5HVCA

Solution structure of the apo state of the acyl carrier protein from the mlsa2 subunit of the mycolactone polyketide synthase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
95
structure length
95
Chain Sequence
GSHMRLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLDLPPTLIFDHPTPHALTQHLHTRLTQSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sticky swinging arm dynamics: studies of an acyl carrier protein domain from the mycolactone polyketide synthase.
pubmed doi rcsb
source organism Mycobacterium ulcerans
molecule tags Transferase
molecule keywords Type I modular polyketide synthase
total genus 27
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5hvcA00
2LL8A 4BPGA 2N98A 2AF8A 2N5HA 2KGAA 3EJBA 2GDYA 2L0QA 2XZ1C 5EJDA 2JU1A 2L9FA 2EHSA 3LMOA 2ROQA 2KWLA 4H2WC 2K92A 2CNRA 2N6ZA 2LPKA 4BPHA 4R0MA 1OR5A 2N5IA 2KG8A 2KOSA 2LIUA 4PWVB 2XZ0D 2CQ8A 4NEOA 2MVVA 2FVFA 2FVEA 4BPFA 2FHSC 2FAEA 2MD9A 3NY7B 2L4BA 2KGCA 5KP6B 2MR7A 2M5RA 3GZMA 3GZLA 2QNWA 4HKGA 1HQBA 4IZ6A 2KORA 2KOQA 2FVAA 5HV8A 2KOPA 3EJDA 2L22A 2MR8A 1DV5A 1HY8A 2LIWA 2LTEA 2KW2A 1DNYA 2AFDA 2K94A 2K93A 2DNWA 2FQ2A 1X3OA 2AFEA 4MRTC 5KP7B 2N50A 1AF8A 2EHTA 2LKIA 1KLPA 2FQ0A 2AVAA 3EJEA 1F80D 4H2YC 2JGPA 2MVUA 2GDWA 3RG2A 1L0HA 4DG9A 2K2QA 1T8KA 2FACA 2VSQA 2LMLA 2FQ1A 2X2BA 2MF4A 1VKUA 2CGQA 5CZDB 2KR5A 5KP8B 2K0XA 2CG5B 2LOLA 3CE7A 2JU2A 4CA3A 2KOOA 2N6YA 2PNGA 2KG9A 2FADA 2KGDA 4H2XC 2KG6A 2KGEA 1L0IA 4PXHB 2JQ4A 2K0YA 1ACPA 1NQ4A 2MY5A 2GDXA 5HVCA
chains in the Genus database with same CATH superfamily
1KQSO 4BPGA 4U0AA 5F2KA 5F2OA 3HZQA 1RO0A 1AYIA 2K5XA 2EFJA 1QRJA 2GDYA 3DS4A 5EJDA 3CCMP 3CCEP 2JU1A 3G1IA 3LMOA 3G71P 2KWLA 2K92A 2CNRA 2GYKA 2LPKA 2PENA 3GJNA 3I55P 1IUQA 1RO2A 1ZMBA 1EOQA 2FVFA 1AUMA 1VHNA 1UJZA 2BUOA 2M8LA 3NY7B 2KGCA 2QEXP 2M5RA 2KORA 5BS1A 5HV8A 2QA4P 2EIAA 3CC4P 2NO8A 1YI2P 2MR8A 2PEMA 1DNYA 5EW5E 1VQLP 2K93A 3E2DA 3DTJA 3HYBA 2JGPA 3DS2A 1FR2A 1T8KA 4COPA 2FACA 1W2BO 3B5IA 1VQ6P 1D1DA 2K0XA 2Z45A 2LOLA 4CA3A 2JYGA 2GDXA 2JAZA 2CWOA 2LL8A 4COCA 3G28A 1Q86Q 3EJBA 3P05A 4M0IA 4PH1A 2EHSA 1M90Q 2N6ZA 1YITP 1M74A 4R0MA 1MZ8A 1IMPA 2KOSA 2LIUA 2XZ0D 2P9XA 3I56P 3H47A 2CQ8A 4NEOA 5HGNA 1GXGA 2DGYA 2FVEA 3G1GA 2EG5A 1KC8Q 2GZEA 3CD6P 1A8OA 2E1MA 7CEIA 2MD9A 2XT1A 2XV6A 1K30A 5KP6B 2XXMA 3GKLC 2MR7A 3GZMA 3DS5A 3GZLA 2QNWA 5HGMA 4IZ6A 1HQBA 4XFYA 1N8RQ 1RNIA 2KOPA 4F37A 2L22A 1EMVA 1DV5A 1HY8A 2LIWA 2KW2A 2DNWA 2FQ2A 2OTJP 3DS0A 2N50A 1AF8A 2LKIA 1KLPA 2Z44A 2FQ0A 2AVAA 2ONTA 3CCQP 4XROA 1F80D 2JBGA 3G21A 1K8AQ 2MVUA 2GDWA 5HGLA 2PEIA 4DG9A 3H4EA 1UNKA 1K73Q 2PEKA 2MF4A 2CGQA 5KP8B 3WBHA 2CG5B 3CE7A 2JU2A 3U43A 2KOOA 2N6YA 4UHPB 2FADA 2GZIA 2M8NA 2KGEA 2K0YA 2MY5A 5HVCA 1M6NA 2OTLP 2ERHA 2N98A 3CXCO 2L0QA 2XZ1C 1ZNVA 1QVFO 2L9FA 5F2NA 3DPHA 2ROQA 4H2WC 4BPHA 1YJNP 2N5IA 3G0VA 4PWVB 1M6EX 2VLNA 3DS1A 2MVVA 1YIJP 1Q7YQ 4BPFA 1Q82Q 2FHSC 2JYLA 2LF4A 2FAEA 4WYMA 1YJ9P 1YHQP 2VLOA 3CCJP 3CMEP 1A43A 2JB0A 1NJIQ 2KOQA 2FVAA 1VQ4P 1QVGO 3NTEA 3Q20A 3EJDA 1GPJA 4XFZA 1K9MQ 1Q81Q 2AFDA 5JPAA 3CC7P 4IPYA 3VRLC 1X3OA 4MRTC 5KP7B 2EHTA 3CCSP 3H0DA 3DS3A 2M8PA 1BXIA 1VQ5P 4U0DA 1E6JP 1L0HA 1E0HA 4PH0A 2X2BA 1VKUA 2L6EA 2KR5A 4U0BA 1M1KQ 2KGDA 2PY8A 4H2XC 2KG6A 2KODA 4PXHB 5BS2A 3CMAP 3G26A 2AF8A 2N5HA 5HGOA 2KGAA 2Z46A 1IMQA 2GZGA 1VQ8P 1KD1Q 1VQNP 2VLPA 4U0CA 3CCRP 3CPWO 2PEQA 1OR5A 2K0DX 2KG8A 3CCLP 1Z6MA 2GZFA 2GZJA 4U0EA 3G4SP 1VQMP 3G6EP 1CEIA 2PEOA 3RG6C 2L4BA 1VQKP 4U0FA 1VQPP 1GXHA 1VQ7P 4HKGA 4XFXA 3CCUP 3OW2O 1VQ9P 2BHVA 3CCVP 3B4QA 1S72P 2LTEA 1EIAA 2K94A 2JO0A 2AFEA 5I4TG 4QKOA 3EJEA 1VQOP 4QNBA 2WPTA 3LRYA 4H2YC 3RG2A 2K2QA 2VLQA 2VSQA 4GR2A 2LMLA 2FQ1A 2OARA 5CZDB 3G29A 3MGEA 1YJWP 1JJ2O 2PNGA 3M1MA 2KG9A 5DCKA 2PEJA 3CC2P 1L0IA 2JQ4A 4XRQA 1ACPA 1NQ4A 4GR6A 1BAJA
chains in the Genus database with same CATH topology
2LL8A 4BPGA 2N98A 2AF8A 2N5HA 2KGAA 3EJBA 2GDYA 2L0QA 2XZ1C 5EJDA 2JU1A 2L9FA 2EHSA 3LMOA 2ROQA 2KWLA 4H2WC 2K92A 2CNRA 2N6ZA 2LPKA 4BPHA 4R0MA 1OR5A 2N5IA 2KG8A 2KOSA 2LIUA 4PWVB 2XZ0D 2CQ8A 4NEOA 2MVVA 2FVFA 2FVEA 4BPFA 2FHSC 2FAEA 2MD9A 3NY7B 2L4BA 2KGCA 5KP6B 2MR7A 2M5RA 3GZMA 3GZLA 2QNWA 4HKGA 1HQBA 4IZ6A 2KORA 2KOQA 2FVAA 5HV8A 2KOPA 3EJDA 2L22A 2MR8A 1DV5A 1HY8A 2LIWA 2LTEA 2KW2A 1DNYA 2AFDA 2K94A 2K93A 2DNWA 2FQ2A 1X3OA 2AFEA 4MRTC 5KP7B 2N50A 1AF8A 2EHTA 2LKIA 1KLPA 2FQ0A 2AVAA 3EJEA 1F80D 4H2YC 2JGPA 2MVUA 2GDWA 3RG2A 1L0HA 4DG9A 2K2QA 1T8KA 2FACA 2VSQA 2LMLA 2FQ1A 2X2BA 2MF4A 1VKUA 2CGQA 5CZDB 2KR5A 5KP8B 2K0XA 2CG5B 2LOLA 3CE7A 2JU2A 4CA3A 2KOOA 2N6YA 2PNGA 2KG9A 2FADA 2KGDA 4H2XC 2KG6A 2KGEA 1L0IA 4PXHB 2JQ4A 2K0YA 1ACPA 1NQ4A 2MY5A 2GDXA 5HVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LL8 A;  4BPG A;  2N98 A;  2AF8 A;  2N5H A;  2KGA A;  3EJB A;  2GDY A;  2L0Q A;  2XZ1 C;  5EJD A;  2JU1 A;  2L9F A;  2EHS A;  3LMO A;  2ROQ A;  2KWL A;  4H2W C;  2K92 A;  2CNR A;  2N6Z A;  2LPK A;  4BPH A;  4R0M A;  1OR5 A;  2N5I A;  2KG8 A;  2KOS A;  2LIU A;  4PWV B;  2XZ0 D;  2CQ8 A;  4NEO A;  2MVV A;  2FVF A;  2FVE A;  4BPF A;  2FHS C;  2FAE A;  2MD9 A;  3NY7 B;  2L4B A;  2KGC A;  5KP6 B;  2MR7 A;  2M5R A;  3GZM A;  3GZL A;  2QNW A;  4HKG A;  1HQB A;  4IZ6 A;  2KOR A;  2KOQ A;  2FVA A;  5HV8 A;  2KOP A;  3EJD A;  2L22 A;  2MR8 A;  1DV5 A;  1HY8 A;  2LIW A;  2LTE A;  2KW2 A;  1DNY A;  2AFD A;  2K94 A;  2K93 A;  2DNW A;  2FQ2 A;  1X3O A;  2AFE A;  4MRT C;  5KP7 B;  2N50 A;  1AF8 A;  2EHT A;  2LKI A;  1KLP A;  2FQ0 A;  2AVA A;  3EJE A;  1F80 D;  4H2Y C;  2JGP A;  2MVU A;  2GDW A;  3RG2 A;  1L0H A;  4DG9 A;  2K2Q A;  1T8K A;  2FAC A;  2VSQ A;  2LML A;  2FQ1 A;  2X2B A;  2MF4 A;  1VKU A;  2CGQ A;  5CZD B;  2KR5 A;  5KP8 B;  2K0X A;  2CG5 B;  2LOL A;  3CE7 A;  2JU2 A;  4CA3 A;  2KOO A;  2N6Y A;  2PNG A;  2KG9 A;  2FAD A;  2KGD A;  4H2X C;  2KG6 A;  2KGE A;  1L0I A;  4PXH B;  2JQ4 A;  2K0Y A;  1ACP A;  1NQ4 A;  2MY5 A;  2GDX A;  5HVC A; 
#chains in the Genus database with same CATH topology
 1KQS O;  4BPG A;  4U0A A;  5F2K A;  5F2O A;  3HZQ A;  1RO0 A;  1AYI A;  2K5X A;  2EFJ A;  1QRJ A;  2GDY A;  3DS4 A;  5EJD A;  3CCM P;  3CCE P;  2JU1 A;  3G1I A;  3LMO A;  3G71 P;  2KWL A;  2K92 A;  2CNR A;  2GYK A;  2LPK A;  2PEN A;  3GJN A;  3I55 P;  1IUQ A;  1RO2 A;  1ZMB A;  1EOQ A;  2FVF A;  1AUM A;  1VHN A;  1UJZ A;  2BUO A;  2M8L A;  3NY7 B;  2KGC A;  2QEX P;  2M5R A;  2KOR A;  5BS1 A;  5HV8 A;  2QA4 P;  2EIA A;  3CC4 P;  2NO8 A;  1YI2 P;  2MR8 A;  2PEM A;  1DNY A;  5EW5 E;  1VQL P;  2K93 A;  3E2D A;  3DTJ A;  3HYB A;  2JGP A;  3DS2 A;  1FR2 A;  1T8K A;  4COP A;  2FAC A;  1W2B O;  3B5I A;  1VQ6 P;  1D1D A;  2K0X A;  2Z45 A;  2LOL A;  4CA3 A;  2JYG A;  2GDX A;  2JAZ A;  2CWO A;  2LL8 A;  4COC A;  3G28 A;  1Q86 Q;  3EJB A;  3P05 A;  4M0I A;  4PH1 A;  2EHS A;  1M90 Q;  2N6Z A;  1YIT P;  1M74 A;  4R0M A;  1MZ8 A;  1IMP A;  2KOS A;  2LIU A;  2XZ0 D;  2P9X A;  3I56 P;  3H47 A;  2CQ8 A;  4NEO A;  5HGN A;  1GXG A;  2DGY A;  2FVE A;  3G1G A;  2EG5 A;  1KC8 Q;  2GZE A;  3CD6 P;  1A8O A;  2E1M A;  7CEI A;  2MD9 A;  2XT1 A;  2XV6 A;  1K30 A;  5KP6 B;  2XXM A;  3GKL C;  2MR7 A;  3GZM A;  3DS5 A;  3GZL A;  2QNW A;  5HGM A;  4IZ6 A;  1HQB A;  4XFY A;  1N8R Q;  1RNI A;  2KOP A;  4F37 A;  2L22 A;  1EMV A;  1DV5 A;  1HY8 A;  2LIW A;  2KW2 A;  2DNW A;  2FQ2 A;  2OTJ P;  3DS0 A;  2N50 A;  1AF8 A;  2LKI A;  1KLP A;  2Z44 A;  2FQ0 A;  2AVA A;  2ONT A;  3CCQ P;  4XRO A;  1F80 D;  2JBG A;  3G21 A;  1K8A Q;  2MVU A;  2GDW A;  5HGL A;  2PEI A;  4DG9 A;  3H4E A;  1UNK A;  1K73 Q;  2PEK A;  2MF4 A;  2CGQ A;  5KP8 B;  3WBH A;  2CG5 B;  3CE7 A;  2JU2 A;  3U43 A;  2KOO A;  2N6Y A;  4UHP B;  2FAD A;  2GZI A;  2M8N A;  2KGE A;  2K0Y A;  2MY5 A;  5HVC A;  1M6N A;  2OTL P;  2ERH A;  2N98 A;  3CXC O;  2L0Q A;  2XZ1 C;  1ZNV A;  1QVF O;  2L9F A;  5F2N A;  3DPH A;  2ROQ A;  4H2W C;  4BPH A;  1YJN P;  2N5I A;  3G0V A;  4PWV B;  1M6E X;  2VLN A;  3DS1 A;  2MVV A;  1YIJ P;  1Q7Y Q;  4BPF A;  1Q82 Q;  2FHS C;  2JYL A;  2LF4 A;  2FAE A;  4WYM A;  1YJ9 P;  1YHQ P;  2VLO A;  3CCJ P;  3CME P;  1A43 A;  2JB0 A;  1NJI Q;  2KOQ A;  2FVA A;  1VQ4 P;  1QVG O;  3NTE A;  3Q20 A;  3EJD A;  1GPJ A;  4XFZ A;  1K9M Q;  1Q81 Q;  2AFD A;  5JPA A;  3CC7 P;  4IPY A;  3VRL C;  1X3O A;  4MRT C;  5KP7 B;  2EHT A;  3CCS P;  3H0D A;  3DS3 A;  2M8P A;  1BXI A;  1VQ5 P;  4U0D A;  1E6J P;  1L0H A;  1E0H A;  4PH0 A;  2X2B A;  1VKU A;  2L6E A;  2KR5 A;  4U0B A;  1M1K Q;  2KGD A;  2PY8 A;  4H2X C;  2KG6 A;  2KOD A;  4PXH B;  5BS2 A;  3CMA P;  3G26 A;  2AF8 A;  2N5H A;  5HGO A;  2KGA A;  2Z46 A;  1IMQ A;  2GZG A;  1VQ8 P;  1KD1 Q;  1VQN P;  2VLP A;  4U0C A;  3CCR P;  3CPW O;  2PEQ A;  1OR5 A;  2K0D X;  2KG8 A;  3CCL P;  1Z6M A;  2GZF A;  2GZJ A;  4U0E A;  3G4S P;  1VQM P;  3G6E P;  1CEI A;  2PEO A;  3RG6 C;  2L4B A;  1VQK P;  4U0F A;  1VQP P;  1GXH A;  1VQ7 P;  4HKG A;  4XFX A;  3CCU P;  3OW2 O;  1VQ9 P;  2BHV A;  3CCV P;  3B4Q A;  1S72 P;  2LTE A;  1EIA A;  2K94 A;  2JO0 A;  2AFE A;  5I4T G;  4QKO A;  3EJE A;  1VQO P;  4QNB A;  2WPT A;  3LRY A;  4H2Y C;  3RG2 A;  2K2Q A;  2VLQ A;  2VSQ A;  4GR2 A;  2LML A;  2FQ1 A;  2OAR A;  5CZD B;  3G29 A;  3MGE A;  1YJW P;  1JJ2 O;  2PNG A;  3M1M A;  2KG9 A;  5DCK A;  2PEJ A;  3CC2 P;  1L0I A;  2JQ4 A;  4XRQ A;  1ACP A;  1NQ4 A;  4GR6 A;  1BAJ A; 
#chains in the Genus database with same CATH homology
 2LL8 A;  4BPG A;  2N98 A;  2AF8 A;  2N5H A;  2KGA A;  3EJB A;  2GDY A;  2L0Q A;  2XZ1 C;  5EJD A;  2JU1 A;  2L9F A;  2EHS A;  3LMO A;  2ROQ A;  2KWL A;  4H2W C;  2K92 A;  2CNR A;  2N6Z A;  2LPK A;  4BPH A;  4R0M A;  1OR5 A;  2N5I A;  2KG8 A;  2KOS A;  2LIU A;  4PWV B;  2XZ0 D;  2CQ8 A;  4NEO A;  2MVV A;  2FVF A;  2FVE A;  4BPF A;  2FHS C;  2FAE A;  2MD9 A;  3NY7 B;  2L4B A;  2KGC A;  5KP6 B;  2MR7 A;  2M5R A;  3GZM A;  3GZL A;  2QNW A;  4HKG A;  1HQB A;  4IZ6 A;  2KOR A;  2KOQ A;  2FVA A;  5HV8 A;  2KOP A;  3EJD A;  2L22 A;  2MR8 A;  1DV5 A;  1HY8 A;  2LIW A;  2LTE A;  2KW2 A;  1DNY A;  2AFD A;  2K94 A;  2K93 A;  2DNW A;  2FQ2 A;  1X3O A;  2AFE A;  4MRT C;  5KP7 B;  2N50 A;  1AF8 A;  2EHT A;  2LKI A;  1KLP A;  2FQ0 A;  2AVA A;  3EJE A;  1F80 D;  4H2Y C;  2JGP A;  2MVU A;  2GDW A;  3RG2 A;  1L0H A;  4DG9 A;  2K2Q A;  1T8K A;  2FAC A;  2VSQ A;  2LML A;  2FQ1 A;  2X2B A;  2MF4 A;  1VKU A;  2CGQ A;  5CZD B;  2KR5 A;  5KP8 B;  2K0X A;  2CG5 B;  2LOL A;  3CE7 A;  2JU2 A;  4CA3 A;  2KOO A;  2N6Y A;  2PNG A;  2KG9 A;  2FAD A;  2KGD A;  4H2X C;  2KG6 A;  2KGE A;  1L0I A;  4PXH B;  2JQ4 A;  2K0Y A;  1ACP A;  1NQ4 A;  2MY5 A;  2GDX A;  5HVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...