5HVCA

Solution structure of the apo state of the acyl carrier protein from the mlsa2 subunit of the mycolactone polyketide synthase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
95
structure length
95
Chain Sequence
GSHMRLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLDLPPTLIFDHPTPHALTQHLHTRLTQSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sticky swinging arm dynamics: studies of an acyl carrier protein domain from the mycolactone polyketide synthase.
pubmed doi rcsb
source organism Mycobacterium ulcerans
molecule tags Transferase
molecule keywords Type I modular polyketide synthase
total genus 27
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5hvcA00
2KGDA 1AF8A 1L0IA 2FVAA 2M5RA 2FHSC 4PXHB 2N5HA 1DV5A 2K0XA 2FQ2A 1KLPA 2MY5A 5KP7B 2DNWA 2AF8A 2LIWA 1L0HA 2GDYA 3EJBA 2KG8A 2FQ0A 2AFDA 4IZ6A 4BPFA 2K92A 5HVCA 4BPHA 2CQ8A 1X3OA 2KG6A 2N98A 2L22A 4H2WC 2LPKA 5CZDB 2FQ1A 2XZ0D 5EJDA 4H2YC 2LKIA 2FAEA 4MRTC 2FADA 2FACA 2VSQA 1T8KA 2KGAA 2KW2A 1DNYA 2KWLA 1HY8A 2LL8A 2KOOA 2K2QA 2JU2A 2L9FA 2FVFA 4PWVB 2LIUA 2KORA 2MVVA 2MR7A 3EJDA 2K94A 4BPGA 2KOSA 1HQBA 5HV8A 4H2XC 2FVEA 2CNRA 4DG9A 5KP8B 2N6YA 2L4BA 2KOPA 2PNGA 3GZMA 2LMLA 2K93A 2EHSA 4NEOA 2QNWA 2N5IA 2JU1A 2GDWA 2LTEA 2JGPA 2L0QA 2KR5A 1F80D 2KG9A 2CG5B 3EJEA 2CGQA 2LOLA 2MR8A 4CA3A 3LMOA 2MF4A 2KGCA 2EHTA 2XZ1C 2JQ4A 3GZLA 1NQ4A 2MD9A 4R0MA 3NY7B 3CE7A 2KOQA 5KP6B 2ROQA 1OR5A 2AVAA 2MVUA 3RG2A 2KGEA 2X2BA 4HKGA 2GDXA 1ACPA 2N6ZA 1VKUA 2N50A 2AFEA 2K0YA
chains in the Genus database with same CATH superfamily
3CCRP 3CCJP 1AF8A 1BAJA 2FVAA 2M5RA 2FHSC 4PXHB 3G6EP 2K0XA 2FQ2A 2LF4A 1Z6MA 2GZGA 2LIWA 1L0HA 1VQ8P 4XFZA 1M6EX 3DS3A 2ONTA 1K30A 1EOQA 2M8LA 4PH0A 4BPFA 2K92A 2XT1A 2PEOA 1E0HA 3G29A 5BS1A 1YITP 2L22A 5CZDB 2FQ1A 2JYGA 2LKIA 1K73Q 1IMQA 1T8KA 2JBGA 1Q7YQ 1KD1Q 3DS1A 1HY8A 2LL8A 3GJNA 1RNIA 4PWVB 3G28A 1GXGA 2MR7A 5DCKA 3CMEP 2P9XA 2ERHA 4XFXA 1HQBA 5EW5E 2FVEA 2CNRA 5KP8B 4UHPB 3GZMA 2LMLA 5F2OA 2EHSA 3H4EA 4NEOA 1M1KQ 3CCVP 1VQ4P 2PENA 4XFYA 2L0QA 3Q20A 3U43A 3M1MA 4XROA 2CGQA 4CA3A 3DS5A 1Q86Q 2KGCA 3I56P 2GZFA 2EG5A 3G1GA 1Q81Q 1YJ9P 2KOQA 1M74A 2KGEA 1K9MQ 3DPHA 1ACPA 1VKUA 1K8AQ 2KGDA 3G4SP 1CEIA 2JO0A 1A8OA 1L0IA 3RG6C 1VQLP 1KLPA 2MY5A 5KP7B 2DNWA 2E1MA 3B5IA 3WBHA 2FQ0A 2AFDA 4PH1A 5HVCA 4BPHA 2M8NA 2NO8A 2PEMA 1W2BO 1VHNA 2PY8A 5EJDA 2PEQA 2FAEA 3CC4P 2FADA 2QA4P 2KGAA 2KWLA 1A43A 2L9FA 2FVFA 2KORA 3E2DA 2MVVA 3LRYA 3EJDA 2KOSA 1GPJA 4H2XC 3CC7P 2KOPA 2K93A 2QNWA 5HGLA 1JJ2O 2JGPA 2KR5A 1VQNP 2KG9A 3CCMP 2JAZA 4U0CA 2LOLA 2MR8A 3CC2P 2EHTA 1NQ4A 2MD9A 3DS4A 2PEIA 5BS2A 3NY7B 2GZJA 3CE7A 2Z45A 5KP6B 1VQ6P 3RG2A 4U0AA 2JB0A 2GDXA 2WPTA 2AFEA 2K0YA 2CQ8A 4QKOA 2VLNA 1GXHA 5F2NA 1YHQP 2PEJA 3DS2A 3EJBA 5HGOA 3DS0A 2DGYA 2KG6A 2N98A 4H2WC 1M90Q 4COCA 1M6NA 2XZ0D 3G21A 4H2YC 3H0DA 1ZNVA 3GKLC 1Q82Q 2VSQA 2FACA 3VRLC 3I55P 2KW2A 1DNYA 1VQ5P 1YI2P 2Z46A 2BUOA 1AYIA 2VLPA 5F2KA 1VQ7P 2K94A 4BPGA 5HV8A 4DG9A 2N6YA 2L4BA 5JPAA 1VQPP 2N5IA 3OW2O 2GDWA 2LTEA 5I4TG 2CWOA 2CG5B 1D1DA 3EJEA 1ZMBA 3LMOA 2XV6A 3CCEP 2JQ4A 1QRJA 1VQ9P 2PEKA 1EIAA 1YJNP 4COPA 1OR5A 2AVAA 2MVUA 7CEIA 4GR6A 3CCQP 1E6JP 1EMVA 2N6ZA 2KODA 4XRQA 2OARA 1UNKA 2JYLA 3G1IA 3HYBA 2M8PA 4GR2A 2N5HA 1DV5A 3DTJA 2AF8A 3MGEA 3CCUP 2BHVA 2VLQA 2GDYA 2VLOA 2KG8A 4WYMA 1RO2A 4IZ6A 4U0BA 3CD6P 1VQOP 5HGNA 2GZEA 1X3OA 1RO0A 2OTJP 1IUQA 2GYKA 2LPKA 3P05A 2K0DX 1FR2A 1VQKP 4MRTC 1QVFO 3CCSP 1UJZA 1KQSO 4U0FA 3CMAP 2KOOA 2K2QA 2JU2A 1BXIA 2LIUA 3G0VA 3H47A 2QEXP 3B4QA 4U0EA 3CXCO 1VQMP 2PNGA 2XXMA 2L6EA 4IPYA 4U0DA 2EFJA 4QNBA 2JU1A 1YIJP 3CPWO 4M0IA 5HGMA 1F80D 1IMPA 2GZIA 4F37A 1MZ8A 2MF4A 2XZ1C 3GZLA 2OTLP 1S72P 4R0MA 1NJIQ 2EIAA 2K5XA 1QVGO 1YJWP 3CCLP 3NTEA 2X2BA 3G71P 4HKGA 3HZQA 1KC8Q 1AUMA 2N50A 2Z44A 1N8RQ 2ROQA 3G26A
chains in the Genus database with same CATH topology
2KGDA 1AF8A 1L0IA 2FVAA 2M5RA 2FHSC 4PXHB 2N5HA 1DV5A 2K0XA 2FQ2A 1KLPA 2MY5A 5KP7B 2DNWA 2AF8A 2LIWA 1L0HA 2GDYA 3EJBA 2KG8A 2FQ0A 2AFDA 4IZ6A 4BPFA 2K92A 5HVCA 4BPHA 2CQ8A 1X3OA 2KG6A 2N98A 2L22A 4H2WC 2LPKA 5CZDB 2FQ1A 2XZ0D 5EJDA 4H2YC 2LKIA 2FAEA 4MRTC 2FADA 2FACA 2VSQA 1T8KA 2KGAA 2KW2A 1DNYA 2KWLA 1HY8A 2LL8A 2KOOA 2K2QA 2JU2A 2L9FA 2FVFA 4PWVB 2LIUA 2KORA 2MVVA 2MR7A 3EJDA 2K94A 4BPGA 2KOSA 1HQBA 5HV8A 4H2XC 2FVEA 2CNRA 4DG9A 5KP8B 2N6YA 2L4BA 2KOPA 2PNGA 3GZMA 2LMLA 2K93A 2EHSA 4NEOA 2QNWA 2N5IA 2JU1A 2GDWA 2LTEA 2JGPA 2L0QA 2KR5A 1F80D 2KG9A 2CG5B 3EJEA 2CGQA 2LOLA 2MR8A 4CA3A 3LMOA 2MF4A 2KGCA 2EHTA 2XZ1C 2JQ4A 3GZLA 1NQ4A 2MD9A 4R0MA 3NY7B 3CE7A 2KOQA 5KP6B 2ROQA 1OR5A 2AVAA 2MVUA 3RG2A 2KGEA 2X2BA 4HKGA 2GDXA 1ACPA 2N6ZA 1VKUA 2N50A 2AFEA 2K0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGD A;  1AF8 A;  1L0I A;  2FVA A;  2M5R A;  2FHS C;  4PXH B;  2N5H A;  1DV5 A;  2K0X A;  2FQ2 A;  1KLP A;  2MY5 A;  5KP7 B;  2DNW A;  2AF8 A;  2LIW A;  1L0H A;  2GDY A;  3EJB A;  2KG8 A;  2FQ0 A;  2AFD A;  4IZ6 A;  4BPF A;  2K92 A;  5HVC A;  4BPH A;  2CQ8 A;  1X3O A;  2KG6 A;  2N98 A;  2L22 A;  4H2W C;  2LPK A;  5CZD B;  2FQ1 A;  2XZ0 D;  5EJD A;  4H2Y C;  2LKI A;  2FAE A;  4MRT C;  2FAD A;  2FAC A;  2VSQ A;  1T8K A;  2KGA A;  2KW2 A;  1DNY A;  2KWL A;  1HY8 A;  2LL8 A;  2KOO A;  2K2Q A;  2JU2 A;  2L9F A;  2FVF A;  4PWV B;  2LIU A;  2KOR A;  2MVV A;  2MR7 A;  3EJD A;  2K94 A;  4BPG A;  2KOS A;  1HQB A;  5HV8 A;  4H2X C;  2FVE A;  2CNR A;  4DG9 A;  5KP8 B;  2N6Y A;  2L4B A;  2KOP A;  2PNG A;  3GZM A;  2LML A;  2K93 A;  2EHS A;  4NEO A;  2QNW A;  2N5I A;  2JU1 A;  2GDW A;  2LTE A;  2JGP A;  2L0Q A;  2KR5 A;  1F80 D;  2KG9 A;  2CG5 B;  3EJE A;  2CGQ A;  2LOL A;  2MR8 A;  4CA3 A;  3LMO A;  2MF4 A;  2KGC A;  2EHT A;  2XZ1 C;  2JQ4 A;  3GZL A;  1NQ4 A;  2MD9 A;  4R0M A;  3NY7 B;  3CE7 A;  2KOQ A;  5KP6 B;  2ROQ A;  1OR5 A;  2AVA A;  2MVU A;  3RG2 A;  2KGE A;  2X2B A;  4HKG A;  2GDX A;  1ACP A;  2N6Z A;  1VKU A;  2N50 A;  2AFE A;  2K0Y A; 
#chains in the Genus database with same CATH topology
 3CCR P;  3CCJ P;  1AF8 A;  1BAJ A;  2FVA A;  2M5R A;  2FHS C;  4PXH B;  3G6E P;  2K0X A;  2FQ2 A;  2LF4 A;  1Z6M A;  2GZG A;  2LIW A;  1L0H A;  1VQ8 P;  4XFZ A;  1M6E X;  3DS3 A;  2ONT A;  1K30 A;  1EOQ A;  2M8L A;  4PH0 A;  4BPF A;  2K92 A;  2XT1 A;  2PEO A;  1E0H A;  3G29 A;  5BS1 A;  1YIT P;  2L22 A;  5CZD B;  2FQ1 A;  2JYG A;  2LKI A;  1K73 Q;  1IMQ A;  1T8K A;  2JBG A;  1Q7Y Q;  1KD1 Q;  3DS1 A;  1HY8 A;  2LL8 A;  3GJN A;  1RNI A;  4PWV B;  3G28 A;  1GXG A;  2MR7 A;  5DCK A;  3CME P;  2P9X A;  2ERH A;  4XFX A;  1HQB A;  5EW5 E;  2FVE A;  2CNR A;  5KP8 B;  4UHP B;  3GZM A;  2LML A;  5F2O A;  2EHS A;  3H4E A;  4NEO A;  1M1K Q;  3CCV P;  1VQ4 P;  2PEN A;  4XFY A;  2L0Q A;  3Q20 A;  3U43 A;  3M1M A;  4XRO A;  2CGQ A;  4CA3 A;  3DS5 A;  1Q86 Q;  2KGC A;  3I56 P;  2GZF A;  2EG5 A;  3G1G A;  1Q81 Q;  1YJ9 P;  2KOQ A;  1M74 A;  2KGE A;  1K9M Q;  3DPH A;  1ACP A;  1VKU A;  1K8A Q;  2KGD A;  3G4S P;  1CEI A;  2JO0 A;  1A8O A;  1L0I A;  3RG6 C;  1VQL P;  1KLP A;  2MY5 A;  5KP7 B;  2DNW A;  2E1M A;  3B5I A;  3WBH A;  2FQ0 A;  2AFD A;  4PH1 A;  5HVC A;  4BPH A;  2M8N A;  2NO8 A;  2PEM A;  1W2B O;  1VHN A;  2PY8 A;  5EJD A;  2PEQ A;  2FAE A;  3CC4 P;  2FAD A;  2QA4 P;  2KGA A;  2KWL A;  1A43 A;  2L9F A;  2FVF A;  2KOR A;  3E2D A;  2MVV A;  3LRY A;  3EJD A;  2KOS A;  1GPJ A;  4H2X C;  3CC7 P;  2KOP A;  2K93 A;  2QNW A;  5HGL A;  1JJ2 O;  2JGP A;  2KR5 A;  1VQN P;  2KG9 A;  3CCM P;  2JAZ A;  4U0C A;  2LOL A;  2MR8 A;  3CC2 P;  2EHT A;  1NQ4 A;  2MD9 A;  3DS4 A;  2PEI A;  5BS2 A;  3NY7 B;  2GZJ A;  3CE7 A;  2Z45 A;  5KP6 B;  1VQ6 P;  3RG2 A;  4U0A A;  2JB0 A;  2GDX A;  2WPT A;  2AFE A;  2K0Y A;  2CQ8 A;  4QKO A;  2VLN A;  1GXH A;  5F2N A;  1YHQ P;  2PEJ A;  3DS2 A;  3EJB A;  5HGO A;  3DS0 A;  2DGY A;  2KG6 A;  2N98 A;  4H2W C;  1M90 Q;  4COC A;  1M6N A;  2XZ0 D;  3G21 A;  4H2Y C;  3H0D A;  1ZNV A;  3GKL C;  1Q82 Q;  2VSQ A;  2FAC A;  3VRL C;  3I55 P;  2KW2 A;  1DNY A;  1VQ5 P;  1YI2 P;  2Z46 A;  2BUO A;  1AYI A;  2VLP A;  5F2K A;  1VQ7 P;  2K94 A;  4BPG A;  5HV8 A;  4DG9 A;  2N6Y A;  2L4B A;  5JPA A;  1VQP P;  2N5I A;  3OW2 O;  2GDW A;  2LTE A;  5I4T G;  2CWO A;  2CG5 B;  1D1D A;  3EJE A;  1ZMB A;  3LMO A;  2XV6 A;  3CCE P;  2JQ4 A;  1QRJ A;  1VQ9 P;  2PEK A;  1EIA A;  1YJN P;  4COP A;  1OR5 A;  2AVA A;  2MVU A;  7CEI A;  4GR6 A;  3CCQ P;  1E6J P;  1EMV A;  2N6Z A;  2KOD A;  4XRQ A;  2OAR A;  1UNK A;  2JYL A;  3G1I A;  3HYB A;  2M8P A;  4GR2 A;  2N5H A;  1DV5 A;  3DTJ A;  2AF8 A;  3MGE A;  3CCU P;  2BHV A;  2VLQ A;  2GDY A;  2VLO A;  2KG8 A;  4WYM A;  1RO2 A;  4IZ6 A;  4U0B A;  3CD6 P;  1VQO P;  5HGN A;  2GZE A;  1X3O A;  1RO0 A;  2OTJ P;  1IUQ A;  2GYK A;  2LPK A;  3P05 A;  2K0D X;  1FR2 A;  1VQK P;  4MRT C;  1QVF O;  3CCS P;  1UJZ A;  1KQS O;  4U0F A;  3CMA P;  2KOO A;  2K2Q A;  2JU2 A;  1BXI A;  2LIU A;  3G0V A;  3H47 A;  2QEX P;  3B4Q A;  4U0E A;  3CXC O;  1VQM P;  2PNG A;  2XXM A;  2L6E A;  4IPY A;  4U0D A;  2EFJ A;  4QNB A;  2JU1 A;  1YIJ P;  3CPW O;  4M0I A;  5HGM A;  1F80 D;  1IMP A;  2GZI A;  4F37 A;  1MZ8 A;  2MF4 A;  2XZ1 C;  3GZL A;  2OTL P;  1S72 P;  4R0M A;  1NJI Q;  2EIA A;  2K5X A;  1QVG O;  1YJW P;  3CCL P;  3NTE A;  2X2B A;  3G71 P;  4HKG A;  3HZQ A;  1KC8 Q;  1AUM A;  2N50 A;  2Z44 A;  1N8R Q;  2ROQ A;  3G26 A; 
#chains in the Genus database with same CATH homology
 2KGD A;  1AF8 A;  1L0I A;  2FVA A;  2M5R A;  2FHS C;  4PXH B;  2N5H A;  1DV5 A;  2K0X A;  2FQ2 A;  1KLP A;  2MY5 A;  5KP7 B;  2DNW A;  2AF8 A;  2LIW A;  1L0H A;  2GDY A;  3EJB A;  2KG8 A;  2FQ0 A;  2AFD A;  4IZ6 A;  4BPF A;  2K92 A;  5HVC A;  4BPH A;  2CQ8 A;  1X3O A;  2KG6 A;  2N98 A;  2L22 A;  4H2W C;  2LPK A;  5CZD B;  2FQ1 A;  2XZ0 D;  5EJD A;  4H2Y C;  2LKI A;  2FAE A;  4MRT C;  2FAD A;  2FAC A;  2VSQ A;  1T8K A;  2KGA A;  2KW2 A;  1DNY A;  2KWL A;  1HY8 A;  2LL8 A;  2KOO A;  2K2Q A;  2JU2 A;  2L9F A;  2FVF A;  4PWV B;  2LIU A;  2KOR A;  2MVV A;  2MR7 A;  3EJD A;  2K94 A;  4BPG A;  2KOS A;  1HQB A;  5HV8 A;  4H2X C;  2FVE A;  2CNR A;  4DG9 A;  5KP8 B;  2N6Y A;  2L4B A;  2KOP A;  2PNG A;  3GZM A;  2LML A;  2K93 A;  2EHS A;  4NEO A;  2QNW A;  2N5I A;  2JU1 A;  2GDW A;  2LTE A;  2JGP A;  2L0Q A;  2KR5 A;  1F80 D;  2KG9 A;  2CG5 B;  3EJE A;  2CGQ A;  2LOL A;  2MR8 A;  4CA3 A;  3LMO A;  2MF4 A;  2KGC A;  2EHT A;  2XZ1 C;  2JQ4 A;  3GZL A;  1NQ4 A;  2MD9 A;  4R0M A;  3NY7 B;  3CE7 A;  2KOQ A;  5KP6 B;  2ROQ A;  1OR5 A;  2AVA A;  2MVU A;  3RG2 A;  2KGE A;  2X2B A;  4HKG A;  2GDX A;  1ACP A;  2N6Z A;  1VKU A;  2N50 A;  2AFE A;  2K0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...