5HVCA

Solution structure of the apo state of the acyl carrier protein from the mlsa2 subunit of the mycolactone polyketide synthase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
95
structure length
95
Chain Sequence
b'GSHMRLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLDLPPTLIFDHPTPHALTQHLHTRLTQSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Type I modular polyketide synthase
publication title Sticky swinging arm dynamics: studies of an acyl carrier protein domain from the mycolactone polyketide synthase.
pubmed doi rcsb
source organism Mycobacterium ulcerans
molecule tags Transferase
total genus 27
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5hvcA00
2FADA 2N5HA 1VKUA 2PNGA 2XZ1C 2L9FA 2JU2A 2MY5A 2GDYA 2CGQA 1L0IA 2JGPA 2JQ4A 4BPFA 4PWVB 2L0QA 2MVVA 2LPKA 3GZLA 2GDXA 4DG9A 2KORA 2FVEA 2CNRA 2EHSA 4NEOA 2KOOA 4H2YC 2MD9A 1KLPA 2GDWA 2AFEA 2JU1A 2L22A 2N6ZA 2KWLA 2KW2A 2CG5B 3CE7A 5CZDB 2LKIA 2L4BA 2AF8A 2DNWA 5EJDA 5HVCA 2LIUA 2FQ2A 2QNWA 1OR5A 4HKGA 5HV8A 2ROQA 2MF4A 1DNYA 2KOPA 1ACPA 2EHTA 2LIWA 2X2BA 3RG2A 2M5RA 2MR7A 3EJBA 2MR8A 1X3OA 2KGDA 4CA3A 2N6YA 2FVAA 2KG9A 5KP7B 4R0MA 3EJDA 3EJEA 2CQ8A 4MRTC 2XZ0D 2K2QA 1NQ4A 1HQBA 2N50A 2LMLA 2KGEA 2N98A 1AF8A 2KG8A 2KOQA 2AVAA 4H2XC 4IZ6A 2AFDA 1F80D 2KGCA 2K92A 1DV5A 2N5IA 2LTEA 3GZMA 3LMOA 5KP8B 2VSQA 4BPGA 2K93A 1L0HA 2K0YA 4H2WC 2FHSC 4BPHA 3NY7B 2LL8A 5KP6B 2FACA 2FQ1A 2FQ0A 4PXHB 2K94A 2KOSA 2K0XA 2KGAA 2MVUA 2LOLA 2FVFA 2KR5A 1HY8A 2FAEA 1T8KA 2KG6A
chains in the Genus database with same CATH superfamily
1EMVA 1VQ6P 2DGYA 1L0IA 2PEIA 2JGPA 2GZJA 4F37A 2L0QA 2LPKA 2GDXA 4QNBA 1VQ5P 1Z6MA 2MD9A 1IMQA 2AFEA 2JU1A 1EOQA 2GZEA 1M6EX 3CC2P 5BS1A 2VLOA 1YIJP 1VQ8P 1ACPA 2CWOA 1E0HA 2M8LA 5HGNA 3RG6C 1FR2A 2M5RA 2WPTA 3EJBA 2KGDA 1K9MQ 2PEKA 3CCEP 2XV6A 4COPA 2K0DX 5HGLA 4R0MA 3EJEA 4M0IA 5JPAA 3I56P 5I4TG 3CCSP 3WBHA 3G29A 1GXGA 2KGEA 3B4QA 1VQKP 2KG8A 2GZGA 1UNKA 1KD1Q 2AFDA 3G26A 3H47A 2OTLP 2N5IA 1ZMBA 2PEJA 3CC7P 5KP8B 2VSQA 1IMPA 3DS3A 3NY7B 2GZFA 2E1MA 2FQ1A 2FQ0A 1QRJA 2K94A 2KOSA 3G28A 3CCQP 2QA4P 1W2BO 4IPYA 2KG6A 2FADA 2N5HA 1VKUA 1VQ7P 1VQLP 2JU2A 2MY5A 5DCKA 4U0BA 2EG5A 1Q82Q 1D1DA 2EHSA 4NEOA 1RO0A 2KOOA 4H2YC 1VHNA 3Q20A 4QKOA 2GDWA 2L22A 5HGOA 2KW2A 2P9XA 3CE7A 1KC8Q 2L4BA 2DNWA 5HVCA 2FQ2A 3G0VA 5HV8A 3HYBA 4HKGA 2M8NA 2ROQA 2MF4A 1YJWP 2NO8A 3RG2A 2K5XA 2MR7A 3LRYA 1X3OA 4CA3A 2JYGA 2N6YA 2FVAA 2BUOA 1KQSO 3EJDA 1MZ8A 3CCMP 4MRTC 3DS0A 3G1GA 2ERHA 1UJZA 2LMLA 4XRQA 2KOQA 2AVAA 1VQOP 1BXIA 1Q81Q 1JJ2O 1AUMA 2LTEA 1L0HA 2K0YA 3G1IA 3H4EA 2Z44A 3E2DA 3H0DA 2JBGA 5HGMA 3CMEP 2FACA 3GJNA 1Q86Q 1VQMP 3P05A 4PXHB 2GYKA 2MVUA 1NJIQ 5F2NA 2OARA 3G21A 2PNGA 2XZ1C 2PEMA 1GXHA 2L9FA 2GDYA 2CGQA 2JQ4A 4PH0A 3DTJA 3DS4A 4DG9A 2KORA 2FVEA 3CCLP 2JO0A 1KLPA 2N6ZA 1VQ4P 2JAZA 2CG5B 2LKIA 1CEIA 2Z45A 1RNIA 2PEOA 3I55P 5EJDA 3G71P 2LIUA 2QNWA 1OR5A 1E6JP 2KOPA 5EW5E 4U0AA 1IUQA 2EHTA 2LIWA 2X2BA 1M1KQ 1QVFO 1BAJA 1VQNP 2EFJA 2KG9A 4GR2A 1EIAA 3U43A 5KP7B 2Z46A 2CQ8A 2PY8A 2K2QA 3CCJP 4XFYA 7CEIA 3MGEA 4U0DA 1HQBA 2N50A 1YI2P 2XT1A 2QEXP 3B5IA 4H2XC 4IZ6A 2KGCA 2VLQA 1DV5A 3GZMA 3CCUP 4H2WC 2BHVA 2L6EA 4BPHA 3M1MA 2LL8A 5BS2A 5KP6B 3G6EP 1RO2A 1A8OA 3DPHA 3CPWO 3NTEA 2VLPA 4GR6A 2K0XA 4XFZA 2KGAA 3CD6P 2PEQA 3DS5A 2KR5A 4XFXA 1HY8A 2FAEA 3CCRP 4UHPB 4BPFA 3CXCO 1S72P 4PWVB 2MVVA 3GZLA 1ZNVA 2GZIA 2CNRA 1YHQP 1VQPP 2KWLA 2VLNA 1Q7YQ 5CZDB 1QVGO 2AF8A 2JYLA 1DNYA 4XROA 1GPJA 5F2OA 1YJNP 3HZQA 3VRLC 5F2KA 2MR8A 3OW2O 3DS1A 2JB0A 3CMAP 4PH1A 1YJ9P 2XZ0D 2PENA 1NQ4A 1VQ9P 1M90Q 3GKLC 2EIAA 2N98A 1AF8A 2KODA 1YITP 3DS2A 3CCVP 1M6NA 3G4SP 1K8AQ 1F80D 1AYIA 2XXMA 2K92A 1N8RQ 1K73Q 3LMOA 2OTJP 4BPGA 2K93A 4U0EA 2FHSC 2M8PA 4WYMA 3CC4P 1K30A 4U0FA 2ONTA 4COCA 1M74A 2LOLA 2FVFA 4U0CA 1A43A 2LF4A 1T8KA
chains in the Genus database with same CATH topology
2FADA 2N5HA 1VKUA 2PNGA 2XZ1C 2L9FA 2JU2A 2MY5A 2GDYA 2CGQA 1L0IA 2JGPA 2JQ4A 4BPFA 4PWVB 2L0QA 2MVVA 2LPKA 3GZLA 2GDXA 4DG9A 2KORA 2FVEA 2CNRA 2EHSA 4NEOA 2KOOA 4H2YC 2MD9A 1KLPA 2GDWA 2AFEA 2JU1A 2L22A 2N6ZA 2KWLA 2KW2A 2CG5B 3CE7A 5CZDB 2LKIA 2L4BA 2AF8A 2DNWA 5EJDA 5HVCA 2LIUA 2FQ2A 2QNWA 1OR5A 4HKGA 5HV8A 2ROQA 2MF4A 1DNYA 2KOPA 1ACPA 2EHTA 2LIWA 2X2BA 3RG2A 2M5RA 2MR7A 3EJBA 2MR8A 1X3OA 2KGDA 4CA3A 2N6YA 2FVAA 2KG9A 5KP7B 4R0MA 3EJDA 3EJEA 2CQ8A 4MRTC 2XZ0D 2K2QA 1NQ4A 1HQBA 2N50A 2LMLA 2KGEA 2N98A 1AF8A 2KG8A 2KOQA 2AVAA 4H2XC 4IZ6A 2AFDA 1F80D 2KGCA 2K92A 1DV5A 2N5IA 2LTEA 3GZMA 3LMOA 5KP8B 2VSQA 4BPGA 2K93A 1L0HA 2K0YA 4H2WC 2FHSC 4BPHA 3NY7B 2LL8A 5KP6B 2FACA 2FQ1A 2FQ0A 4PXHB 2K94A 2KOSA 2K0XA 2KGAA 2MVUA 2LOLA 2FVFA 2KR5A 1HY8A 2FAEA 1T8KA 2KG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAD A;  2N5H A;  1VKU A;  2PNG A;  2XZ1 C;  2L9F A;  2JU2 A;  2MY5 A;  2GDY A;  2CGQ A;  1L0I A;  2JGP A;  2JQ4 A;  4BPF A;  4PWV B;  2L0Q A;  2MVV A;  2LPK A;  3GZL A;  2GDX A;  4DG9 A;  2KOR A;  2FVE A;  2CNR A;  2EHS A;  4NEO A;  2KOO A;  4H2Y C;  2MD9 A;  1KLP A;  2GDW A;  2AFE A;  2JU1 A;  2L22 A;  2N6Z A;  2KWL A;  2KW2 A;  2CG5 B;  3CE7 A;  5CZD B;  2LKI A;  2L4B A;  2AF8 A;  2DNW A;  5EJD A;  5HVC A;  2LIU A;  2FQ2 A;  2QNW A;  1OR5 A;  4HKG A;  5HV8 A;  2ROQ A;  2MF4 A;  1DNY A;  2KOP A;  1ACP A;  2EHT A;  2LIW A;  2X2B A;  3RG2 A;  2M5R A;  2MR7 A;  3EJB A;  2MR8 A;  1X3O A;  2KGD A;  4CA3 A;  2N6Y A;  2FVA A;  2KG9 A;  5KP7 B;  4R0M A;  3EJD A;  3EJE A;  2CQ8 A;  4MRT C;  2XZ0 D;  2K2Q A;  1NQ4 A;  1HQB A;  2N50 A;  2LML A;  2KGE A;  2N98 A;  1AF8 A;  2KG8 A;  2KOQ A;  2AVA A;  4H2X C;  4IZ6 A;  2AFD A;  1F80 D;  2KGC A;  2K92 A;  1DV5 A;  2N5I A;  2LTE A;  3GZM A;  3LMO A;  5KP8 B;  2VSQ A;  4BPG A;  2K93 A;  1L0H A;  2K0Y A;  4H2W C;  2FHS C;  4BPH A;  3NY7 B;  2LL8 A;  5KP6 B;  2FAC A;  2FQ1 A;  2FQ0 A;  4PXH B;  2K94 A;  2KOS A;  2K0X A;  2KGA A;  2MVU A;  2LOL A;  2FVF A;  2KR5 A;  1HY8 A;  2FAE A;  1T8K A;  2KG6 A; 
#chains in the Genus database with same CATH topology
 1EMV A;  1VQ6 P;  2DGY A;  1L0I A;  2PEI A;  2JGP A;  2GZJ A;  4F37 A;  2L0Q A;  2LPK A;  2GDX A;  4QNB A;  1VQ5 P;  1Z6M A;  2MD9 A;  1IMQ A;  2AFE A;  2JU1 A;  1EOQ A;  2GZE A;  1M6E X;  3CC2 P;  5BS1 A;  2VLO A;  1YIJ P;  1VQ8 P;  1ACP A;  2CWO A;  1E0H A;  2M8L A;  5HGN A;  3RG6 C;  1FR2 A;  2M5R A;  2WPT A;  3EJB A;  2KGD A;  1K9M Q;  2PEK A;  3CCE P;  2XV6 A;  4COP A;  2K0D X;  5HGL A;  4R0M A;  3EJE A;  4M0I A;  5JPA A;  3I56 P;  5I4T G;  3CCS P;  3WBH A;  3G29 A;  1GXG A;  2KGE A;  3B4Q A;  1VQK P;  2KG8 A;  2GZG A;  1UNK A;  1KD1 Q;  2AFD A;  3G26 A;  3H47 A;  2OTL P;  2N5I A;  1ZMB A;  2PEJ A;  3CC7 P;  5KP8 B;  2VSQ A;  1IMP A;  3DS3 A;  3NY7 B;  2GZF A;  2E1M A;  2FQ1 A;  2FQ0 A;  1QRJ A;  2K94 A;  2KOS A;  3G28 A;  3CCQ P;  2QA4 P;  1W2B O;  4IPY A;  2KG6 A;  2FAD A;  2N5H A;  1VKU A;  1VQ7 P;  1VQL P;  2JU2 A;  2MY5 A;  5DCK A;  4U0B A;  2EG5 A;  1Q82 Q;  1D1D A;  2EHS A;  4NEO A;  1RO0 A;  2KOO A;  4H2Y C;  1VHN A;  3Q20 A;  4QKO A;  2GDW A;  2L22 A;  5HGO A;  2KW2 A;  2P9X A;  3CE7 A;  1KC8 Q;  2L4B A;  2DNW A;  5HVC A;  2FQ2 A;  3G0V A;  5HV8 A;  3HYB A;  4HKG A;  2M8N A;  2ROQ A;  2MF4 A;  1YJW P;  2NO8 A;  3RG2 A;  2K5X A;  2MR7 A;  3LRY A;  1X3O A;  4CA3 A;  2JYG A;  2N6Y A;  2FVA A;  2BUO A;  1KQS O;  3EJD A;  1MZ8 A;  3CCM P;  4MRT C;  3DS0 A;  3G1G A;  2ERH A;  1UJZ A;  2LML A;  4XRQ A;  2KOQ A;  2AVA A;  1VQO P;  1BXI A;  1Q81 Q;  1JJ2 O;  1AUM A;  2LTE A;  1L0H A;  2K0Y A;  3G1I A;  3H4E A;  2Z44 A;  3E2D A;  3H0D A;  2JBG A;  5HGM A;  3CME P;  2FAC A;  3GJN A;  1Q86 Q;  1VQM P;  3P05 A;  4PXH B;  2GYK A;  2MVU A;  1NJI Q;  5F2N A;  2OAR A;  3G21 A;  2PNG A;  2XZ1 C;  2PEM A;  1GXH A;  2L9F A;  2GDY A;  2CGQ A;  2JQ4 A;  4PH0 A;  3DTJ A;  3DS4 A;  4DG9 A;  2KOR A;  2FVE A;  3CCL P;  2JO0 A;  1KLP A;  2N6Z A;  1VQ4 P;  2JAZ A;  2CG5 B;  2LKI A;  1CEI A;  2Z45 A;  1RNI A;  2PEO A;  3I55 P;  5EJD A;  3G71 P;  2LIU A;  2QNW A;  1OR5 A;  1E6J P;  2KOP A;  5EW5 E;  4U0A A;  1IUQ A;  2EHT A;  2LIW A;  2X2B A;  1M1K Q;  1QVF O;  1BAJ A;  1VQN P;  2EFJ A;  2KG9 A;  4GR2 A;  1EIA A;  3U43 A;  5KP7 B;  2Z46 A;  2CQ8 A;  2PY8 A;  2K2Q A;  3CCJ P;  4XFY A;  7CEI A;  3MGE A;  4U0D A;  1HQB A;  2N50 A;  1YI2 P;  2XT1 A;  2QEX P;  3B5I A;  4H2X C;  4IZ6 A;  2KGC A;  2VLQ A;  1DV5 A;  3GZM A;  3CCU P;  4H2W C;  2BHV A;  2L6E A;  4BPH A;  3M1M A;  2LL8 A;  5BS2 A;  5KP6 B;  3G6E P;  1RO2 A;  1A8O A;  3DPH A;  3CPW O;  3NTE A;  2VLP A;  4GR6 A;  2K0X A;  4XFZ A;  2KGA A;  3CD6 P;  2PEQ A;  3DS5 A;  2KR5 A;  4XFX A;  1HY8 A;  2FAE A;  3CCR P;  4UHP B;  4BPF A;  3CXC O;  1S72 P;  4PWV B;  2MVV A;  3GZL A;  1ZNV A;  2GZI A;  2CNR A;  1YHQ P;  1VQP P;  2KWL A;  2VLN A;  1Q7Y Q;  5CZD B;  1QVG O;  2AF8 A;  2JYL A;  1DNY A;  4XRO A;  1GPJ A;  5F2O A;  1YJN P;  3HZQ A;  3VRL C;  5F2K A;  2MR8 A;  3OW2 O;  3DS1 A;  2JB0 A;  3CMA P;  4PH1 A;  1YJ9 P;  2XZ0 D;  2PEN A;  1NQ4 A;  1VQ9 P;  1M90 Q;  3GKL C;  2EIA A;  2N98 A;  1AF8 A;  2KOD A;  1YIT P;  3DS2 A;  3CCV P;  1M6N A;  3G4S P;  1K8A Q;  1F80 D;  1AYI A;  2XXM A;  2K92 A;  1N8R Q;  1K73 Q;  3LMO A;  2OTJ P;  4BPG A;  2K93 A;  4U0E A;  2FHS C;  2M8P A;  4WYM A;  3CC4 P;  1K30 A;  4U0F A;  2ONT A;  4COC A;  1M74 A;  2LOL A;  2FVF A;  4U0C A;  1A43 A;  2LF4 A;  1T8K A; 
#chains in the Genus database with same CATH homology
 2FAD A;  2N5H A;  1VKU A;  2PNG A;  2XZ1 C;  2L9F A;  2JU2 A;  2MY5 A;  2GDY A;  2CGQ A;  1L0I A;  2JGP A;  2JQ4 A;  4BPF A;  4PWV B;  2L0Q A;  2MVV A;  2LPK A;  3GZL A;  2GDX A;  4DG9 A;  2KOR A;  2FVE A;  2CNR A;  2EHS A;  4NEO A;  2KOO A;  4H2Y C;  2MD9 A;  1KLP A;  2GDW A;  2AFE A;  2JU1 A;  2L22 A;  2N6Z A;  2KWL A;  2KW2 A;  2CG5 B;  3CE7 A;  5CZD B;  2LKI A;  2L4B A;  2AF8 A;  2DNW A;  5EJD A;  5HVC A;  2LIU A;  2FQ2 A;  2QNW A;  1OR5 A;  4HKG A;  5HV8 A;  2ROQ A;  2MF4 A;  1DNY A;  2KOP A;  1ACP A;  2EHT A;  2LIW A;  2X2B A;  3RG2 A;  2M5R A;  2MR7 A;  3EJB A;  2MR8 A;  1X3O A;  2KGD A;  4CA3 A;  2N6Y A;  2FVA A;  2KG9 A;  5KP7 B;  4R0M A;  3EJD A;  3EJE A;  2CQ8 A;  4MRT C;  2XZ0 D;  2K2Q A;  1NQ4 A;  1HQB A;  2N50 A;  2LML A;  2KGE A;  2N98 A;  1AF8 A;  2KG8 A;  2KOQ A;  2AVA A;  4H2X C;  4IZ6 A;  2AFD A;  1F80 D;  2KGC A;  2K92 A;  1DV5 A;  2N5I A;  2LTE A;  3GZM A;  3LMO A;  5KP8 B;  2VSQ A;  4BPG A;  2K93 A;  1L0H A;  2K0Y A;  4H2W C;  2FHS C;  4BPH A;  3NY7 B;  2LL8 A;  5KP6 B;  2FAC A;  2FQ1 A;  2FQ0 A;  4PXH B;  2K94 A;  2KOS A;  2K0X A;  2KGA A;  2MVU A;  2LOL A;  2FVF A;  2KR5 A;  1HY8 A;  2FAE A;  1T8K A;  2KG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...