5HVCA

Solution structure of the apo state of the acyl carrier protein from the mlsa2 subunit of the mycolactone polyketide synthase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
95
structure length
95
Chain Sequence
GSHMRLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLDLPPTLIFDHPTPHALTQHLHTRLTQSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Type I modular polyketide synthase
publication title Sticky swinging arm dynamics: studies of an acyl carrier protein domain from the mycolactone polyketide synthase.
pubmed doi rcsb
source organism Mycobacterium ulcerans
molecule tags Transferase
total genus 27
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5hvcA00
2N98A 2KGAA 2MVVA 2LKIA 2KG8A 2LMLA 5CZDB 5EJDA 2KGDA 2MVUA 2CQ8A 2N6ZA 1X3OA 2K2QA 1L0IA 2KG6A 2FQ0A 2JU2A 2MY5A 2AF8A 2KW2A 1L0HA 2CGQA 4PWVB 3RG2A 2K94A 4H2YC 2XZ0D 2MD9A 2FVFA 3GZMA 4BPHA 2KOQA 2N50A 1DNYA 4BPGA 4PXHB 1ACPA 2FQ2A 2FQ1A 2L9FA 2L4BA 2GDWA 2CG5B 2LOLA 2EHSA 3NY7B 2LTEA 2FHSC 4DG9A 3GZLA 1AF8A 1HQBA 3CE7A 5KP6B 4NEOA 2AVAA 2FAEA 5HVCA 2KG9A 2FVEA 2PNGA 2EHTA 1OR5A 2QNWA 4HKGA 2N5IA 4BPFA 2CNRA 2JU1A 2L0QA 1T8KA 2LL8A 2MR7A 1HY8A 4H2WC 2FADA 2LIUA 3EJBA 4R0MA 2K0XA 2K93A 2KR5A 5HV8A 2X2BA 2LIWA 2L22A 2FACA 2DNWA 2KGEA 2LPKA 2FVAA 2KOPA 2GDXA 3EJEA 4CA3A 2N5HA 2K92A 1F80D 1KLPA 2JQ4A 2ROQA 3EJDA 2AFDA 2N6YA 2KOOA 2MF4A 2XZ1C 1DV5A 2KGCA 2MR8A 2M5RA 4H2XC 5KP8B 2KWLA 2GDYA 2KOSA 2K0YA 4MRTC 2VSQA 1NQ4A 4IZ6A 2JGPA 5KP7B 2KORA 2AFEA 3LMOA 1VKUA
chains in the Genus database with same CATH superfamily
5DCKA 2GZEA 2KGAA 2MVVA 1M6EX 1VHNA 1IMQA 3CXCO 2XXMA 1YI2P 1FR2A 2E1MA 5CZDB 2MVUA 4UHPB 1VQ4P 2CQ8A 1JJ2O 2JU2A 1M90Q 4U0DA 3U43A 2MY5A 2AF8A 3CC7P 1QVGO 4U0CA 3HYBA 2XZ0D 2GZGA 1DNYA 1UNKA 2JYGA 2M8NA 3DS1A 2PEQA 5HGNA 2L4BA 1IUQA 3NY7B 2EHSA 5HGOA 3CC2P 2DGYA 2FAEA 3G26A 2PNGA 4HKGA 2N5IA 1Q81Q 2VLPA 3G6EP 1EIAA 4H2WC 2PEIA 2K93A 5F2OA 5HV8A 2X2BA 2OTJP 2GZFA 3CCQP 2DNWA 2KGEA 3Q20A 3H47A 2EFJA 2GDXA 1E6JP 4CA3A 2K92A 1KLPA 2ROQA 1E0HA 1VQNP 3OW2O 1DV5A 4COCA 4F37A 2GZJA 2KGCA 2MR8A 2M5RA 3G4SP 2KWLA 2KOSA 3DS4A 3CCLP 3DS3A 2EG5A 4IZ6A 2KORA 2AFEA 3B4QA 2BUOA 1Z6MA 2GYKA 1GXGA 2P9XA 5EJDA 1L0IA 3B5IA 4XRQA 3P05A 4PH0A 2KG6A 1UJZA 2FQ0A 4U0AA 2VLOA 2KW2A 1L0HA 2CGQA 3MGEA 2K94A 4H2YC 4WYMA 2QEXP 3GKLC 3DS0A 3GZMA 4BPHA 2KOQA 4BPGA 1ACPA 3G29A 3CMEP 5F2NA 4XFYA 2FQ1A 2LOLA 1QRJA 2LTEA 1VQOP 2L6EA 3E2DA 1HQBA 1Q86Q 1ZMBA 3CCEP 1VQ7P 3I55P 2M8PA 2EHTA 2K0DX 4BPFA 1YIJP 2JU1A 4IPYA 2L0QA 2LL8A 2FADA 2LIUA 3EJBA 2JBGA 3CCRP 2LIWA 1VQ9P 2PEKA 1GPJA 5HGLA 2Z46A 5JPAA 2FVAA 3G1IA 3EJEA 2BHVA 2JQ4A 2Z44A 1NJIQ 2AFDA 2LF4A 1YHQP 1Q7YQ 2OARA 1IMPA 5KP8B 4H2XC 3DS5A 1RO2A 2VSQA 2PEOA 3H4EA 1M6NA 5KP7B 1K9MQ 1KD1Q 2KG8A 2LMLA 1GXHA 1W2BO 1ZNVA 4U0EA 2KGDA 3CCSP 7CEIA 2JO0A 1VQLP 1MZ8A 2NO8A 3M1MA 1VQPP 1K30A 2FVFA 2MD9A 2PEJA 2XV6A 2FQ2A 3CPWO 1N8RQ 2L9FA 2VLNA 5BS1A 2GDWA 1YJWP 1VQMP 2FHSC 4DG9A 3GZLA 3G71P 5KP6B 4XFZA 2AVAA 2KG9A 2KODA 1VQ6P 1YJ9P 1OR5A 2QNWA 3G28A 5BS2A 2WPTA 1EOQA 2MR7A 1AYIA 2KR5A 1BXIA 2L22A 2QA4P 1K73Q 3DPHA 3CC4P 3G1GA 3CCJP 3H0DA 5F2KA 1BAJA 3GJNA 2N5HA 1F80D 3EJDA 1AUMA 2N6YA 1VQKP 2GZIA 2MF4A 2XZ1C 3NTEA 2JAZA 1YITP 2GDYA 5I4TG 2K0YA 3LRYA 4MRTC 1A8OA 3LMOA 1VKUA 1RNIA 2N98A 4U0FA 1D1DA 2LKIA 4GR2A 3G0VA 4M0IA 2Z45A 5HGMA 3WBHA 2N6ZA 1X3OA 2K2QA 2VLQA 2PENA 1K8AQ 1QVFO 1S72P 4PWVB 3RG2A 5EW5E 3CMAP 2JB0A 2N50A 4PXHB 3RG6C 2K5XA 1Q82Q 3CCVP 2ONTA 4QKOA 2CG5B 2EIAA 4U0BA 1EMVA 1AF8A 3CE7A 1A43A 4NEOA 1M1KQ 3VRLC 3DS2A 5HVCA 1CEIA 2PY8A 3I56P 2FVEA 2JYLA 1KC8Q 2CNRA 1T8KA 1HY8A 3HZQA 4XFXA 2PEMA 4GR6A 4R0MA 2K0XA 2XT1A 1M74A 1VQ8P 2FACA 2LPKA 4QNBA 3CD6P 2KOPA 1KQSO 3G21A 4COPA 2CWOA 3CCUP 1RO0A 2OTLP 2KOOA 2M8LA 3DTJA 2ERHA 1YJNP 1VQ5P 4XROA 1NQ4A 4PH1A 2JGPA 3CCMP
chains in the Genus database with same CATH topology
2N98A 2KGAA 2MVVA 2LKIA 2KG8A 2LMLA 5CZDB 5EJDA 2KGDA 2MVUA 2CQ8A 2N6ZA 1X3OA 2K2QA 1L0IA 2KG6A 2FQ0A 2JU2A 2MY5A 2AF8A 2KW2A 1L0HA 2CGQA 4PWVB 3RG2A 2K94A 4H2YC 2XZ0D 2MD9A 2FVFA 3GZMA 4BPHA 2KOQA 2N50A 1DNYA 4BPGA 4PXHB 1ACPA 2FQ2A 2FQ1A 2L9FA 2L4BA 2GDWA 2CG5B 2LOLA 2EHSA 3NY7B 2LTEA 2FHSC 4DG9A 3GZLA 1AF8A 1HQBA 3CE7A 5KP6B 4NEOA 2AVAA 2FAEA 5HVCA 2KG9A 2FVEA 2PNGA 2EHTA 1OR5A 2QNWA 4HKGA 2N5IA 4BPFA 2CNRA 2JU1A 2L0QA 1T8KA 2LL8A 2MR7A 1HY8A 4H2WC 2FADA 2LIUA 3EJBA 4R0MA 2K0XA 2K93A 2KR5A 5HV8A 2X2BA 2LIWA 2L22A 2FACA 2DNWA 2KGEA 2LPKA 2FVAA 2KOPA 2GDXA 3EJEA 4CA3A 2N5HA 2K92A 1F80D 1KLPA 2JQ4A 2ROQA 3EJDA 2AFDA 2N6YA 2KOOA 2MF4A 2XZ1C 1DV5A 2KGCA 2MR8A 2M5RA 4H2XC 5KP8B 2KWLA 2GDYA 2KOSA 2K0YA 4MRTC 2VSQA 1NQ4A 4IZ6A 2JGPA 5KP7B 2KORA 2AFEA 3LMOA 1VKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N98 A;  2KGA A;  2MVV A;  2LKI A;  2KG8 A;  2LML A;  5CZD B;  5EJD A;  2KGD A;  2MVU A;  2CQ8 A;  2N6Z A;  1X3O A;  2K2Q A;  1L0I A;  2KG6 A;  2FQ0 A;  2JU2 A;  2MY5 A;  2AF8 A;  2KW2 A;  1L0H A;  2CGQ A;  4PWV B;  3RG2 A;  2K94 A;  4H2Y C;  2XZ0 D;  2MD9 A;  2FVF A;  3GZM A;  4BPH A;  2KOQ A;  2N50 A;  1DNY A;  4BPG A;  4PXH B;  1ACP A;  2FQ2 A;  2FQ1 A;  2L9F A;  2L4B A;  2GDW A;  2CG5 B;  2LOL A;  2EHS A;  3NY7 B;  2LTE A;  2FHS C;  4DG9 A;  3GZL A;  1AF8 A;  1HQB A;  3CE7 A;  5KP6 B;  4NEO A;  2AVA A;  2FAE A;  5HVC A;  2KG9 A;  2FVE A;  2PNG A;  2EHT A;  1OR5 A;  2QNW A;  4HKG A;  2N5I A;  4BPF A;  2CNR A;  2JU1 A;  2L0Q A;  1T8K A;  2LL8 A;  2MR7 A;  1HY8 A;  4H2W C;  2FAD A;  2LIU A;  3EJB A;  4R0M A;  2K0X A;  2K93 A;  2KR5 A;  5HV8 A;  2X2B A;  2LIW A;  2L22 A;  2FAC A;  2DNW A;  2KGE A;  2LPK A;  2FVA A;  2KOP A;  2GDX A;  3EJE A;  4CA3 A;  2N5H A;  2K92 A;  1F80 D;  1KLP A;  2JQ4 A;  2ROQ A;  3EJD A;  2AFD A;  2N6Y A;  2KOO A;  2MF4 A;  2XZ1 C;  1DV5 A;  2KGC A;  2MR8 A;  2M5R A;  4H2X C;  5KP8 B;  2KWL A;  2GDY A;  2KOS A;  2K0Y A;  4MRT C;  2VSQ A;  1NQ4 A;  4IZ6 A;  2JGP A;  5KP7 B;  2KOR A;  2AFE A;  3LMO A;  1VKU A; 
#chains in the Genus database with same CATH topology
 5DCK A;  2GZE A;  2KGA A;  2MVV A;  1M6E X;  1VHN A;  1IMQ A;  3CXC O;  2XXM A;  1YI2 P;  1FR2 A;  2E1M A;  5CZD B;  2MVU A;  4UHP B;  1VQ4 P;  2CQ8 A;  1JJ2 O;  2JU2 A;  1M90 Q;  4U0D A;  3U43 A;  2MY5 A;  2AF8 A;  3CC7 P;  1QVG O;  4U0C A;  3HYB A;  2XZ0 D;  2GZG A;  1DNY A;  1UNK A;  2JYG A;  2M8N A;  3DS1 A;  2PEQ A;  5HGN A;  2L4B A;  1IUQ A;  3NY7 B;  2EHS A;  5HGO A;  3CC2 P;  2DGY A;  2FAE A;  3G26 A;  2PNG A;  4HKG A;  2N5I A;  1Q81 Q;  2VLP A;  3G6E P;  1EIA A;  4H2W C;  2PEI A;  2K93 A;  5F2O A;  5HV8 A;  2X2B A;  2OTJ P;  2GZF A;  3CCQ P;  2DNW A;  2KGE A;  3Q20 A;  3H47 A;  2EFJ A;  2GDX A;  1E6J P;  4CA3 A;  2K92 A;  1KLP A;  2ROQ A;  1E0H A;  1VQN P;  3OW2 O;  1DV5 A;  4COC A;  4F37 A;  2GZJ A;  2KGC A;  2MR8 A;  2M5R A;  3G4S P;  2KWL A;  2KOS A;  3DS4 A;  3CCL P;  3DS3 A;  2EG5 A;  4IZ6 A;  2KOR A;  2AFE A;  3B4Q A;  2BUO A;  1Z6M A;  2GYK A;  1GXG A;  2P9X A;  5EJD A;  1L0I A;  3B5I A;  4XRQ A;  3P05 A;  4PH0 A;  2KG6 A;  1UJZ A;  2FQ0 A;  4U0A A;  2VLO A;  2KW2 A;  1L0H A;  2CGQ A;  3MGE A;  2K94 A;  4H2Y C;  4WYM A;  2QEX P;  3GKL C;  3DS0 A;  3GZM A;  4BPH A;  2KOQ A;  4BPG A;  1ACP A;  3G29 A;  3CME P;  5F2N A;  4XFY A;  2FQ1 A;  2LOL A;  1QRJ A;  2LTE A;  1VQO P;  2L6E A;  3E2D A;  1HQB A;  1Q86 Q;  1ZMB A;  3CCE P;  1VQ7 P;  3I55 P;  2M8P A;  2EHT A;  2K0D X;  4BPF A;  1YIJ P;  2JU1 A;  4IPY A;  2L0Q A;  2LL8 A;  2FAD A;  2LIU A;  3EJB A;  2JBG A;  3CCR P;  2LIW A;  1VQ9 P;  2PEK A;  1GPJ A;  5HGL A;  2Z46 A;  5JPA A;  2FVA A;  3G1I A;  3EJE A;  2BHV A;  2JQ4 A;  2Z44 A;  1NJI Q;  2AFD A;  2LF4 A;  1YHQ P;  1Q7Y Q;  2OAR A;  1IMP A;  5KP8 B;  4H2X C;  3DS5 A;  1RO2 A;  2VSQ A;  2PEO A;  3H4E A;  1M6N A;  5KP7 B;  1K9M Q;  1KD1 Q;  2KG8 A;  2LML A;  1GXH A;  1W2B O;  1ZNV A;  4U0E A;  2KGD A;  3CCS P;  7CEI A;  2JO0 A;  1VQL P;  1MZ8 A;  2NO8 A;  3M1M A;  1VQP P;  1K30 A;  2FVF A;  2MD9 A;  2PEJ A;  2XV6 A;  2FQ2 A;  3CPW O;  1N8R Q;  2L9F A;  2VLN A;  5BS1 A;  2GDW A;  1YJW P;  1VQM P;  2FHS C;  4DG9 A;  3GZL A;  3G71 P;  5KP6 B;  4XFZ A;  2AVA A;  2KG9 A;  2KOD A;  1VQ6 P;  1YJ9 P;  1OR5 A;  2QNW A;  3G28 A;  5BS2 A;  2WPT A;  1EOQ A;  2MR7 A;  1AYI A;  2KR5 A;  1BXI A;  2L22 A;  2QA4 P;  1K73 Q;  3DPH A;  3CC4 P;  3G1G A;  3CCJ P;  3H0D A;  5F2K A;  1BAJ A;  3GJN A;  2N5H A;  1F80 D;  3EJD A;  1AUM A;  2N6Y A;  1VQK P;  2GZI A;  2MF4 A;  2XZ1 C;  3NTE A;  2JAZ A;  1YIT P;  2GDY A;  5I4T G;  2K0Y A;  3LRY A;  4MRT C;  1A8O A;  3LMO A;  1VKU A;  1RNI A;  2N98 A;  4U0F A;  1D1D A;  2LKI A;  4GR2 A;  3G0V A;  4M0I A;  2Z45 A;  5HGM A;  3WBH A;  2N6Z A;  1X3O A;  2K2Q A;  2VLQ A;  2PEN A;  1K8A Q;  1QVF O;  1S72 P;  4PWV B;  3RG2 A;  5EW5 E;  3CMA P;  2JB0 A;  2N50 A;  4PXH B;  3RG6 C;  2K5X A;  1Q82 Q;  3CCV P;  2ONT A;  4QKO A;  2CG5 B;  2EIA A;  4U0B A;  1EMV A;  1AF8 A;  3CE7 A;  1A43 A;  4NEO A;  1M1K Q;  3VRL C;  3DS2 A;  5HVC A;  1CEI A;  2PY8 A;  3I56 P;  2FVE A;  2JYL A;  1KC8 Q;  2CNR A;  1T8K A;  1HY8 A;  3HZQ A;  4XFX A;  2PEM A;  4GR6 A;  4R0M A;  2K0X A;  2XT1 A;  1M74 A;  1VQ8 P;  2FAC A;  2LPK A;  4QNB A;  3CD6 P;  2KOP A;  1KQS O;  3G21 A;  4COP A;  2CWO A;  3CCU P;  1RO0 A;  2OTL P;  2KOO A;  2M8L A;  3DTJ A;  2ERH A;  1YJN P;  1VQ5 P;  4XRO A;  1NQ4 A;  4PH1 A;  2JGP A;  3CCM P; 
#chains in the Genus database with same CATH homology
 2N98 A;  2KGA A;  2MVV A;  2LKI A;  2KG8 A;  2LML A;  5CZD B;  5EJD A;  2KGD A;  2MVU A;  2CQ8 A;  2N6Z A;  1X3O A;  2K2Q A;  1L0I A;  2KG6 A;  2FQ0 A;  2JU2 A;  2MY5 A;  2AF8 A;  2KW2 A;  1L0H A;  2CGQ A;  4PWV B;  3RG2 A;  2K94 A;  4H2Y C;  2XZ0 D;  2MD9 A;  2FVF A;  3GZM A;  4BPH A;  2KOQ A;  2N50 A;  1DNY A;  4BPG A;  4PXH B;  1ACP A;  2FQ2 A;  2FQ1 A;  2L9F A;  2L4B A;  2GDW A;  2CG5 B;  2LOL A;  2EHS A;  3NY7 B;  2LTE A;  2FHS C;  4DG9 A;  3GZL A;  1AF8 A;  1HQB A;  3CE7 A;  5KP6 B;  4NEO A;  2AVA A;  2FAE A;  5HVC A;  2KG9 A;  2FVE A;  2PNG A;  2EHT A;  1OR5 A;  2QNW A;  4HKG A;  2N5I A;  4BPF A;  2CNR A;  2JU1 A;  2L0Q A;  1T8K A;  2LL8 A;  2MR7 A;  1HY8 A;  4H2W C;  2FAD A;  2LIU A;  3EJB A;  4R0M A;  2K0X A;  2K93 A;  2KR5 A;  5HV8 A;  2X2B A;  2LIW A;  2L22 A;  2FAC A;  2DNW A;  2KGE A;  2LPK A;  2FVA A;  2KOP A;  2GDX A;  3EJE A;  4CA3 A;  2N5H A;  2K92 A;  1F80 D;  1KLP A;  2JQ4 A;  2ROQ A;  3EJD A;  2AFD A;  2N6Y A;  2KOO A;  2MF4 A;  2XZ1 C;  1DV5 A;  2KGC A;  2MR8 A;  2M5R A;  4H2X C;  5KP8 B;  2KWL A;  2GDY A;  2KOS A;  2K0Y A;  4MRT C;  2VSQ A;  1NQ4 A;  4IZ6 A;  2JGP A;  5KP7 B;  2KOR A;  2AFE A;  3LMO A;  1VKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...