2MD9A

Solution structure of an active site mutant pepitdyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
PVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHALKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a PCP/Sfp Complex Reveals the Structural Basis for Carrier Protein Posttranslational Modification.
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase
molecule keywords Tyrocidine synthase 3
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2md9A00
1L0IA 2N6ZA 2KOOA 2M5RA 1T8KA 2EHSA 5KP8B 1NQ4A 2L9FA 2KG8A 2KGDA 2JU2A 2VSQA 2N50A 2MF4A 2K0XA 2CNRA 2JQ4A 4DG9A 2AF8A 2L22A 2PNGA 2LIUA 4H2YC 2CG5B 3EJDA 4NEOA 2ROQA 1KLPA 5CZDB 2N98A 2LMLA 2MD9A 2CGQA 2KGEA 2CQ8A 5EJDA 4MRTC 2GDXA 3RG2A 3NY7B 1VKUA 2MVUA 2XZ0D 2K93A 1OR5A 2N5IA 2FVAA 2LOLA 4R0MA 2GDWA 2JU1A 4BPFA 2AFDA 2N5HA 2MVVA 2KWLA 2FACA 2FQ0A 4IZ6A 1L0HA 4HKGA 1X3OA 2K92A 2JGPA 4H2WC 2MR8A 3LMOA 3CE7A 4PWVB 2L4BA 2EHTA 2KORA 2LL8A 2K0YA 1DV5A 2FADA 2N6YA 2K94A 2LTEA 2MR7A 2KOQA 4BPGA 5HVCA 2XZ1C 5KP7B 2FQ2A 2L0QA 1DNYA 2QNWA 2FVFA 3GZMA 2LKIA 2K2QA 1F80D 4PXHB 4CA3A 2KOPA 2KR5A 1ACPA 1HY8A 2GDYA 2MY5A 2LPKA 3EJBA 5HV8A 2LIWA 3EJEA 1AF8A 2KG9A 4BPHA 2KGCA 4H2XC 2FHSC 1HQBA 2KG6A 2AFEA 2FVEA 3GZLA 2FQ1A 2AVAA 2X2BA 5KP6B 2DNWA 2FAEA 2KGAA 2KOSA 2KW2A
chains in the Genus database with same CATH superfamily
1CEIA 2M5RA 5F2OA 3DS4A 5JPAA 3CCSP 4XRQA 3I55P 3CCRP 2PEQA 5HGOA 2MF4A 4U0DA 2JQ4A 4DG9A 2AF8A 2GZJA 2L22A 4WYMA 2VLOA 3EJDA 4NEOA 3G4SP 5CZDB 4M0IA 1UNKA 2LMLA 3DS1A 3CCEP 2EFJA 4MRTC 2BHVA 1M74A 2Z44A 4U0BA 1Z6MA 3RG2A 3NY7B 2N5IA 2FVAA 3G71P 2JBGA 4U0EA 3G1GA 2GDWA 4R0MA 3MGEA 1IMPA 2JYLA 2AFDA 2JB0A 2FACA 4F37A 5BS2A 1L0HA 2MR8A 2CWOA 3CE7A 3CCUP 3CXCO 1KD1Q 2EHTA 1M90Q 3CCJP 2FQ2A 1QRJA 2L0QA 2GYKA 1DNYA 3G29A 3DS0A 3I56P 2XV6A 5DCKA 2MY5A 2VLQA 2LPKA 3EJBA 4COCA 2XT1A 2KGCA 3DS3A 3E2DA 1EOQA 3P05A 2LF4A 2AVAA 5KP6B 3DTJA 2ONTA 2KGAA 1L0IA 1ZNVA 1VQ7P 1VHNA 1KQSO 1YHQP 1NQ4A 2L9FA 4XFYA 1E0HA 2VSQA 1RNIA 1EIAA 4U0AA 2PNGA 4XFZA 1NJIQ 2CQ8A 2K0DX 4U0CA 5EJDA 2GDXA 2XZ0D 2K5XA 1OR5A 3B4QA 1VQOP 2JYGA 1GXHA 2N5HA 2PENA 2MVVA 2VLNA 3G6EP 2PEOA 4HKGA 2JGPA 2GZGA 1M6NA 4PWVB 1A43A 2L4BA 5I4TG 3HYBA 3NTEA 1K73Q 1K9MQ 2K0YA 2K94A 3DS5A 1VQ6P 2MR7A 2Z45A 4BPGA 3LRYA 1Q81Q 1VQKP 4IPYA 1IUQA 7CEIA 3CCLP 2FVFA 3GZMA 1Q86Q 2LKIA 1VQPP 4PH0A 3Q20A 4CA3A 4QNBA 2GDYA 1VQ9P 5HGNA 1AUMA 5HGMA 3WBHA 4BPHA 2PY8A 4H2XC 5HGLA 1BAJA 2QEXP 2AFEA 1N8RQ 1YI2P 2FQ1A 2X2BA 1S72P 4XFXA 2FAEA 3CCQP 2KW2A 2N6ZA 2KOOA 1W2BO 2E1MA 1YITP 5KP8B 1VQ8P 4GR6A 2NO8A 2JU2A 3G28A 2N50A 3HZQA 3RG6C 2K0XA 2PEIA 2OTLP 3U43A 2LIUA 4H2YC 2CG5B 2BUOA 4PH1A 2ROQA 1KLPA 2N98A 2CGQA 2KGEA 3DPHA 2MVUA 2K93A 4U0FA 4BPFA 5F2NA 1UJZA 1KC8Q 2KWLA 1VQMP 4COPA 2OTJP 2FQ0A 4IZ6A 3B5IA 3CCMP 1VQLP 2KODA 1VQ4P 2GZEA 2JO0A 2LL8A 3CPWO 2FADA 1QVFO 3G21A 2LTEA 1YIJP 5HVCA 5KP7B 2M8PA 2QNWA 4XROA 2WPTA 2K2QA 5F2KA 1F80D 4PXHB 2P9XA 1HY8A 3CC4P 2OARA 3GKLC 5HV8A 1BXIA 2LIWA 1AF8A 2GZIA 2EG5A 2PEJA 3CC2P 1MZ8A 1E6JP 1HQBA 1K8AQ 2KG6A 2FVEA 3GZLA 3OW2O 2DNWA 2M8LA 1D1DA 3CCVP 1Q82Q 2ERHA 1T8KA 3G26A 2EHSA 2KG8A 2KGDA 2VLPA 1RO2A 2CNRA 2Z46A 3H4EA 3CMEP 1YJ9P 1AYIA 1YJNP 2EIAA 1EMVA 4QKOA 2MD9A 3G0VA 1M1KQ 1GXGA 1VKUA 2LOLA 1FR2A 2JU1A 2JAZA 2PEKA 4GR2A 1A8OA 1JJ2O 3CD6P 1QVGO 1VQ5P 5BS1A 5EW5E 2QA4P 1X3OA 2K92A 4H2WC 2PEMA 2XXMA 3LMOA 3H47A 3DS2A 3M1MA 1YJWP 2KORA 3VRLC 1DV5A 2N6YA 2M8NA 1M6EX 2KOQA 3G1IA 1IMQA 2XZ1C 4UHPB 2KOPA 2KR5A 1Q7YQ 2DGYA 1ACPA 3GJNA 1RO0A 3EJEA 2KG9A 3CMAP 1GPJA 1K30A 2FHSC 3CC7P 2GZFA 2L6EA 1VQNP 3H0DA 1ZMBA 2KOSA
chains in the Genus database with same CATH topology
1L0IA 2N6ZA 2KOOA 2M5RA 1T8KA 2EHSA 5KP8B 1NQ4A 2L9FA 2KG8A 2KGDA 2JU2A 2VSQA 2N50A 2MF4A 2K0XA 2CNRA 2JQ4A 4DG9A 2AF8A 2L22A 2PNGA 2LIUA 4H2YC 2CG5B 3EJDA 4NEOA 2ROQA 1KLPA 5CZDB 2N98A 2LMLA 2MD9A 2CGQA 2KGEA 2CQ8A 5EJDA 4MRTC 2GDXA 3RG2A 3NY7B 1VKUA 2MVUA 2XZ0D 2K93A 1OR5A 2N5IA 2FVAA 2LOLA 4R0MA 2GDWA 2JU1A 4BPFA 2AFDA 2N5HA 2MVVA 2KWLA 2FACA 2FQ0A 4IZ6A 1L0HA 4HKGA 1X3OA 2K92A 2JGPA 4H2WC 2MR8A 3LMOA 3CE7A 4PWVB 2L4BA 2EHTA 2KORA 2LL8A 2K0YA 1DV5A 2FADA 2N6YA 2K94A 2LTEA 2MR7A 2KOQA 4BPGA 5HVCA 2XZ1C 5KP7B 2FQ2A 2L0QA 1DNYA 2QNWA 2FVFA 3GZMA 2LKIA 2K2QA 1F80D 4PXHB 4CA3A 2KOPA 2KR5A 1ACPA 1HY8A 2GDYA 2MY5A 2LPKA 3EJBA 5HV8A 2LIWA 3EJEA 1AF8A 2KG9A 4BPHA 2KGCA 4H2XC 2FHSC 1HQBA 2KG6A 2AFEA 2FVEA 3GZLA 2FQ1A 2AVAA 2X2BA 5KP6B 2DNWA 2FAEA 2KGAA 2KOSA 2KW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0I A;  2N6Z A;  2KOO A;  2M5R A;  1T8K A;  2EHS A;  5KP8 B;  1NQ4 A;  2L9F A;  2KG8 A;  2KGD A;  2JU2 A;  2VSQ A;  2N50 A;  2MF4 A;  2K0X A;  2CNR A;  2JQ4 A;  4DG9 A;  2AF8 A;  2L22 A;  2PNG A;  2LIU A;  4H2Y C;  2CG5 B;  3EJD A;  4NEO A;  2ROQ A;  1KLP A;  5CZD B;  2N98 A;  2LML A;  2MD9 A;  2CGQ A;  2KGE A;  2CQ8 A;  5EJD A;  4MRT C;  2GDX A;  3RG2 A;  3NY7 B;  1VKU A;  2MVU A;  2XZ0 D;  2K93 A;  1OR5 A;  2N5I A;  2FVA A;  2LOL A;  4R0M A;  2GDW A;  2JU1 A;  4BPF A;  2AFD A;  2N5H A;  2MVV A;  2KWL A;  2FAC A;  2FQ0 A;  4IZ6 A;  1L0H A;  4HKG A;  1X3O A;  2K92 A;  2JGP A;  4H2W C;  2MR8 A;  3LMO A;  3CE7 A;  4PWV B;  2L4B A;  2EHT A;  2KOR A;  2LL8 A;  2K0Y A;  1DV5 A;  2FAD A;  2N6Y A;  2K94 A;  2LTE A;  2MR7 A;  2KOQ A;  4BPG A;  5HVC A;  2XZ1 C;  5KP7 B;  2FQ2 A;  2L0Q A;  1DNY A;  2QNW A;  2FVF A;  3GZM A;  2LKI A;  2K2Q A;  1F80 D;  4PXH B;  4CA3 A;  2KOP A;  2KR5 A;  1ACP A;  1HY8 A;  2GDY A;  2MY5 A;  2LPK A;  3EJB A;  5HV8 A;  2LIW A;  3EJE A;  1AF8 A;  2KG9 A;  4BPH A;  2KGC A;  4H2X C;  2FHS C;  1HQB A;  2KG6 A;  2AFE A;  2FVE A;  3GZL A;  2FQ1 A;  2AVA A;  2X2B A;  5KP6 B;  2DNW A;  2FAE A;  2KGA A;  2KOS A;  2KW2 A; 
#chains in the Genus database with same CATH topology
 1CEI A;  2M5R A;  5F2O A;  3DS4 A;  5JPA A;  3CCS P;  4XRQ A;  3I55 P;  3CCR P;  2PEQ A;  5HGO A;  2MF4 A;  4U0D A;  2JQ4 A;  4DG9 A;  2AF8 A;  2GZJ A;  2L22 A;  4WYM A;  2VLO A;  3EJD A;  4NEO A;  3G4S P;  5CZD B;  4M0I A;  1UNK A;  2LML A;  3DS1 A;  3CCE P;  2EFJ A;  4MRT C;  2BHV A;  1M74 A;  2Z44 A;  4U0B A;  1Z6M A;  3RG2 A;  3NY7 B;  2N5I A;  2FVA A;  3G71 P;  2JBG A;  4U0E A;  3G1G A;  2GDW A;  4R0M A;  3MGE A;  1IMP A;  2JYL A;  2AFD A;  2JB0 A;  2FAC A;  4F37 A;  5BS2 A;  1L0H A;  2MR8 A;  2CWO A;  3CE7 A;  3CCU P;  3CXC O;  1KD1 Q;  2EHT A;  1M90 Q;  3CCJ P;  2FQ2 A;  1QRJ A;  2L0Q A;  2GYK A;  1DNY A;  3G29 A;  3DS0 A;  3I56 P;  2XV6 A;  5DCK A;  2MY5 A;  2VLQ A;  2LPK A;  3EJB A;  4COC A;  2XT1 A;  2KGC A;  3DS3 A;  3E2D A;  1EOQ A;  3P05 A;  2LF4 A;  2AVA A;  5KP6 B;  3DTJ A;  2ONT A;  2KGA A;  1L0I A;  1ZNV A;  1VQ7 P;  1VHN A;  1KQS O;  1YHQ P;  1NQ4 A;  2L9F A;  4XFY A;  1E0H A;  2VSQ A;  1RNI A;  1EIA A;  4U0A A;  2PNG A;  4XFZ A;  1NJI Q;  2CQ8 A;  2K0D X;  4U0C A;  5EJD A;  2GDX A;  2XZ0 D;  2K5X A;  1OR5 A;  3B4Q A;  1VQO P;  2JYG A;  1GXH A;  2N5H A;  2PEN A;  2MVV A;  2VLN A;  3G6E P;  2PEO A;  4HKG A;  2JGP A;  2GZG A;  1M6N A;  4PWV B;  1A43 A;  2L4B A;  5I4T G;  3HYB A;  3NTE A;  1K73 Q;  1K9M Q;  2K0Y A;  2K94 A;  3DS5 A;  1VQ6 P;  2MR7 A;  2Z45 A;  4BPG A;  3LRY A;  1Q81 Q;  1VQK P;  4IPY A;  1IUQ A;  7CEI A;  3CCL P;  2FVF A;  3GZM A;  1Q86 Q;  2LKI A;  1VQP P;  4PH0 A;  3Q20 A;  4CA3 A;  4QNB A;  2GDY A;  1VQ9 P;  5HGN A;  1AUM A;  5HGM A;  3WBH A;  4BPH A;  2PY8 A;  4H2X C;  5HGL A;  1BAJ A;  2QEX P;  2AFE A;  1N8R Q;  1YI2 P;  2FQ1 A;  2X2B A;  1S72 P;  4XFX A;  2FAE A;  3CCQ P;  2KW2 A;  2N6Z A;  2KOO A;  1W2B O;  2E1M A;  1YIT P;  5KP8 B;  1VQ8 P;  4GR6 A;  2NO8 A;  2JU2 A;  3G28 A;  2N50 A;  3HZQ A;  3RG6 C;  2K0X A;  2PEI A;  2OTL P;  3U43 A;  2LIU A;  4H2Y C;  2CG5 B;  2BUO A;  4PH1 A;  2ROQ A;  1KLP A;  2N98 A;  2CGQ A;  2KGE A;  3DPH A;  2MVU A;  2K93 A;  4U0F A;  4BPF A;  5F2N A;  1UJZ A;  1KC8 Q;  2KWL A;  1VQM P;  4COP A;  2OTJ P;  2FQ0 A;  4IZ6 A;  3B5I A;  3CCM P;  1VQL P;  2KOD A;  1VQ4 P;  2GZE A;  2JO0 A;  2LL8 A;  3CPW O;  2FAD A;  1QVF O;  3G21 A;  2LTE A;  1YIJ P;  5HVC A;  5KP7 B;  2M8P A;  2QNW A;  4XRO A;  2WPT A;  2K2Q A;  5F2K A;  1F80 D;  4PXH B;  2P9X A;  1HY8 A;  3CC4 P;  2OAR A;  3GKL C;  5HV8 A;  1BXI A;  2LIW A;  1AF8 A;  2GZI A;  2EG5 A;  2PEJ A;  3CC2 P;  1MZ8 A;  1E6J P;  1HQB A;  1K8A Q;  2KG6 A;  2FVE A;  3GZL A;  3OW2 O;  2DNW A;  2M8L A;  1D1D A;  3CCV P;  1Q82 Q;  2ERH A;  1T8K A;  3G26 A;  2EHS A;  2KG8 A;  2KGD A;  2VLP A;  1RO2 A;  2CNR A;  2Z46 A;  3H4E A;  3CME P;  1YJ9 P;  1AYI A;  1YJN P;  2EIA A;  1EMV A;  4QKO A;  2MD9 A;  3G0V A;  1M1K Q;  1GXG A;  1VKU A;  2LOL A;  1FR2 A;  2JU1 A;  2JAZ A;  2PEK A;  4GR2 A;  1A8O A;  1JJ2 O;  3CD6 P;  1QVG O;  1VQ5 P;  5BS1 A;  5EW5 E;  2QA4 P;  1X3O A;  2K92 A;  4H2W C;  2PEM A;  2XXM A;  3LMO A;  3H47 A;  3DS2 A;  3M1M A;  1YJW P;  2KOR A;  3VRL C;  1DV5 A;  2N6Y A;  2M8N A;  1M6E X;  2KOQ A;  3G1I A;  1IMQ A;  2XZ1 C;  4UHP B;  2KOP A;  2KR5 A;  1Q7Y Q;  2DGY A;  1ACP A;  3GJN A;  1RO0 A;  3EJE A;  2KG9 A;  3CMA P;  1GPJ A;  1K30 A;  2FHS C;  3CC7 P;  2GZF A;  2L6E A;  1VQN P;  3H0D A;  1ZMB A;  2KOS A; 
#chains in the Genus database with same CATH homology
 1L0I A;  2N6Z A;  2KOO A;  2M5R A;  1T8K A;  2EHS A;  5KP8 B;  1NQ4 A;  2L9F A;  2KG8 A;  2KGD A;  2JU2 A;  2VSQ A;  2N50 A;  2MF4 A;  2K0X A;  2CNR A;  2JQ4 A;  4DG9 A;  2AF8 A;  2L22 A;  2PNG A;  2LIU A;  4H2Y C;  2CG5 B;  3EJD A;  4NEO A;  2ROQ A;  1KLP A;  5CZD B;  2N98 A;  2LML A;  2MD9 A;  2CGQ A;  2KGE A;  2CQ8 A;  5EJD A;  4MRT C;  2GDX A;  3RG2 A;  3NY7 B;  1VKU A;  2MVU A;  2XZ0 D;  2K93 A;  1OR5 A;  2N5I A;  2FVA A;  2LOL A;  4R0M A;  2GDW A;  2JU1 A;  4BPF A;  2AFD A;  2N5H A;  2MVV A;  2KWL A;  2FAC A;  2FQ0 A;  4IZ6 A;  1L0H A;  4HKG A;  1X3O A;  2K92 A;  2JGP A;  4H2W C;  2MR8 A;  3LMO A;  3CE7 A;  4PWV B;  2L4B A;  2EHT A;  2KOR A;  2LL8 A;  2K0Y A;  1DV5 A;  2FAD A;  2N6Y A;  2K94 A;  2LTE A;  2MR7 A;  2KOQ A;  4BPG A;  5HVC A;  2XZ1 C;  5KP7 B;  2FQ2 A;  2L0Q A;  1DNY A;  2QNW A;  2FVF A;  3GZM A;  2LKI A;  2K2Q A;  1F80 D;  4PXH B;  4CA3 A;  2KOP A;  2KR5 A;  1ACP A;  1HY8 A;  2GDY A;  2MY5 A;  2LPK A;  3EJB A;  5HV8 A;  2LIW A;  3EJE A;  1AF8 A;  2KG9 A;  4BPH A;  2KGC A;  4H2X C;  2FHS C;  1HQB A;  2KG6 A;  2AFE A;  2FVE A;  3GZL A;  2FQ1 A;  2AVA A;  2X2B A;  5KP6 B;  2DNW A;  2FAE A;  2KGA A;  2KOS A;  2KW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...