5HVCA

Solution structure of the apo state of the acyl carrier protein from the mlsa2 subunit of the mycolactone polyketide synthase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
95
structure length
95
Chain Sequence
GSHMRLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLDLPPTLIFDHPTPHALTQHLHTRLTQSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Type I modular polyketide synthase
publication title Sticky swinging arm dynamics: studies of an acyl carrier protein domain from the mycolactone polyketide synthase.
pubmed doi rcsb
source organism Mycobacterium ulcerans
total genus 27
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5hvcA00
1NQ4A 1F80D 1DNYA 4PWVB 3LMOA 2LMLA 2ROQA 2MY5A 3GZMA 2JU2A 4H2YC 2FQ1A 4IZ6A 1OR5A 2KGAA 2LL8A 2KOOA 2MF4A 1L0IA 2LPKA 1HY8A 2KG8A 2DNWA 4BPFA 2MVVA 2K0YA 2VSQA 4DG9A 4HKGA 2XZ0D 3EJBA 4CA3A 2N6ZA 2FVAA 2KOSA 2N50A 2AF8A 5HVCA 4R0MA 2M5RA 4NEOA 4BPGA 1KLPA 2JU1A 2MR7A 2N6YA 2JGPA 2LTEA 2AFDA 5EJDA 2LKIA 2CG5B 2KORA 2X2BA 2L0QA 5CZDB 2AFEA 2FQ2A 2K0XA 4PXHB 2N5HA 2EHSA 2GDXA 2KGCA 2KWLA 4BPHA 2FACA 2KOQA 4H2WC 3RG2A 2GDYA 2L22A 2K94A 2K92A 2QNWA 2FVFA 5KP6B 2KR5A 2MVUA 2CQ8A 2FVEA 2FADA 2LIUA 4H2XC 2JQ4A 2LOLA 2K2QA 2K93A 2AVAA 2KG6A 1VKUA 1T8KA 2MD9A 5KP7B 2L4BA 1DV5A 2EHTA 3CE7A 2KOPA 3NY7B 2LIWA 2KGEA 2L9FA 4MRTC 2CGQA 2N5IA 1X3OA 2PNGA 2GDWA 1HQBA 2N98A 2KG9A 5HV8A 2MR8A 2FHSC 3EJDA 2KW2A 3GZLA 1AF8A 5KP8B 2FQ0A 2CNRA 2XZ1C 2FAEA 1L0HA 1ACPA 2KGDA 3EJEA
chains in the Genus database with same CATH superfamily
3H0DA 1F80D 1YI2P 2EIAA 2LMLA 5DCKA 1E6JP 2EG5A 2MY5A 4QNBA 2GZGA 4IZ6A 1OR5A 5HGOA 2KGAA 1VQ8P 3VRLC 2M8PA 3G26A 2OTLP 1HY8A 1EOQA 1ZNVA 1QRJA 2GZEA 2MVVA 2XZ0D 2N6ZA 2FVAA 3CCJP 1YHQP 4F37A 2LF4A 2M5RA 3OW2O 3CPWO 2MR7A 3G71P 2E1MA 2N6YA 2JGPA 2AFDA 5EJDA 1YJNP 1K30A 5CZDB 3P05A 2QA4P 3B4QA 1IUQA 2JO0A 1W2BO 3DS4A 3RG2A 2L6EA 2MVUA 4GR6A 2LIUA 2ONTA 4XRQA 1VQ6P 2JQ4A 3G1IA 1VKUA 1T8KA 3LRYA 1VQKP 3B5IA 5KP7B 2EHTA 7CEIA 4MRTC 2CGQA 2N5IA 5EW5E 3CC2P 2GZFA 4U0AA 5HV8A 1ZMBA 2KG9A 1AF8A 5KP8B 3CMAP 2JAZA 2FQ0A 2EFJA 3GJNA 2JYLA 1ACPA 3G29A 1NQ4A 1DNYA 3HYBA 2K0DX 2P9XA 5HGMA 4QKOA 2GYKA 1VQMP 1KQSO 1M74A 1VQPP 2DNWA 4BPFA 1E0HA 4DG9A 2K0YA 4CA3A 5I4TG 2JB0A 4PH1A 2KOSA 2N50A 3RG6C 4U0CA 1Q82Q 5HGNA 3G0VA 1VQLP 1KLPA 4XFYA 2LTEA 1M90Q 2WPTA 2PY8A 1AYIA 2CG5B 2KORA 1KC8Q 2K0XA 1VQ9P 4COCA 4U0DA 2KGCA 2KWLA 2K5XA 2L22A 2K94A 2K92A 2KR5A 4M0IA 3CC4P 1RO0A 2FADA 5BS1A 2M8LA 2Z45A 3H47A 2K2QA 2AVAA 4IPYA 2L4BA 1GXGA 1BXIA 2PENA 1QVGO 2LIWA 3Q20A 3G21A 1QVFO 2PEJA 2DGYA 1HQBA 1GXHA 3U43A 3EJDA 3GZLA 3DS1A 1YITP 1K73Q 1KD1Q 1Q81Q 2FAEA 4XFXA 2KGDA 4WYMA 5F2OA 3LMOA 2PEKA 1D1DA 1S72P 3G28A 3I56P 3CMEP 1L0IA 2KG8A 1FR2A 2PEMA 1UJZA 3H4EA 4HKGA 3CCEP 4GR2A 3DS2A 3DS5A 1GPJA 1YJ9P 2VLOA 4NEOA 3DS0A 1UNKA 2JU1A 4U0FA 3MGEA 2LKIA 2X2BA 2AFEA 3GKLC 4PXHB 5HGLA 1Q86Q 2EHSA 2GDXA 3HZQA 4BPHA 2FACA 1IMQA 3M1MA 2KOQA 5JPAA 2QNWA 3CCUP 5KP6B 1N8RQ 2OTJP 2NO8A 4H2XC 1JJ2O 2VLPA 2LOLA 2K93A 2KG6A 1M6EX 1EMVA 3CE7A 5BS2A 4U0EA 3CCMP 3NY7B 2KGEA 2L9FA 2GDWA 3CCVP 2N98A 1RO2A 3G6EP 2MR8A 2FHSC 5F2NA 3CCLP 3CC7P 3DS3A 1IMPA 2XZ1C 1VQ7P 3CD6P 3G4SP 1L0HA 4PWVB 1NJIQ 2ROQA 2XT1A 3GZMA 2JU2A 4H2YC 2FQ1A 2GZIA 1K8AQ 2LL8A 2XXMA 1M1KQ 1M6NA 2KOOA 1VQ4P 2MF4A 2LPKA 1YJWP 3I55P 2VSQA 3EJBA 1A43A 1Q7YQ 4UHPB 1A8OA 2AF8A 3E2DA 4R0MA 2KODA 5HVCA 4U0BA 3DPHA 4BPGA 2VLNA 4XFZA 2VLQA 1EIAA 2BHVA 4PH0A 1MZ8A 2BUOA 2L0QA 2FQ2A 2N5HA 1VHNA 1RNIA 1YIJP 2QEXP 3NTEA 4H2WC 3CCQP 2PEOA 3CCSP 2GDYA 1CEIA 2FVFA 2XV6A 3CCRP 2CQ8A 2FVEA 2PEQA 1VQ5P 1VQOP 2CWOA 1AUMA 4XROA 2JYGA 2MD9A 1DV5A 3DTJA 2KOPA 4COPA 2JBGA 2ERHA 3CXCO 1X3OA 2PNGA 2GZJA 2Z44A 5F2KA 2KW2A 2PEIA 1Z6MA 2OARA 1VQNP 2CNRA 1BAJA 2Z46A 2M8NA 1K9MQ 3WBHA 3G1GA 3EJEA
chains in the Genus database with same CATH topology
1NQ4A 1F80D 1DNYA 4PWVB 3LMOA 2LMLA 2ROQA 2MY5A 3GZMA 2JU2A 4H2YC 2FQ1A 4IZ6A 1OR5A 2KGAA 2LL8A 2KOOA 2MF4A 1L0IA 2LPKA 1HY8A 2KG8A 2DNWA 4BPFA 2MVVA 2K0YA 2VSQA 4DG9A 4HKGA 2XZ0D 3EJBA 4CA3A 2N6ZA 2FVAA 2KOSA 2N50A 2AF8A 5HVCA 4R0MA 2M5RA 4NEOA 4BPGA 1KLPA 2JU1A 2MR7A 2N6YA 2JGPA 2LTEA 2AFDA 5EJDA 2LKIA 2CG5B 2KORA 2X2BA 2L0QA 5CZDB 2AFEA 2FQ2A 2K0XA 4PXHB 2N5HA 2EHSA 2GDXA 2KGCA 2KWLA 4BPHA 2FACA 2KOQA 4H2WC 3RG2A 2GDYA 2L22A 2K94A 2K92A 2QNWA 2FVFA 5KP6B 2KR5A 2MVUA 2CQ8A 2FVEA 2FADA 2LIUA 4H2XC 2JQ4A 2LOLA 2K2QA 2K93A 2AVAA 2KG6A 1VKUA 1T8KA 2MD9A 5KP7B 2L4BA 1DV5A 2EHTA 3CE7A 2KOPA 3NY7B 2LIWA 2KGEA 2L9FA 4MRTC 2CGQA 2N5IA 1X3OA 2PNGA 2GDWA 1HQBA 2N98A 2KG9A 5HV8A 2MR8A 2FHSC 3EJDA 2KW2A 3GZLA 1AF8A 5KP8B 2FQ0A 2CNRA 2XZ1C 2FAEA 1L0HA 1ACPA 2KGDA 3EJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NQ4 A;  1F80 D;  1DNY A;  4PWV B;  3LMO A;  2LML A;  2ROQ A;  2MY5 A;  3GZM A;  2JU2 A;  4H2Y C;  2FQ1 A;  4IZ6 A;  1OR5 A;  2KGA A;  2LL8 A;  2KOO A;  2MF4 A;  1L0I A;  2LPK A;  1HY8 A;  2KG8 A;  2DNW A;  4BPF A;  2MVV A;  2K0Y A;  2VSQ A;  4DG9 A;  4HKG A;  2XZ0 D;  3EJB A;  4CA3 A;  2N6Z A;  2FVA A;  2KOS A;  2N50 A;  2AF8 A;  5HVC A;  4R0M A;  2M5R A;  4NEO A;  4BPG A;  1KLP A;  2JU1 A;  2MR7 A;  2N6Y A;  2JGP A;  2LTE A;  2AFD A;  5EJD A;  2LKI A;  2CG5 B;  2KOR A;  2X2B A;  2L0Q A;  5CZD B;  2AFE A;  2FQ2 A;  2K0X A;  4PXH B;  2N5H A;  2EHS A;  2GDX A;  2KGC A;  2KWL A;  4BPH A;  2FAC A;  2KOQ A;  4H2W C;  3RG2 A;  2GDY A;  2L22 A;  2K94 A;  2K92 A;  2QNW A;  2FVF A;  5KP6 B;  2KR5 A;  2MVU A;  2CQ8 A;  2FVE A;  2FAD A;  2LIU A;  4H2X C;  2JQ4 A;  2LOL A;  2K2Q A;  2K93 A;  2AVA A;  2KG6 A;  1VKU A;  1T8K A;  2MD9 A;  5KP7 B;  2L4B A;  1DV5 A;  2EHT A;  3CE7 A;  2KOP A;  3NY7 B;  2LIW A;  2KGE A;  2L9F A;  4MRT C;  2CGQ A;  2N5I A;  1X3O A;  2PNG A;  2GDW A;  1HQB A;  2N98 A;  2KG9 A;  5HV8 A;  2MR8 A;  2FHS C;  3EJD A;  2KW2 A;  3GZL A;  1AF8 A;  5KP8 B;  2FQ0 A;  2CNR A;  2XZ1 C;  2FAE A;  1L0H A;  1ACP A;  2KGD A;  3EJE A; 
#chains in the Genus database with same CATH topology
 3H0D A;  1F80 D;  1YI2 P;  2EIA A;  2LML A;  5DCK A;  1E6J P;  2EG5 A;  2MY5 A;  4QNB A;  2GZG A;  4IZ6 A;  1OR5 A;  5HGO A;  2KGA A;  1VQ8 P;  3VRL C;  2M8P A;  3G26 A;  2OTL P;  1HY8 A;  1EOQ A;  1ZNV A;  1QRJ A;  2GZE A;  2MVV A;  2XZ0 D;  2N6Z A;  2FVA A;  3CCJ P;  1YHQ P;  4F37 A;  2LF4 A;  2M5R A;  3OW2 O;  3CPW O;  2MR7 A;  3G71 P;  2E1M A;  2N6Y A;  2JGP A;  2AFD A;  5EJD A;  1YJN P;  1K30 A;  5CZD B;  3P05 A;  2QA4 P;  3B4Q A;  1IUQ A;  2JO0 A;  1W2B O;  3DS4 A;  3RG2 A;  2L6E A;  2MVU A;  4GR6 A;  2LIU A;  2ONT A;  4XRQ A;  1VQ6 P;  2JQ4 A;  3G1I A;  1VKU A;  1T8K A;  3LRY A;  1VQK P;  3B5I A;  5KP7 B;  2EHT A;  7CEI A;  4MRT C;  2CGQ A;  2N5I A;  5EW5 E;  3CC2 P;  2GZF A;  4U0A A;  5HV8 A;  1ZMB A;  2KG9 A;  1AF8 A;  5KP8 B;  3CMA P;  2JAZ A;  2FQ0 A;  2EFJ A;  3GJN A;  2JYL A;  1ACP A;  3G29 A;  1NQ4 A;  1DNY A;  3HYB A;  2K0D X;  2P9X A;  5HGM A;  4QKO A;  2GYK A;  1VQM P;  1KQS O;  1M74 A;  1VQP P;  2DNW A;  4BPF A;  1E0H A;  4DG9 A;  2K0Y A;  4CA3 A;  5I4T G;  2JB0 A;  4PH1 A;  2KOS A;  2N50 A;  3RG6 C;  4U0C A;  1Q82 Q;  5HGN A;  3G0V A;  1VQL P;  1KLP A;  4XFY A;  2LTE A;  1M90 Q;  2WPT A;  2PY8 A;  1AYI A;  2CG5 B;  2KOR A;  1KC8 Q;  2K0X A;  1VQ9 P;  4COC A;  4U0D A;  2KGC A;  2KWL A;  2K5X A;  2L22 A;  2K94 A;  2K92 A;  2KR5 A;  4M0I A;  3CC4 P;  1RO0 A;  2FAD A;  5BS1 A;  2M8L A;  2Z45 A;  3H47 A;  2K2Q A;  2AVA A;  4IPY A;  2L4B A;  1GXG A;  1BXI A;  2PEN A;  1QVG O;  2LIW A;  3Q20 A;  3G21 A;  1QVF O;  2PEJ A;  2DGY A;  1HQB A;  1GXH A;  3U43 A;  3EJD A;  3GZL A;  3DS1 A;  1YIT P;  1K73 Q;  1KD1 Q;  1Q81 Q;  2FAE A;  4XFX A;  2KGD A;  4WYM A;  5F2O A;  3LMO A;  2PEK A;  1D1D A;  1S72 P;  3G28 A;  3I56 P;  3CME P;  1L0I A;  2KG8 A;  1FR2 A;  2PEM A;  1UJZ A;  3H4E A;  4HKG A;  3CCE P;  4GR2 A;  3DS2 A;  3DS5 A;  1GPJ A;  1YJ9 P;  2VLO A;  4NEO A;  3DS0 A;  1UNK A;  2JU1 A;  4U0F A;  3MGE A;  2LKI A;  2X2B A;  2AFE A;  3GKL C;  4PXH B;  5HGL A;  1Q86 Q;  2EHS A;  2GDX A;  3HZQ A;  4BPH A;  2FAC A;  1IMQ A;  3M1M A;  2KOQ A;  5JPA A;  2QNW A;  3CCU P;  5KP6 B;  1N8R Q;  2OTJ P;  2NO8 A;  4H2X C;  1JJ2 O;  2VLP A;  2LOL A;  2K93 A;  2KG6 A;  1M6E X;  1EMV A;  3CE7 A;  5BS2 A;  4U0E A;  3CCM P;  3NY7 B;  2KGE A;  2L9F A;  2GDW A;  3CCV P;  2N98 A;  1RO2 A;  3G6E P;  2MR8 A;  2FHS C;  5F2N A;  3CCL P;  3CC7 P;  3DS3 A;  1IMP A;  2XZ1 C;  1VQ7 P;  3CD6 P;  3G4S P;  1L0H A;  4PWV B;  1NJI Q;  2ROQ A;  2XT1 A;  3GZM A;  2JU2 A;  4H2Y C;  2FQ1 A;  2GZI A;  1K8A Q;  2LL8 A;  2XXM A;  1M1K Q;  1M6N A;  2KOO A;  1VQ4 P;  2MF4 A;  2LPK A;  1YJW P;  3I55 P;  2VSQ A;  3EJB A;  1A43 A;  1Q7Y Q;  4UHP B;  1A8O A;  2AF8 A;  3E2D A;  4R0M A;  2KOD A;  5HVC A;  4U0B A;  3DPH A;  4BPG A;  2VLN A;  4XFZ A;  2VLQ A;  1EIA A;  2BHV A;  4PH0 A;  1MZ8 A;  2BUO A;  2L0Q A;  2FQ2 A;  2N5H A;  1VHN A;  1RNI A;  1YIJ P;  2QEX P;  3NTE A;  4H2W C;  3CCQ P;  2PEO A;  3CCS P;  2GDY A;  1CEI A;  2FVF A;  2XV6 A;  3CCR P;  2CQ8 A;  2FVE A;  2PEQ A;  1VQ5 P;  1VQO P;  2CWO A;  1AUM A;  4XRO A;  2JYG A;  2MD9 A;  1DV5 A;  3DTJ A;  2KOP A;  4COP A;  2JBG A;  2ERH A;  3CXC O;  1X3O A;  2PNG A;  2GZJ A;  2Z44 A;  5F2K A;  2KW2 A;  2PEI A;  1Z6M A;  2OAR A;  1VQN P;  2CNR A;  1BAJ A;  2Z46 A;  2M8N A;  1K9M Q;  3WBH A;  3G1G A;  3EJE A; 
#chains in the Genus database with same CATH homology
 1NQ4 A;  1F80 D;  1DNY A;  4PWV B;  3LMO A;  2LML A;  2ROQ A;  2MY5 A;  3GZM A;  2JU2 A;  4H2Y C;  2FQ1 A;  4IZ6 A;  1OR5 A;  2KGA A;  2LL8 A;  2KOO A;  2MF4 A;  1L0I A;  2LPK A;  1HY8 A;  2KG8 A;  2DNW A;  4BPF A;  2MVV A;  2K0Y A;  2VSQ A;  4DG9 A;  4HKG A;  2XZ0 D;  3EJB A;  4CA3 A;  2N6Z A;  2FVA A;  2KOS A;  2N50 A;  2AF8 A;  5HVC A;  4R0M A;  2M5R A;  4NEO A;  4BPG A;  1KLP A;  2JU1 A;  2MR7 A;  2N6Y A;  2JGP A;  2LTE A;  2AFD A;  5EJD A;  2LKI A;  2CG5 B;  2KOR A;  2X2B A;  2L0Q A;  5CZD B;  2AFE A;  2FQ2 A;  2K0X A;  4PXH B;  2N5H A;  2EHS A;  2GDX A;  2KGC A;  2KWL A;  4BPH A;  2FAC A;  2KOQ A;  4H2W C;  3RG2 A;  2GDY A;  2L22 A;  2K94 A;  2K92 A;  2QNW A;  2FVF A;  5KP6 B;  2KR5 A;  2MVU A;  2CQ8 A;  2FVE A;  2FAD A;  2LIU A;  4H2X C;  2JQ4 A;  2LOL A;  2K2Q A;  2K93 A;  2AVA A;  2KG6 A;  1VKU A;  1T8K A;  2MD9 A;  5KP7 B;  2L4B A;  1DV5 A;  2EHT A;  3CE7 A;  2KOP A;  3NY7 B;  2LIW A;  2KGE A;  2L9F A;  4MRT C;  2CGQ A;  2N5I A;  1X3O A;  2PNG A;  2GDW A;  1HQB A;  2N98 A;  2KG9 A;  5HV8 A;  2MR8 A;  2FHS C;  3EJD A;  2KW2 A;  3GZL A;  1AF8 A;  5KP8 B;  2FQ0 A;  2CNR A;  2XZ1 C;  2FAE A;  1L0H A;  1ACP A;  2KGD A;  3EJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...