5HVCA

Solution structure of the apo state of the acyl carrier protein from the mlsa2 subunit of the mycolactone polyketide synthase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
95
structure length
95
Chain Sequence
GSHMRLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLDLPPTLIFDHPTPHALTQHLHTRLTQSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Type I modular polyketide synthase
publication title Sticky swinging arm dynamics: studies of an acyl carrier protein domain from the mycolactone polyketide synthase.
pubmed doi rcsb
source organism Mycobacterium ulcerans
molecule tags Transferase
total genus 27
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5hvcA00
4H2YC 5HVCA 1L0HA 5KP6B 3LMOA 2LIUA 2KORA 2CQ8A 2GDWA 2L9FA 1L0IA 2AVAA 2FHSC 2GDXA 4H2WC 2KOQA 2PNGA 2LOLA 2AFEA 2FAEA 2FQ2A 2MVUA 2FQ0A 2K94A 2MY5A 3EJBA 5EJDA 2VSQA 2M5RA 2EHTA 2N6ZA 2KG6A 2KR5A 2KG9A 4CA3A 2DNWA 2CG5B 4BPFA 4HKGA 2LTEA 2GDYA 2N50A 3EJDA 1OR5A 2CNRA 3NY7B 2K0YA 2KGEA 4R0MA 4BPHA 2MD9A 4BPGA 3RG2A 2FVAA 1F80D 2KOPA 2JU2A 1DNYA 2X2BA 3CE7A 2K0XA 2L22A 4IZ6A 4PWVB 2EHSA 2N5IA 2MVVA 2LPKA 2KWLA 4PXHB 1T8KA 1NQ4A 1X3OA 4NEOA 2JQ4A 5CZDB 2FACA 1ACPA 1HQBA 2CGQA 2QNWA 2N98A 4MRTC 2KW2A 2LMLA 2MF4A 2KG8A 2LKIA 2JGPA 2XZ1C 1AF8A 2XZ0D 2LL8A 1VKUA 3EJEA 2FADA 2N6YA 2KGCA 2AFDA 2L0QA 2MR8A 1HY8A 2FQ1A 5KP7B 2AF8A 2K2QA 2K92A 5KP8B 2KGAA 5HV8A 4H2XC 2KGDA 1DV5A 2L4BA 2MR7A 3GZLA 2K93A 2FVFA 4DG9A 2ROQA 2KOSA 3GZMA 2KOOA 2JU1A 2LIWA 1KLPA 2N5HA 2FVEA
chains in the Genus database with same CATH superfamily
5F2KA 1L0HA 1ZMBA 1Q7YQ 1VQKP 3CPWO 3CCLP 2PNGA 3CCMP 2FQ0A 2K94A 3EJBA 5EJDA 2M5RA 2EHTA 2JO0A 1M74A 3CC4P 1VQNP 2CG5B 3HYBA 5HGNA 1Q86Q 2XXMA 1JJ2O 3LRYA 3NY7B 4U0DA 2K0YA 3G28A 3RG2A 2FVAA 5DCKA 1DNYA 1QRJA 2JYGA 3GKLC 3DTJA 1UNKA 2VLOA 1K8AQ 2QA4P 1NJIQ 2KWLA 4PXHB 1T8KA 1YJWP 3U43A 4PH1A 3DS3A 1ACPA 1HQBA 3CD6P 2KW2A 1W2BO 5HGLA 1M6EX 2KG8A 2JGPA 3DS0A 1EMVA 1VKUA 1UJZA 2N6YA 2AFDA 2K5XA 1GXHA 4XFXA 2K2QA 2K92A 5HV8A 4H2XC 2KGDA 1DV5A 2L4BA 2MR7A 2QEXP 4U0EA 5BS2A 1YJNP 3I56P 1VQ6P 2LIWA 3CCQP 3G4SP 4UHPB 2XV6A 1YHQP 1Q81Q 1FR2A 2GYKA 2LIUA 1E0HA 2L9FA 1L0IA 2GDXA 1BXIA 2LOLA 3DS1A 2FAEA 1VQ8P 2PEMA 3DPHA 1QVGO 2KG6A 4CA3A 1IMPA 4HKGA 3CCEP 3H4EA 3E2DA 2Z46A 1OR5A 2M8NA 4QKOA 2KGEA 2ONTA 4BPGA 1VQOP 1F80D 3RG6C 2JU2A 2X2BA 1RNIA 2K0XA 4PWVB 2NO8A 4XFYA 4IPYA 2MVVA 4U0BA 2EIAA 2PEOA 2PEJA 1RO2A 3I55P 1VQMP 5CZDB 1VQPP 4QNBA 1MZ8A 1YIJP 2N98A 2LMLA 2VLQA 3G26A 2XZ1C 2JBGA 2FADA 2PY8A 2KGCA 1VQ5P 2OTLP 2BHVA 3Q20A 2AF8A 5KP7B 1M90Q 4PH0A 4COCA 3GZLA 4GR6A 3MGEA 1IMQA 2M8PA 3B4QA 3H0DA 3VRLC 3M1MA 2BUOA 2KOOA 3CCSP 3DS2A 1YITP 1BAJA 2ERHA 2N5HA 2FVEA 3DS4A 2EG5A 2PEKA 5HVCA 1CEIA 2K0DX 2KORA 2CQ8A 2AVAA 4H2WC 2KOQA 3G1GA 3CCJP 4XFZA 2AFEA 2M8LA 2MVUA 4COPA 4XRQA 2MY5A 2VSQA 2N6ZA 2JAZA 1RO0A 3CCUP 2DNWA 4U0FA 1VQ7P 3WBHA 2VLPA 1E6JP 2GDYA 2N50A 3EJDA 1GXGA 3CC2P 1VQ4P 4BPHA 2KOPA 1EOQA 7CEIA 5BS1A 1A43A 4U0AA 2GZGA 3CCVP 2L22A 4IZ6A 1KQSO 2PEIA 1NQ4A 2JQ4A 1GPJA 3CMAP 2FACA 1K30A 2CGQA 4MRTC 2P9XA 2L6EA 2EFJA 1YJ9P 3CXCO 1M1KQ 1AF8A 1AUMA 2WPTA 2L0QA 2MR8A 2OTJP 1HY8A 3OW2O 2GZFA 2XT1A 2OARA 3HZQA 2KGAA 2GZJA 3G71P 3DS5A 1KD1Q 1M6NA 2K93A 5HGMA 1VQ9P 2PEQA 2JYLA 2JB0A 3GZMA 1K9MQ 1QVFO 4U0CA 5I4TG 3NTEA 1KC8Q 4H2YC 2PENA 5KP6B 3LMOA 3H47A 2GDWA 2E1MA 2FHSC 2Z44A 1ZNVA 2FQ2A 2DGYA 3P05A 2KR5A 2KG9A 5EW5E 5F2NA 4XROA 4BPFA 3G21A 2LTEA 2GZIA 2CNRA 4R0MA 2MD9A 3G6EP 4GR2A 1K73Q 1AYIA 3CE7A 5F2OA 3G1IA 2Z45A 3GJNA 3CC7P 1Q82Q 3G0VA 1Z6MA 2EHSA 2N5IA 3G29A 2LPKA 1X3OA 4NEOA 1D1DA 1VHNA 4WYMA 2LF4A 2QNWA 2KODA 2MF4A 2LKIA 1S72P 5HGOA 3CCRP 2VLNA 2XZ0D 2LL8A 3EJEA 1IUQA 2CWOA 2FQ1A 1N8RQ 4M0IA 5KP8B 1YI2P 1A8OA 3CMEP 2GZEA 2FVFA 1EIAA 5JPAA 4DG9A 3B5IA 2ROQA 2KOSA 1VQLP 2JU1A 4F37A 1KLPA
chains in the Genus database with same CATH topology
4H2YC 5HVCA 1L0HA 5KP6B 3LMOA 2LIUA 2KORA 2CQ8A 2GDWA 2L9FA 1L0IA 2AVAA 2FHSC 2GDXA 4H2WC 2KOQA 2PNGA 2LOLA 2AFEA 2FAEA 2FQ2A 2MVUA 2FQ0A 2K94A 2MY5A 3EJBA 5EJDA 2VSQA 2M5RA 2EHTA 2N6ZA 2KG6A 2KR5A 2KG9A 4CA3A 2DNWA 2CG5B 4BPFA 4HKGA 2LTEA 2GDYA 2N50A 3EJDA 1OR5A 2CNRA 3NY7B 2K0YA 2KGEA 4R0MA 4BPHA 2MD9A 4BPGA 3RG2A 2FVAA 1F80D 2KOPA 2JU2A 1DNYA 2X2BA 3CE7A 2K0XA 2L22A 4IZ6A 4PWVB 2EHSA 2N5IA 2MVVA 2LPKA 2KWLA 4PXHB 1T8KA 1NQ4A 1X3OA 4NEOA 2JQ4A 5CZDB 2FACA 1ACPA 1HQBA 2CGQA 2QNWA 2N98A 4MRTC 2KW2A 2LMLA 2MF4A 2KG8A 2LKIA 2JGPA 2XZ1C 1AF8A 2XZ0D 2LL8A 1VKUA 3EJEA 2FADA 2N6YA 2KGCA 2AFDA 2L0QA 2MR8A 1HY8A 2FQ1A 5KP7B 2AF8A 2K2QA 2K92A 5KP8B 2KGAA 5HV8A 4H2XC 2KGDA 1DV5A 2L4BA 2MR7A 3GZLA 2K93A 2FVFA 4DG9A 2ROQA 2KOSA 3GZMA 2KOOA 2JU1A 2LIWA 1KLPA 2N5HA 2FVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2Y C;  5HVC A;  1L0H A;  5KP6 B;  3LMO A;  2LIU A;  2KOR A;  2CQ8 A;  2GDW A;  2L9F A;  1L0I A;  2AVA A;  2FHS C;  2GDX A;  4H2W C;  2KOQ A;  2PNG A;  2LOL A;  2AFE A;  2FAE A;  2FQ2 A;  2MVU A;  2FQ0 A;  2K94 A;  2MY5 A;  3EJB A;  5EJD A;  2VSQ A;  2M5R A;  2EHT A;  2N6Z A;  2KG6 A;  2KR5 A;  2KG9 A;  4CA3 A;  2DNW A;  2CG5 B;  4BPF A;  4HKG A;  2LTE A;  2GDY A;  2N50 A;  3EJD A;  1OR5 A;  2CNR A;  3NY7 B;  2K0Y A;  2KGE A;  4R0M A;  4BPH A;  2MD9 A;  4BPG A;  3RG2 A;  2FVA A;  1F80 D;  2KOP A;  2JU2 A;  1DNY A;  2X2B A;  3CE7 A;  2K0X A;  2L22 A;  4IZ6 A;  4PWV B;  2EHS A;  2N5I A;  2MVV A;  2LPK A;  2KWL A;  4PXH B;  1T8K A;  1NQ4 A;  1X3O A;  4NEO A;  2JQ4 A;  5CZD B;  2FAC A;  1ACP A;  1HQB A;  2CGQ A;  2QNW A;  2N98 A;  4MRT C;  2KW2 A;  2LML A;  2MF4 A;  2KG8 A;  2LKI A;  2JGP A;  2XZ1 C;  1AF8 A;  2XZ0 D;  2LL8 A;  1VKU A;  3EJE A;  2FAD A;  2N6Y A;  2KGC A;  2AFD A;  2L0Q A;  2MR8 A;  1HY8 A;  2FQ1 A;  5KP7 B;  2AF8 A;  2K2Q A;  2K92 A;  5KP8 B;  2KGA A;  5HV8 A;  4H2X C;  2KGD A;  1DV5 A;  2L4B A;  2MR7 A;  3GZL A;  2K93 A;  2FVF A;  4DG9 A;  2ROQ A;  2KOS A;  3GZM A;  2KOO A;  2JU1 A;  2LIW A;  1KLP A;  2N5H A;  2FVE A; 
#chains in the Genus database with same CATH topology
 5F2K A;  1L0H A;  1ZMB A;  1Q7Y Q;  1VQK P;  3CPW O;  3CCL P;  2PNG A;  3CCM P;  2FQ0 A;  2K94 A;  3EJB A;  5EJD A;  2M5R A;  2EHT A;  2JO0 A;  1M74 A;  3CC4 P;  1VQN P;  2CG5 B;  3HYB A;  5HGN A;  1Q86 Q;  2XXM A;  1JJ2 O;  3LRY A;  3NY7 B;  4U0D A;  2K0Y A;  3G28 A;  3RG2 A;  2FVA A;  5DCK A;  1DNY A;  1QRJ A;  2JYG A;  3GKL C;  3DTJ A;  1UNK A;  2VLO A;  1K8A Q;  2QA4 P;  1NJI Q;  2KWL A;  4PXH B;  1T8K A;  1YJW P;  3U43 A;  4PH1 A;  3DS3 A;  1ACP A;  1HQB A;  3CD6 P;  2KW2 A;  1W2B O;  5HGL A;  1M6E X;  2KG8 A;  2JGP A;  3DS0 A;  1EMV A;  1VKU A;  1UJZ A;  2N6Y A;  2AFD A;  2K5X A;  1GXH A;  4XFX A;  2K2Q A;  2K92 A;  5HV8 A;  4H2X C;  2KGD A;  1DV5 A;  2L4B A;  2MR7 A;  2QEX P;  4U0E A;  5BS2 A;  1YJN P;  3I56 P;  1VQ6 P;  2LIW A;  3CCQ P;  3G4S P;  4UHP B;  2XV6 A;  1YHQ P;  1Q81 Q;  1FR2 A;  2GYK A;  2LIU A;  1E0H A;  2L9F A;  1L0I A;  2GDX A;  1BXI A;  2LOL A;  3DS1 A;  2FAE A;  1VQ8 P;  2PEM A;  3DPH A;  1QVG O;  2KG6 A;  4CA3 A;  1IMP A;  4HKG A;  3CCE P;  3H4E A;  3E2D A;  2Z46 A;  1OR5 A;  2M8N A;  4QKO A;  2KGE A;  2ONT A;  4BPG A;  1VQO P;  1F80 D;  3RG6 C;  2JU2 A;  2X2B A;  1RNI A;  2K0X A;  4PWV B;  2NO8 A;  4XFY A;  4IPY A;  2MVV A;  4U0B A;  2EIA A;  2PEO A;  2PEJ A;  1RO2 A;  3I55 P;  1VQM P;  5CZD B;  1VQP P;  4QNB A;  1MZ8 A;  1YIJ P;  2N98 A;  2LML A;  2VLQ A;  3G26 A;  2XZ1 C;  2JBG A;  2FAD A;  2PY8 A;  2KGC A;  1VQ5 P;  2OTL P;  2BHV A;  3Q20 A;  2AF8 A;  5KP7 B;  1M90 Q;  4PH0 A;  4COC A;  3GZL A;  4GR6 A;  3MGE A;  1IMQ A;  2M8P A;  3B4Q A;  3H0D A;  3VRL C;  3M1M A;  2BUO A;  2KOO A;  3CCS P;  3DS2 A;  1YIT P;  1BAJ A;  2ERH A;  2N5H A;  2FVE A;  3DS4 A;  2EG5 A;  2PEK A;  5HVC A;  1CEI A;  2K0D X;  2KOR A;  2CQ8 A;  2AVA A;  4H2W C;  2KOQ A;  3G1G A;  3CCJ P;  4XFZ A;  2AFE A;  2M8L A;  2MVU A;  4COP A;  4XRQ A;  2MY5 A;  2VSQ A;  2N6Z A;  2JAZ A;  1RO0 A;  3CCU P;  2DNW A;  4U0F A;  1VQ7 P;  3WBH A;  2VLP A;  1E6J P;  2GDY A;  2N50 A;  3EJD A;  1GXG A;  3CC2 P;  1VQ4 P;  4BPH A;  2KOP A;  1EOQ A;  7CEI A;  5BS1 A;  1A43 A;  4U0A A;  2GZG A;  3CCV P;  2L22 A;  4IZ6 A;  1KQS O;  2PEI A;  1NQ4 A;  2JQ4 A;  1GPJ A;  3CMA P;  2FAC A;  1K30 A;  2CGQ A;  4MRT C;  2P9X A;  2L6E A;  2EFJ A;  1YJ9 P;  3CXC O;  1M1K Q;  1AF8 A;  1AUM A;  2WPT A;  2L0Q A;  2MR8 A;  2OTJ P;  1HY8 A;  3OW2 O;  2GZF A;  2XT1 A;  2OAR A;  3HZQ A;  2KGA A;  2GZJ A;  3G71 P;  3DS5 A;  1KD1 Q;  1M6N A;  2K93 A;  5HGM A;  1VQ9 P;  2PEQ A;  2JYL A;  2JB0 A;  3GZM A;  1K9M Q;  1QVF O;  4U0C A;  5I4T G;  3NTE A;  1KC8 Q;  4H2Y C;  2PEN A;  5KP6 B;  3LMO A;  3H47 A;  2GDW A;  2E1M A;  2FHS C;  2Z44 A;  1ZNV A;  2FQ2 A;  2DGY A;  3P05 A;  2KR5 A;  2KG9 A;  5EW5 E;  5F2N A;  4XRO A;  4BPF A;  3G21 A;  2LTE A;  2GZI A;  2CNR A;  4R0M A;  2MD9 A;  3G6E P;  4GR2 A;  1K73 Q;  1AYI A;  3CE7 A;  5F2O A;  3G1I A;  2Z45 A;  3GJN A;  3CC7 P;  1Q82 Q;  3G0V A;  1Z6M A;  2EHS A;  2N5I A;  3G29 A;  2LPK A;  1X3O A;  4NEO A;  1D1D A;  1VHN A;  4WYM A;  2LF4 A;  2QNW A;  2KOD A;  2MF4 A;  2LKI A;  1S72 P;  5HGO A;  3CCR P;  2VLN A;  2XZ0 D;  2LL8 A;  3EJE A;  1IUQ A;  2CWO A;  2FQ1 A;  1N8R Q;  4M0I A;  5KP8 B;  1YI2 P;  1A8O A;  3CME P;  2GZE A;  2FVF A;  1EIA A;  5JPA A;  4DG9 A;  3B5I A;  2ROQ A;  2KOS A;  1VQL P;  2JU1 A;  4F37 A;  1KLP A; 
#chains in the Genus database with same CATH homology
 4H2Y C;  5HVC A;  1L0H A;  5KP6 B;  3LMO A;  2LIU A;  2KOR A;  2CQ8 A;  2GDW A;  2L9F A;  1L0I A;  2AVA A;  2FHS C;  2GDX A;  4H2W C;  2KOQ A;  2PNG A;  2LOL A;  2AFE A;  2FAE A;  2FQ2 A;  2MVU A;  2FQ0 A;  2K94 A;  2MY5 A;  3EJB A;  5EJD A;  2VSQ A;  2M5R A;  2EHT A;  2N6Z A;  2KG6 A;  2KR5 A;  2KG9 A;  4CA3 A;  2DNW A;  2CG5 B;  4BPF A;  4HKG A;  2LTE A;  2GDY A;  2N50 A;  3EJD A;  1OR5 A;  2CNR A;  3NY7 B;  2K0Y A;  2KGE A;  4R0M A;  4BPH A;  2MD9 A;  4BPG A;  3RG2 A;  2FVA A;  1F80 D;  2KOP A;  2JU2 A;  1DNY A;  2X2B A;  3CE7 A;  2K0X A;  2L22 A;  4IZ6 A;  4PWV B;  2EHS A;  2N5I A;  2MVV A;  2LPK A;  2KWL A;  4PXH B;  1T8K A;  1NQ4 A;  1X3O A;  4NEO A;  2JQ4 A;  5CZD B;  2FAC A;  1ACP A;  1HQB A;  2CGQ A;  2QNW A;  2N98 A;  4MRT C;  2KW2 A;  2LML A;  2MF4 A;  2KG8 A;  2LKI A;  2JGP A;  2XZ1 C;  1AF8 A;  2XZ0 D;  2LL8 A;  1VKU A;  3EJE A;  2FAD A;  2N6Y A;  2KGC A;  2AFD A;  2L0Q A;  2MR8 A;  1HY8 A;  2FQ1 A;  5KP7 B;  2AF8 A;  2K2Q A;  2K92 A;  5KP8 B;  2KGA A;  5HV8 A;  4H2X C;  2KGD A;  1DV5 A;  2L4B A;  2MR7 A;  3GZL A;  2K93 A;  2FVF A;  4DG9 A;  2ROQ A;  2KOS A;  3GZM A;  2KOO A;  2JU1 A;  2LIW A;  1KLP A;  2N5H A;  2FVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...