2MD9A

Solution structure of an active site mutant pepitdyl carrier protein
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
b'PVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHALKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVATRSHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrocidine synthase 3
publication title Crystal Structure of a PCP/Sfp Complex Reveals the Structural Basis for Carrier Protein Posttranslational Modification.
pubmed doi rcsb
source organism Brevibacillus parabrevis
molecule tags Ligase
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2md9A00
2CGQA 2GDXA 2LL8A 3GZMA 2LOLA 2LKIA 2CG5B 2N6ZA 2LMLA 2KG6A 4PWVB 4BPFA 2N50A 5KP8B 1F80D 2FQ0A 2JU1A 1T8KA 5CZDB 2CQ8A 4NEOA 2GDWA 2KOQA 2FAEA 2KORA 2AVAA 2KWLA 1L0IA 2FHSC 1L0HA 1VKUA 2GDYA 2KOSA 1NQ4A 2M5RA 2N6YA 2CNRA 2LPKA 2MY5A 2L22A 3LMOA 3RG2A 2LIUA 1DV5A 2FVAA 1OR5A 2MVUA 2KG9A 2K0YA 2AF8A 2MD9A 2N5HA 3EJEA 4BPGA 1X3OA 2FQ2A 2FADA 1DNYA 2K93A 4DG9A 3EJBA 2KOOA 3NY7B 4HKGA 2AFEA 2JU2A 2KW2A 2MVVA 2KGCA 2PNGA 2KGEA 4MRTC 1HQBA 4BPHA 2FVEA 4H2XC 2L4BA 5KP7B 1KLPA 2KR5A 2FACA 2AFDA 2FVFA 2KGAA 2EHSA 2FQ1A 1AF8A 4R0MA 2LTEA 2MR8A 2KOPA 2N98A 2QNWA 2X2BA 3CE7A 3EJDA 2JQ4A 2L0QA 2XZ0D 4H2YC 5HV8A 5EJDA 4PXHB 2K94A 4H2WC 2K2QA 2LIWA 2L9FA 2EHTA 1ACPA 4IZ6A 2DNWA 2ROQA 2K92A 2KG8A 2K0XA 2KGDA 2JGPA 5KP6B 2XZ1C 2VSQA 2MF4A 3GZLA 4CA3A 5HVCA 1HY8A 2N5IA 2MR7A
chains in the Genus database with same CATH superfamily
4F37A 2LL8A 3NTEA 3G1GA 3DTJA 1Q81Q 2KG6A 1IUQA 1M6EX 5CZDB 3I55P 4NEOA 1GXGA 3CC4P 3G1IA 2KWLA 3DS3A 3I56P 1L0HA 1VKUA 3CCLP 2KOSA 2EG5A 2PEOA 2CNRA 3G6EP 2MY5A 2Z44A 3P05A 1Q7YQ 3LMOA 1YJNP 2KG9A 4QNBA 2K0YA 2N5HA 2JBGA 3E2DA 3G26A 3CCEP 3MGEA 1E6JP 1AYIA 3OW2O 5BS1A 2DGYA 2AFEA 2QEXP 3U43A 2MVVA 3G4SP 3GKLC 2KGEA 4MRTC 1HQBA 5F2KA 2WPTA 2VLQA 1AUMA 2LF4A 5KP7B 3DS0A 1KLPA 2FACA 2FVFA 4IPYA 1MZ8A 1VQ6P 2XV6A 1ZMBA 2JQ4A 1VQOP 1VQKP 2XZ0D 1E0HA 4H2YC 5HV8A 1RO0A 2L9FA 2KGDA 5KP6B 2MF4A 2JO0A 5HVCA 1FR2A 2VLPA 3G0VA 2CGQA 1YJWP 3B4QA 1KQSO 1VQMP 4PH1A 1QVGO 1K9MQ 3GJNA 2LMLA 1F80D 3M1MA 5F2NA 1M1KQ 4U0CA 2FAEA 4U0FA 2KORA 2AVAA 1EIAA 1GXHA 1VQ7P 2GDYA 3DS5A 2BUOA 2M5RA 1D1DA 4XROA 3RG2A 1OR5A 1K73Q 2PENA 2AF8A 2MD9A 2M8LA 1Q86Q 1K8AQ 1W2BO 5BS2A 3CCSP 3CMAP 3EJBA 2KOOA 3DS1A 4WYMA 2GZIA 1Q82Q 4QKOA 1M74A 1VQ9P 1UJZA 3RG6C 4BPHA 2ONTA 3CMEP 4H2XC 2P9XA 2KR5A 2AFDA 2KGAA 2EHSA 1BAJA 2XT1A 2N98A 1BXIA 3CE7A 5HGNA 3VRLC 2PY8A 4XFXA 1IMPA 2LIWA 1KD1Q 1ACPA 3Q20A 4GR2A 1VQNP 2GDXA 1RO2A 2L6EA 2LOLA 3GZMA 3CC7P 1S72P 2N6ZA 2M8NA 2N50A 4COPA 2JYGA 4COCA 1NJIQ 4U0EA 7CEIA 1CEIA 2GDWA 2OTJP 2KOQA 5EW5E 2FHSC 2PEQA 3CCUP 3B5IA 4U0BA 3WBHA 2CWOA 2GZGA 4GR6A 1DV5A 2FVAA 2MVUA 5I4TG 3EJEA 2KODA 1M90Q 4U0AA 4DG9A 1A43A 2GZFA 3DS4A 4UHPB 4HKGA 2JU2A 2KW2A 2KGCA 2JYLA 2PNGA 3CXCO 1M6NA 2E1MA 1GPJA 2FQ1A 2GYKA 1VQ8P 2OARA 1QVFO 4PH0A 2L0QA 1YITP 3G29A 2PEIA 2BHVA 3H0DA 5HGMA 5EJDA 2GZJA 4PXHB 4XFZA 2Z46A 4H2WC 3CPWO 1UNKA 4XFYA 2PEJA 1EOQA 2K0DX 2K92A 2KG8A 2M8PA 2QA4P 4XRQA 2JGPA 2XZ1C 2VSQA 3GZLA 1HY8A 2N5IA 2MR7A 2JB0A 3H47A 5HGLA 2JAZA 2EIAA 2LKIA 2CG5B 1ZNVA 2ERHA 4BPFA 4PWVB 3CCMP 5KP8B 1YI2P 2PEKA 2FQ0A 2JU1A 1T8KA 4M0IA 2CQ8A 2NO8A 2VLOA 1L0IA 2GZEA 2Z45A 1NQ4A 2N6YA 3HZQA 1Z6MA 1A8OA 2LPKA 2L22A 3CCQP 1YIJP 2EFJA 2LIUA 3DPHA 3G21A 1K30A 3DS2A 4BPGA 1X3OA 1YHQP 2FQ2A 3G28A 2FADA 1DNYA 2K93A 4U0DA 1QRJA 2OTLP 3NY7B 1N8RQ 1VQ4P 2FVEA 2L4BA 1JJ2O 3HYBA 1RNIA 3G71P 3CD6P 1AF8A 4R0MA 2LTEA 3CCVP 2MR8A 2KOPA 2QNWA 2X2BA 3EJDA 3LRYA 1KC8Q 1IMQA 2XXMA 1VQPP 2PEMA 3H4EA 3CC2P 2K94A 2K2QA 2VLNA 5JPAA 3CCRP 2EHTA 2K5XA 3CCJP 1EMVA 4IZ6A 2DNWA 2ROQA 5HGOA 2K0XA 1VQ5P 4CA3A 5F2OA 5DCKA 1VQLP 1YJ9P 1VHNA
chains in the Genus database with same CATH topology
2CGQA 2GDXA 2LL8A 3GZMA 2LOLA 2LKIA 2CG5B 2N6ZA 2LMLA 2KG6A 4PWVB 4BPFA 2N50A 5KP8B 1F80D 2FQ0A 2JU1A 1T8KA 5CZDB 2CQ8A 4NEOA 2GDWA 2KOQA 2FAEA 2KORA 2AVAA 2KWLA 1L0IA 2FHSC 1L0HA 1VKUA 2GDYA 2KOSA 1NQ4A 2M5RA 2N6YA 2CNRA 2LPKA 2MY5A 2L22A 3LMOA 3RG2A 2LIUA 1DV5A 2FVAA 1OR5A 2MVUA 2KG9A 2K0YA 2AF8A 2MD9A 2N5HA 3EJEA 4BPGA 1X3OA 2FQ2A 2FADA 1DNYA 2K93A 4DG9A 3EJBA 2KOOA 3NY7B 4HKGA 2AFEA 2JU2A 2KW2A 2MVVA 2KGCA 2PNGA 2KGEA 4MRTC 1HQBA 4BPHA 2FVEA 4H2XC 2L4BA 5KP7B 1KLPA 2KR5A 2FACA 2AFDA 2FVFA 2KGAA 2EHSA 2FQ1A 1AF8A 4R0MA 2LTEA 2MR8A 2KOPA 2N98A 2QNWA 2X2BA 3CE7A 3EJDA 2JQ4A 2L0QA 2XZ0D 4H2YC 5HV8A 5EJDA 4PXHB 2K94A 4H2WC 2K2QA 2LIWA 2L9FA 2EHTA 1ACPA 4IZ6A 2DNWA 2ROQA 2K92A 2KG8A 2K0XA 2KGDA 2JGPA 5KP6B 2XZ1C 2VSQA 2MF4A 3GZLA 4CA3A 5HVCA 1HY8A 2N5IA 2MR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CGQ A;  2GDX A;  2LL8 A;  3GZM A;  2LOL A;  2LKI A;  2CG5 B;  2N6Z A;  2LML A;  2KG6 A;  4PWV B;  4BPF A;  2N50 A;  5KP8 B;  1F80 D;  2FQ0 A;  2JU1 A;  1T8K A;  5CZD B;  2CQ8 A;  4NEO A;  2GDW A;  2KOQ A;  2FAE A;  2KOR A;  2AVA A;  2KWL A;  1L0I A;  2FHS C;  1L0H A;  1VKU A;  2GDY A;  2KOS A;  1NQ4 A;  2M5R A;  2N6Y A;  2CNR A;  2LPK A;  2MY5 A;  2L22 A;  3LMO A;  3RG2 A;  2LIU A;  1DV5 A;  2FVA A;  1OR5 A;  2MVU A;  2KG9 A;  2K0Y A;  2AF8 A;  2MD9 A;  2N5H A;  3EJE A;  4BPG A;  1X3O A;  2FQ2 A;  2FAD A;  1DNY A;  2K93 A;  4DG9 A;  3EJB A;  2KOO A;  3NY7 B;  4HKG A;  2AFE A;  2JU2 A;  2KW2 A;  2MVV A;  2KGC A;  2PNG A;  2KGE A;  4MRT C;  1HQB A;  4BPH A;  2FVE A;  4H2X C;  2L4B A;  5KP7 B;  1KLP A;  2KR5 A;  2FAC A;  2AFD A;  2FVF A;  2KGA A;  2EHS A;  2FQ1 A;  1AF8 A;  4R0M A;  2LTE A;  2MR8 A;  2KOP A;  2N98 A;  2QNW A;  2X2B A;  3CE7 A;  3EJD A;  2JQ4 A;  2L0Q A;  2XZ0 D;  4H2Y C;  5HV8 A;  5EJD A;  4PXH B;  2K94 A;  4H2W C;  2K2Q A;  2LIW A;  2L9F A;  2EHT A;  1ACP A;  4IZ6 A;  2DNW A;  2ROQ A;  2K92 A;  2KG8 A;  2K0X A;  2KGD A;  2JGP A;  5KP6 B;  2XZ1 C;  2VSQ A;  2MF4 A;  3GZL A;  4CA3 A;  5HVC A;  1HY8 A;  2N5I A;  2MR7 A; 
#chains in the Genus database with same CATH topology
 4F37 A;  2LL8 A;  3NTE A;  3G1G A;  3DTJ A;  1Q81 Q;  2KG6 A;  1IUQ A;  1M6E X;  5CZD B;  3I55 P;  4NEO A;  1GXG A;  3CC4 P;  3G1I A;  2KWL A;  3DS3 A;  3I56 P;  1L0H A;  1VKU A;  3CCL P;  2KOS A;  2EG5 A;  2PEO A;  2CNR A;  3G6E P;  2MY5 A;  2Z44 A;  3P05 A;  1Q7Y Q;  3LMO A;  1YJN P;  2KG9 A;  4QNB A;  2K0Y A;  2N5H A;  2JBG A;  3E2D A;  3G26 A;  3CCE P;  3MGE A;  1E6J P;  1AYI A;  3OW2 O;  5BS1 A;  2DGY A;  2AFE A;  2QEX P;  3U43 A;  2MVV A;  3G4S P;  3GKL C;  2KGE A;  4MRT C;  1HQB A;  5F2K A;  2WPT A;  2VLQ A;  1AUM A;  2LF4 A;  5KP7 B;  3DS0 A;  1KLP A;  2FAC A;  2FVF A;  4IPY A;  1MZ8 A;  1VQ6 P;  2XV6 A;  1ZMB A;  2JQ4 A;  1VQO P;  1VQK P;  2XZ0 D;  1E0H A;  4H2Y C;  5HV8 A;  1RO0 A;  2L9F A;  2KGD A;  5KP6 B;  2MF4 A;  2JO0 A;  5HVC A;  1FR2 A;  2VLP A;  3G0V A;  2CGQ A;  1YJW P;  3B4Q A;  1KQS O;  1VQM P;  4PH1 A;  1QVG O;  1K9M Q;  3GJN A;  2LML A;  1F80 D;  3M1M A;  5F2N A;  1M1K Q;  4U0C A;  2FAE A;  4U0F A;  2KOR A;  2AVA A;  1EIA A;  1GXH A;  1VQ7 P;  2GDY A;  3DS5 A;  2BUO A;  2M5R A;  1D1D A;  4XRO A;  3RG2 A;  1OR5 A;  1K73 Q;  2PEN A;  2AF8 A;  2MD9 A;  2M8L A;  1Q86 Q;  1K8A Q;  1W2B O;  5BS2 A;  3CCS P;  3CMA P;  3EJB A;  2KOO A;  3DS1 A;  4WYM A;  2GZI A;  1Q82 Q;  4QKO A;  1M74 A;  1VQ9 P;  1UJZ A;  3RG6 C;  4BPH A;  2ONT A;  3CME P;  4H2X C;  2P9X A;  2KR5 A;  2AFD A;  2KGA A;  2EHS A;  1BAJ A;  2XT1 A;  2N98 A;  1BXI A;  3CE7 A;  5HGN A;  3VRL C;  2PY8 A;  4XFX A;  1IMP A;  2LIW A;  1KD1 Q;  1ACP A;  3Q20 A;  4GR2 A;  1VQN P;  2GDX A;  1RO2 A;  2L6E A;  2LOL A;  3GZM A;  3CC7 P;  1S72 P;  2N6Z A;  2M8N A;  2N50 A;  4COP A;  2JYG A;  4COC A;  1NJI Q;  4U0E A;  7CEI A;  1CEI A;  2GDW A;  2OTJ P;  2KOQ A;  5EW5 E;  2FHS C;  2PEQ A;  3CCU P;  3B5I A;  4U0B A;  3WBH A;  2CWO A;  2GZG A;  4GR6 A;  1DV5 A;  2FVA A;  2MVU A;  5I4T G;  3EJE A;  2KOD A;  1M90 Q;  4U0A A;  4DG9 A;  1A43 A;  2GZF A;  3DS4 A;  4UHP B;  4HKG A;  2JU2 A;  2KW2 A;  2KGC A;  2JYL A;  2PNG A;  3CXC O;  1M6N A;  2E1M A;  1GPJ A;  2FQ1 A;  2GYK A;  1VQ8 P;  2OAR A;  1QVF O;  4PH0 A;  2L0Q A;  1YIT P;  3G29 A;  2PEI A;  2BHV A;  3H0D A;  5HGM A;  5EJD A;  2GZJ A;  4PXH B;  4XFZ A;  2Z46 A;  4H2W C;  3CPW O;  1UNK A;  4XFY A;  2PEJ A;  1EOQ A;  2K0D X;  2K92 A;  2KG8 A;  2M8P A;  2QA4 P;  4XRQ A;  2JGP A;  2XZ1 C;  2VSQ A;  3GZL A;  1HY8 A;  2N5I A;  2MR7 A;  2JB0 A;  3H47 A;  5HGL A;  2JAZ A;  2EIA A;  2LKI A;  2CG5 B;  1ZNV A;  2ERH A;  4BPF A;  4PWV B;  3CCM P;  5KP8 B;  1YI2 P;  2PEK A;  2FQ0 A;  2JU1 A;  1T8K A;  4M0I A;  2CQ8 A;  2NO8 A;  2VLO A;  1L0I A;  2GZE A;  2Z45 A;  1NQ4 A;  2N6Y A;  3HZQ A;  1Z6M A;  1A8O A;  2LPK A;  2L22 A;  3CCQ P;  1YIJ P;  2EFJ A;  2LIU A;  3DPH A;  3G21 A;  1K30 A;  3DS2 A;  4BPG A;  1X3O A;  1YHQ P;  2FQ2 A;  3G28 A;  2FAD A;  1DNY A;  2K93 A;  4U0D A;  1QRJ A;  2OTL P;  3NY7 B;  1N8R Q;  1VQ4 P;  2FVE A;  2L4B A;  1JJ2 O;  3HYB A;  1RNI A;  3G71 P;  3CD6 P;  1AF8 A;  4R0M A;  2LTE A;  3CCV P;  2MR8 A;  2KOP A;  2QNW A;  2X2B A;  3EJD A;  3LRY A;  1KC8 Q;  1IMQ A;  2XXM A;  1VQP P;  2PEM A;  3H4E A;  3CC2 P;  2K94 A;  2K2Q A;  2VLN A;  5JPA A;  3CCR P;  2EHT A;  2K5X A;  3CCJ P;  1EMV A;  4IZ6 A;  2DNW A;  2ROQ A;  5HGO A;  2K0X A;  1VQ5 P;  4CA3 A;  5F2O A;  5DCK A;  1VQL P;  1YJ9 P;  1VHN A; 
#chains in the Genus database with same CATH homology
 2CGQ A;  2GDX A;  2LL8 A;  3GZM A;  2LOL A;  2LKI A;  2CG5 B;  2N6Z A;  2LML A;  2KG6 A;  4PWV B;  4BPF A;  2N50 A;  5KP8 B;  1F80 D;  2FQ0 A;  2JU1 A;  1T8K A;  5CZD B;  2CQ8 A;  4NEO A;  2GDW A;  2KOQ A;  2FAE A;  2KOR A;  2AVA A;  2KWL A;  1L0I A;  2FHS C;  1L0H A;  1VKU A;  2GDY A;  2KOS A;  1NQ4 A;  2M5R A;  2N6Y A;  2CNR A;  2LPK A;  2MY5 A;  2L22 A;  3LMO A;  3RG2 A;  2LIU A;  1DV5 A;  2FVA A;  1OR5 A;  2MVU A;  2KG9 A;  2K0Y A;  2AF8 A;  2MD9 A;  2N5H A;  3EJE A;  4BPG A;  1X3O A;  2FQ2 A;  2FAD A;  1DNY A;  2K93 A;  4DG9 A;  3EJB A;  2KOO A;  3NY7 B;  4HKG A;  2AFE A;  2JU2 A;  2KW2 A;  2MVV A;  2KGC A;  2PNG A;  2KGE A;  4MRT C;  1HQB A;  4BPH A;  2FVE A;  4H2X C;  2L4B A;  5KP7 B;  1KLP A;  2KR5 A;  2FAC A;  2AFD A;  2FVF A;  2KGA A;  2EHS A;  2FQ1 A;  1AF8 A;  4R0M A;  2LTE A;  2MR8 A;  2KOP A;  2N98 A;  2QNW A;  2X2B A;  3CE7 A;  3EJD A;  2JQ4 A;  2L0Q A;  2XZ0 D;  4H2Y C;  5HV8 A;  5EJD A;  4PXH B;  2K94 A;  4H2W C;  2K2Q A;  2LIW A;  2L9F A;  2EHT A;  1ACP A;  4IZ6 A;  2DNW A;  2ROQ A;  2K92 A;  2KG8 A;  2K0X A;  2KGD A;  2JGP A;  5KP6 B;  2XZ1 C;  2VSQ A;  2MF4 A;  3GZL A;  4CA3 A;  5HVC A;  1HY8 A;  2N5I A;  2MR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...