K9M Q;  1DV5 A;  2JU1 A;  3CCR P;  4BPG A;  1YIT P;  2CWO A;  1K30 A;  1NQ4 A;  1N8R Q;  4U0C A;  3GZM A;  1KD1 Q;  2X2B A;  1VQ5 P;  4XFX A;  1EMV A;  4U0A A;  2AFD A;  2MY5 A;  2L6E A;  2DGY A;  3CMA P;  2FHS C;  2KOP A;  2K0D X;  3B5I A;  1VQ6 P;  2JBG A;  2GZJ A;  2PNG A;  3E2D A;  4H2W C;  2KOS A;  1VQ9 P;  4CA3 A;  3DPH A;  5EJD A;  2N5H A;  3DS3 A;  1JJ2 O;  3LRY A;  3CCS P;  2K94 A;  2AFE A;  1YJN P;  2K5X A;  2N6Y A;  2LTE A;  3CCQ P;  2MVU A;  3GZL A;  4R0M A;  2KG8 A;  2MVV A;  3RG2 A;  4IPY A;  1OR5 A;  4IZ6 A;  2GDY A;  1M1K Q;  1E6J P;  4XFY A;  2FQ2 A;  3DS1 A;  2EHS A;  5BS2 A;  2KG6 A;  5HGL A;  1AF8 A;  4BPH A;  2ERH A;  3Q20 A;  1ACP A;  4M0I A;  2AF8 A;  2AVA A;  2ONT A;  2MF4 A;  3DS4 A;  3EJB A;  3EJE A;  1VQO P;  1L0H A;  1CEI A;  1VQN P;  1YHQ P;  1Q86 Q;  2LPK A;  3EJD A;  2PEN A;  3G71 P;  3CCE P;  2L4B A;  1EIA A;  2LML A;  1VHN A;  1D1D A;  2PEM A;  3DS5 A;  3CD6 P;  3I55 P;  1S72 P;  1VKU A;  1RO0 A;  4H2X C;  2FVE A;  1HY8 A;  2KOD A;  4COC A;  4F37 A;  2JB0 A;  2N6Z A;  1Z6M A;  5KP6 B;  1HQB A;  2KW2 A;  2KGC A;  1YIJ P;  2XXM A;  2GDW A;  4PH0 A;  3VRL C;  5KP8 B;  4U0D A;  2E1M A;  1M6N A;  2BHV A;  2KGD A;  1IMQ A;  1RO2 A;  5HGO A;  3GJN A;  1M90 Q;  2FAE A;  2PEJ A;  2PEI A;  2JYL A;  3CCM P;  2XZ0 D;  3H47 A;  2CG5 B;  1IUQ A;  7CEI A;  2EHT A;  1YJW P;  5CZD B;  2KOO A;  2PEO A;  3CC7 P;  1M6E X;  4HKG A;  3H0D A;  5F2O A;  2LOL A; 
#chains in the Genus database with same CATH homology
 2AF8 A;  2XZ1 C;  2AVA A;  3EJB A;  2MF4 A;  3EJE A;  2FAC A;  1L0H A;  2KGE A;  2FQ1 A;  1F80 D;  4BPF A;  2JGP A;  2VSQ A;  2KOQ A;  2LL8 A;  2LPK A;  3EJD A;  1X3O A;  2L4B A;  2FVF A;  2K93 A;  2KR5 A;  2L9F A;  2K2Q A;  2JQ4 A;  2LML A;  2K0Y A;  2LIU A;  1DV5 A;  2JU1 A;  2JU2 A;  4BPG A;  5KP7 B;  4NEO A;  1NQ4 A;  3GZM A;  2X2B A;  2DNW A;  5HVC A;  2AFD A;  2MY5 A;  1VKU A;  1L0I A;  2FHS C;  2K92 A;  4H2X C;  2KOP A;  2FVE A;  2MR8 A;  2L22 A;  4H2Y C;  1HY8 A;  2MD9 A;  4PWV B;  2GDX A;  2KOR A;  2PNG A;  2N6Z A;  2KG9 A;  2CQ8 A;  5HV8 A;  4H2W C;  5KP6 B;  1HQB A;  2KOS A;  4DG9 A;  2QNW A;  2KW2 A;  4CA3 A;  5EJD A;  2KGC A;  2N98 A;  2N5H A;  2GDW A;  2L0Q A;  2K0X A;  4MRT C;  5KP8 B;  1DNY A;  2KGD A;  2K94 A;  2AFE A;  4PXH B;  2KWL A;  2MR7 A;  3LMO A;  2M5R A;  2N6Y A;  2LTE A;  1T8K A;  2MVU A;  3GZL A;  4R0M A;  2KG8 A;  2FAE A;  2MVV A;  3RG2 A;  2CGQ A;  1OR5 A;  2LKI A;  4IZ6 A;  2KGA A;  2XZ0 D;  2FAD A;  2ROQ A;  2GDY A;  2CG5 B;  2FVA A;  2EHT A;  1KLP A;  2N50 A;  5CZD B;  2N5I A;  2FQ2 A;  2KOO A;  2FQ0 A;  3CE7 A;  2CNR A;  2LIW A;  4HKG A;  2EHS A;  3NY7 B;  2KG6 A;  2LOL A;  1AF8 A;  4BPH A;  1ACP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...