1VQPP

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqpP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqpP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqpP02
1M1KQ 3CC4P 1YHQP 1S72P 3CC2P 3I55P 1VQ7P 3CPWO 3CCQP 1YIJP 1K8AQ 1VQNP 1VQLP 1VQKP 1QVFO 1VQ6P 1K9MQ 2OTJP 1Q81Q 1VQMP 3CC7P 1KD1Q 3CCRP 1YJ9P 3CCVP 3CXCO 1Q86Q 2QA4P 1VQ9P 3CD6P 1VQ8P 1KC8Q 1YJNP 3CCUP 1KQSO 3G71P 1Q7YQ 1YITP 1VQ5P 1VQOP 2QEXP 3G6EP 3CCSP 1YI2P 1N8RQ 1QVGO 3CCEP 1K73Q 3CCJP 1VQPP 1Q82Q 3OW2O 1M90Q 3I56P 1NJIQ 1W2BO 3G4SP 3CCMP 1YJWP 1JJ2O 2OTLP 1VQ4P 3CMEP 3CMAP 3CCLP
chains in the Genus database with same CATH superfamily
1SQXG 3HD7A 3T97A 3LIEA 3O8ZA 3RL0g 2AXTE 4L73A 2R32A 3TNUB 1KQLA 3GLMA 3H1HG 5H2FE 1N8RQ 3EWKA 3G4SP 2LKMA 2QRXA 2WPTA 4GR2A 2JB0A 5KLIB 2W6BA 4Y99B 1HGVA 4IPYA 2MF4A 3WMM0 3A2AA 3FX0A 1JY2N 1KC8Q 2VLOA 3L74G 1YITP 4U3FE 4ZMDA 3G9RA 5AVQB 1RF1A 1VQPP 1LT9C 1NTZG 1L0HA 3CX5E 3CMAP 2H43A 1RQVA 1IK7A 1VQNP 1ACPA 2WTYA 2IBZI 4PJ0H 4W80A 5HGOA 2QJPB 5AW5B 4DJGA 2XZ0D 3C1LA 2LOLA 3O6QA 1QRJA 4KT0J 1ZXGA 1X22A 2OTKE 4KHXA 1ZV8A 2IX7C 1U57A 5AVSB 1UIXA 1T8ZA 2OYHA 3GMAA 2ZJSE 2Q7CA 4U0BA 1KD1Q 1N73B 1RF0C 1CI6B 2K9YA 3C9IA 1QVGO 1L0NJ 3EQ2A 1JCCA 2YIUC 2KYVA 3SFEC 1VQ4P 2OTLP 2EIAA 3CC2P 1DEEG 2WVRA 3H1JJ 3FXEA 3H32B 1SS1A 2L91A 3PHLA 3RK3B 3HE4B 5APXA 4ZNCA 1CEIA 2AVAA 1SQQE 3M06A 4JYCA 1BGYG 1GK6A 2N5HA 1QLED 5HVCA 4HYTB 1W2BO 2KP8A 1JMMA 1EIAA 2E74B 5KAIH 1KV4A 2HODA 1AJYA 3H4EA 2GUSA 2E74D 3GG2A 2N9YB 1YBKA 3KZIH 1SQQG 4I7ZC 3CWBJ 2CG5B 2W6JH 5CMZA 3Q5RA 1LP1A 3S9OA 2K0XA 2IBZD 1G2CA 1QEXA 2H7HA 2O1KA 3L73J 3JCUH 1GL2C 1SQPJ 2FHSC 1S72P 1SQBG 1X8YA 2D2CB 1VQMP 2D2CD 1NQ4A 1L4AA 2B87A 3GHGB 1IFDA 3D71A 2MD9A 3TDKA 3LRYA 3USSA 3TGUG 5CJ4A 3CXHI 3P8CD 1P84E 5CHXA 3V4WA 2IBZG 2MJZA 1L0ND 3AEBC 2KI7B 3TK1A 1KORA 3HD7B 3EJDA 3HTKB 1MFZA 1LTJC 3HD7D 1NTKE 1GXHA 3H1JD 3HYBA 3A0HE 1E79H 1OVRA 3DS4A 3H1LG 1D7MA 3MUDC 1RY3A 4H0LB 2PP6A 2OYIC 2ZYAA 5AW1B 4H0LD 4C7RA 2HG5D 1BAJA 3P05A 1EMVA 1T2KD 2A06G 2KZJA 2Z5HA 2I1KA 3CWBD 2I1JA 4DZOA 1W5CE 2FVAA 2JDIH 3UIAA 1S2EA 5B66H 4D6TE 2EHTA 5AVWB 4UB6E 2KSJA 3G0VA 1QL2A 1X79B 1Z6MA 2B88A 1CZQA 3L73D 5AW8B 3A0BE 4GR6A 1QX8A 1SQPD 3EJEA 3HZQA 4EI2A 3A0BH 2R44A 3O6QB 4DOJA 1JTHA 3I55P 1OXZA 1GTWA 2ZT9B 3M91A 3CWBG 1YTZT 5F2KA 3H1KE 4DCKA 1GZLA 2FYUJ 3I56P 2LTEA 1AV1A 2YKPA 3GF3A 3L73G 1SQPG 4MN4C 5TISH 1JOCA 2KK7A 2PEIA 2H8PD 2FBWC 2IYPA 2BUOA 2OQQA 1ZR2A 3CXHH 5APWA 3Q5SA 1JY2P 3RG6C 3PP5A 1G1JA 4R4LA 1DD3A 1LT9A 3RK2B 3SWFA 4XE5B 3G1IA 3VOPA 2FYUK 1EZVD 2XV5A 4IFMA 3RK2D 3AEDC 2OTJP 2P2UA 4HKZH 1S1CX 5KJ7C 3M1MA 2JU1A 3WU2H 1J1EB 4N78E 1EOQA 1VKUA 1LP1B 1NVOA 4PD4D 3CPWO 1G2CB 4ASVA 1A02F 2OYOA 2WPSA 1QL1A 1Y47A 4BPFA 1S3JA 1KTMA 3L70E 2PEKA 4H44B 1NTMJ 2WPVB 1PP9E 4IFDK 1HQBA 4H44D 1L4AB 1LGHB 3TNUA 2B87B 1X3OA 1L4AD 4OGQB 1IZNB 2QJYC 2C9LY 4OGQD 2FY8A 2MR8A 2FYUD 4XA4A 2QG4A 2JR8A 2JQ4A 2FQ1A 1VF5B 2Z5IA 1VF5D 5KLVJ 1VDFA 2WITA 4I2LC 3MIWA 2YMKA 1JM0A 4LC1A 2O01J 3MGNA 5AVXB 2IFNA 2PENA 1PPJD 1PEQA 1NGMB 3NFQA 3AEAC 1SQVK 2R5DA 3BVHA 4CPGA 1E5WA 1PZQA 5CCGC 2JU2A 2POHA 2VRSA 1T6AA 1GL2A 2GYKA 1LT1A 3GKLC 3GZMA 5KLVK 1FZEA 1FOSF 3V2PA 1KMIZ 1ZRTE 1Q86Q 3MD0A 2LIWA 3QWOC 2HLOA 2YMYA 3H1HJ 1VQOP 3G1GA 1K30A 4Y28J 2B89A 1N73A 2PRRA 1CI6A 1PPJG 1SQXK 3W68A 2M3BA 1NTMD 2VSQA 5AW3B 3L74J 3AEEC 1JTHB 2IZ1A 2P10A 2K94A 4AUWA 3NY7B 3BATA 2C9NY 2FXMA 3H32A 3EFFK 1NTZJ 1IFPA 2YO2A 1LTJA 3R4YA 2WPQA 1S9KE 1NU1K 1JY3P 3C8VA 5APYA 5AW6B 3TSIA 4YPCA 1MZ8A 3VN0A 4WY4C 3MUDA 5GTIH 2WQYC 4GOEA 2MVVA 5KLVD 3Q1MA 5EW5E 1L0LE 3FXDA 3H25A 1OW7A 1OW8A 3CX5I 4H2WC 2JJLA 1H0TA 4IOIH 4BWNA 4UHPB 1MZ9A 1EXJA 1NHLA 5EFWB 1LT9B 2E5YA 1IFNA 1SQVE 1HTLC 2K9JA 5KKZC 1AQ5A 4IL6E 3F89A 4PH0A 2HPCA 3L71G 2O01H 1PL5A 4EIJA 2WSSH 3H1HD 1KQFB 1M57D 1RE3C 3WUVA 2JWAA 2YNYA 4WB4A 2XT1A 4U7JA 2K92A 1L2PA 1BGYJ 3E1RA 2QVAA 3RBZA 4L74A 5TJHA 3L74D 2EG5A 3HTKA 1SQQJ 3L36A 3Q3DA 1NTZD 1RH5B 1VQ9P 4M3LA 2YIUB 4L75A 2L4BA 2Z45A 2AXTH 2M5AB 2J5UA 1H8AA 1NU1E 1NJIQ 2ROQA 3EFGA 4PH1A 1NYHA 5H2FH 1SQBJ 4R0MA 2E43A 1YIJP 1BSNA 2Y0CA 1ZLLA 1H88A 1FE6A 2P1JA 3U59A 2ERHA 5HGNA 4L76A 2B9BA 2VLPA 3JC22 3E7KA 2NPSC 5KJ7A 4UB8E 3TGUJ 2L9FA 1KB9E 4I7ZB 2L6EA 2PY8A 5M1BA 1NAFA 3CCQP 2QIWA 3S1KA 1ZN5A 3CX5H 1SQBK 4U3FG 3IF4A 1GL2B 1AVYA 4PWVB 1M8OB 1DD4A 1WMKA 1GL2D 4ZKUA 5HGLA 1BXIA 1FZCC 2CNRA 1K04A 3H1LJ 5GTHE 3ABVC 1P84I 3AE3C 1ZR4A 1BGYD 2OARA 1FZFA 2CPBA 2KUBA 4NPDA 5KAFE 2KG8A 3D70A 1M1JC 2AEFA 1SQQD 2W90A 3CCMP 1NAYA 2Q3IA 3E1IA 4MRTC 3B5NC 1KFMA 1SLQA 1GPJA 3DPHA 5E79E 4U0CA 3L72E 1OMIA 1LTJB 3SWKA 5E79H 2GM4A 3CI9A 5B5EE 1RE4A 3RK3D 1SQBD 3NTEA 1QGKB 1M6EX 5DCKA 4D6TJ 2GDXA 1XTGB 2OYIB 1JUNA 4XFXA 3B4QA 1HJ0A 4BRYB 2H89C 3DS0A 1L0NK 1LTGC 1VHNA 5CCGA 7CEIA 3KHUA 2GA1A 2V7QH 3H1IE 4F37A 3VTPC 3TGUD 1H0TB 3AE2C 1E0HA 4CA3A 2MVUA 3L4FA 5APSA 3VYIA 2K9JB 4HB1A 4H13C 1N7SC 4ZKPA 4NEOA 2HPCB 2J58A 3H1LD 2JKVA 1IC2A 4LGDE 5CCHC 1YQ4C 1UIIA 2KGCA 2GUVA 4N3YB 2IDBA 3WUTA 1L0IA 2GDWA 3CC4P 5CJ0A 2BCCE 3II6A 2A06D 4DT0A 1SQPK 2Q9IA 1P84H 4WY4A 2FFDC 2W83C 4OWFA 1OIPA 1T8KA 1JY3N 4QNBA 3LMOA 3HRNA 2P7JA 3A0HH 2RMZA 1TU3F 1KILE 3BRTB 3OAKA 4D6TD 1NTKG 2PGDA 3PLNA 3G26A 2JP3A 2L5GB 4PV1C 1ZMEC 1L0NE 4HH2A 2FACA 1GK4A 2Q5UA 1VQ6P 1PEUA 1K9MQ 3L70J 3M0DA 3WBHA 3MZWB 1RE3A 2FXPA 3H1JE 2FADA 5KJ7D 4UB6H 2FYZA 2KWLA 3BCCE 3L35A 1URQC 1FDIA 3HUSC 3M9BA 4D6TG 1YHQP 2LPKA 5AW4B 2Y9YA 1MUUA 2FXOA 4H2YC 1PGJA 3CXHD 2ZT9D 1EQ7A 1LWUC 3AE9C 4RO0A 2QJYB 2ZXEB 1KILC 1JY2O 3V2RA 5BS2A 2P9XA 3V5BA 1FJKA 3H1KG 1FOSE 2JGPA 1YJ9P 1LNQA 5BVZA 1OWAA 3CCUP 4TT3H 1BCCE 2P58A 1DV5A 2ONTA 3AEFC 3AE1C 1JJ2O 3V2QA 1LTIC 2XKMA 4XRQA 2XZ1C 3E2DA 2NPSA 4U0EA 1OW6A 1HGZA 3G3ZA 1FJPA 2GZEA 4WWIA 2ITAA 2M8PA 1KYOE 2LXBA 5AW9B 1AA0A 1FDMA 1M6NA 4Z1MH 2M0BA 5CCGD 3RL0C 3L70D 4YXWH 3VMZA 3MHVA 1FZAA 2KGAA 2FQ0A 1Y9BA 2QNWA 4N6JA 1FAVA 3OJAB 2W27A 1RF1C 1VQ8P 2QJKC 1EXIA 3DTJA 2I8DA 1RF0A 1EZVE 2KIKA 2LKIA 3JSVC 2GZGA 2M5AA 1VQLP 3B5NA 1MFTA 1L0LJ 3TF5A 2O3JA 3CCRP 3SFDC 3DS3A 3L70G 1M74A 3GF7A 1PGOA 2KG6A 1PP9G 1JO5A 1U7JA 2KSEA 4PD4E 2OYHC 2PNGA 1OR5A 3L71J 3IR9A 3CMEP 4WY4B 2N6YA 5KTBA 4COPA 1VQ7P 2JWDA 4WY4D 2WSFH 1NTMK 4IFFA 2KXPB 1SVFA 4OH8B 4WBAA 2GZJA 2KOQA 2A45I 1JMBA 1IMPA 1RO2A 1U7MA 2XZRA 2DW3A 3RG2A 3G6EP 2PEQA 5APQA 3OW2O 2V4HA 4XFZA 2LMLA 1S5LE 2FYUE 1EDJA 4GODA 2JYGA 3M9HA 2IFMA 4A7PA 3L37A 5KKZB 1BE3E 5KP8B 1Y8AA 2MY5A 1N7SA 3VP8A 1KQSO 3ITKA 2AFDA 1XTCC 3CCSP 2YKOA 1J2JB 3CCJP 4O9BA 2LL8A 1PEMA 1DEBA 1RO0A 1PEOA 2DGYA 1YTZI 1GU4A 2N98A 1PV3A 1S9KD 3GZLA 2K1AA 2R3CA 4K3AA 2OGUA 1YJNP 1AQTA 2Z44A 3R2PA 2E75C 5AVRB 2SPZA 3S4RA 2E76C 1L0LD 5AVZB 2WT7B 5BU5A 1LTAC 4GOFA 2JAZA 1KZUB 2BEZF 3N7NA 1MV8A 3NMDA 1NWQA 4BPHA 1L4AC 1QVFO 4U3FJ 2K88A 3L71D 1FR2A 1S4XA 2OYIA 4B86A 4BRYA 3VMAA 3L75E 2KS1A 1KB9I 3WUUA 1LTSC 2XNDH 1NTZK 2AXCA 2ZVOB 2K37A 1OFCX 1L0LG 2PEMA 3A5TA 5AW2B 1JNMA 1GW3A 1G1IA 2NPSB 2AFEA 2NPSD 2KGEA 2A45H 1IFJA 4BXLA 1YJWP 1AFOA 2Y9ZA 2Y0DA 4IL6H 1M56D 1URQA 5KLVE 3HUSA 4XFJA 2A45G 1SQVG 3AE7C 2QA4P 2KW2A 3HE5A 1FZCB 4WVZA 2HR3A 1JCDA 1EC5A 1JB0J 2UWJE 2N1TC 2R3SA 1LWUA 5DJUB 3L72J 1KILA 1SQXE 2M3EA 1GXGA 2KOOA 1GDTA 2PAJA 1M1JB 3CXCO 3U1CA 4DG9A 3LW5H 3B5NB 4H2XC 1MKMA 3AE4C 4YTPC 3B5ND 1D1DA 2V7QJ 3H1HE 1BSHA 1NO4A 2BQ1E 4U3FD 1YQ3C 3H1IJ 2WPRA 1OZHA 2LR2A 1KB9D 3CX5D 4BPGA 1HBWA 1FZBA 2WZ7A 3KQGA 2IYOA 4XFYA 2K2QA 1SQQK 1GW4A 1NU1G 1Q82Q 3L74E 4RJTA 4KJMA 4ASWA 2VLNA 1HH0A 2L22A 4W7YA 1PFIA 2O1JA 5K5GB 1NTZE 4JQ0D 2XNXA 3V4QA 4UB8H 3V6IA 3SSUA 1NOHA 1KB9H 2LXCB 4EOTA 1LTTC 1IO4A 2KOSA 2KB7P 1NH4A 3I5CA 1JEKA 1VQ5P 4U0FA 4HKGA 2ZYGA 3DS2A 1HVVA 3QH9A 2BCCJ 5APUA 3U43A 3KYQA 4EDFA 4H13B 3DS1A 1N7SB 3B5IA 4PJ0E 2HYNA 4EYYQ 4H13D 1N7SD 1GU5A 4I6MC 5GTHH 1SFCC 5AVVB 2YXQB 1SP4A 4LLHA 5CCHD 1NTKJ 2LIUA 3L72D 3N4XA 2LF4A 1DH3A 1EDLA 2FYNC 2NRGA 4JBZA 4NPEA 1F80D 2IPPA 3FWLA 5KAFH 4COCA 2N50A 2VLQA 2NO8A 5KP7B 2ZVNB 1J1DC 1M1KQ 1A02J 1A8OA 2FFDB 3BRVB 3IN6A 4NPFX 3AE8C 3CCVP 3IAOA 4C7NA 1AVOA 3Q20A 3H1ID 1IK9A 1NTKK 5B5EH 1BGYE 3H6PA 5CBNA 5AW0B 1DIPA 3L72G 2E5TA 2KS1B 1N2DC 2Q1KA 3BCCJ 2X2BA 4PV1B 1FU1A 5KLIC 5KAIE 5AVUB 4Y99C 4PV1D 2R5BA 3MGEA 2YXRB 3KZIE 2FVFA 4GDOA 4U0DA 2P67A 1NKZB 2BASA 1KFNA 2CPSA 3H1IG 3RK3E 3H1KJ 1SQBE 2WSEJ 2BCCD 1Z56A 2M8RA 3AEGC 2NZ2A 1P84D 2N9BA 1URQB 3PRJA 3JCUE 3HUSB 1BDDA 2QJPC 1URQD 1UNKA 2L0QA 1S5LX 2XXMA 1OVVA 2K5XA 3KDPB 3CCLP 2W8ZA 3HE5B 1HF9A 2PEJA 1NTKD 3TGUE 1Q90D 1LWUB 1BCCJ 3PH0A 2IBZE 4QMAA 2J59M 3PTZA 1KILB 1EDIA 4I1LA 1KILD 1N73C 3Q5PA 3NTNA 5AVTB 2BCCG 3SWYA 2K93A 2KNCA 2ZXXA 4IZ6A 3NXSA 3H1LE 1FC2C 4WYMA 2GZIA 1KYOI 2Z4EA 2KOGA 2AF8A 2E1MA 3T97B 1WT6A 3A7OA 1LJ2A 3B4SA 3RK3C 3P8CE 4RESB 2KORA 2A06E 3RGUA 3BCCD 2CK3H 1VQKP 2E74C 3LIDA 2JEEA 3CL3D 1HJBA 2Y0EA 3RL0B 3W67A 3FWNA 3FGAD 1HUCA 1PP9J 3RL0D 2GDYA 2KR5A 3CCEP 1EZVI 3VMYA 1ZW0A 1L0NG 2W6AA 1HWTC 3H1KD 5B66E 3IFMA 2N1TA 1NKNA 3VMXA 1IJDB 2KZIA 1RF1B 2KODA 2QJKB 2FVEA 4JPZB 3H1JG 1Q81Q 2QM8A 1FBMA 3VRLC 4JF7A 3B71A 2WT7A 4IL6X 2WSFJ 3BCCG 2D2CC 3CWBE 2RH0A 2QEXP 2CQ8A 4PD4I 2EFJA 1BCCD 1ZP0C 3GHGC 2WSEH 1USDA 1T3UA 3EJBA 2WMMA 3KPEA 3L73E 1A43A 1AUMA 1SQPE 1X0TA 1DNYA 2YKQA 2QE7H 2OYHB 2G8YA 5C39A 3G71P 1R5LA 4TLFA 1KYOD 3B8EB 3BASA 5AW7B 3HD7C 5TISE 2EHSA 2FKWB 5HV8A 1BE3J 1OX3A 4C7NB 3CXHE 5L8RJ 4N78D 1KQGB 1CW5A 2IZ0A 3K5BA 1BCCG 2HFED 4H0LC 2ZYDA 2JO0A 5APVA 1M90Q 1KYOH 1T2KC 2XV6A 1FZCA 1M7LA 3D6YA 1PP9D 1RHZB 3CC7P 1E6JP 2K0YA 3PJSK 2HODB 1N86A 3WU2E 2Z46A 1SFCA 2E42A 1H89A 2MR7A 1IMQA 1WRGA 4M0IA 3G21A 3VP9A 3OA7A 1Q7YQ 1M1JA 2DNWA 3D6ZA 4GT1A 4GIFA 3H47A 4YXDC 5EJDA 4XROA 5DJTB 4U0AA 2E75B 3L75J 1ZOYC 5BU8B 1HY8A 5AVYB 4C46A 3V2NA 1USEA 2E75D 2E76B 2JBGA 1EZVG 2ZT9C 3AE6C 2E76D 2Q3EA 2CGQA 5APTA 2KGDA 3P32A 3AECC 4PD4H 4HJGH 4PXHB 1W2EA 1SQVJ 1UJZA 2K0DX 2AEMA 2KNCB 2G3AA 3H0DA 1L0LK 1BE3D 2QM7A 2ZAEB 5F2OA 1ZRTD 2RN0A 3P8MC 1FZGA 3RK2C 1BDCA 1RE4C 5I4TG 1S5LH 2CWOA 1YI2P 1EDKA 2WWWA 3Q2YA 1SQXJ 2WSCJ 5CCHA 5BS1A 2FYUG 4OVNF 2KLUA 1N7LA 1FS0E 3LW5J 4AQRD 1BE3G 1J1EC 1PGPA 3M9QA 3KXDA 1PPJE 1OVUA 1ZNVA 4W7ZA 1JY3O 2JO1A 2N1TB 1NU1J 2N1TD 2JYLA 2ZFCA 2FAEA 1LTBC 2FFDA 5JPAA 1K05A 4K35A 3L75D 1PIXA 2N5IA 1YYCA 1RNIA 2XU6A 4H44C 5CZDB 1RQUA 1FDOA 2MKVA 2M5RA 4GKGA 2KLVA 3MP7B 2XDJA 4OGQC 1VL2A 3ZDMA 2RKLA 3CLQA 1SQVD 3MTUE 2YO3A 1VF5C 2H88C 3HE4A 5GTIE 5HGMA 2BEQD 1CSBA 3P7KA 1IFMA 1NTME 2GZFA 2AEJA 3G29A 1K8AQ 1VPCA 1GMJA 5KP6B 1KLPA 2M8NA 3M0AA 3L75G 2FQ2A 2PEOA 1X9VA 4AYCA 3A3YB 3CE7A 3U1AA 1AYIA 2PFXA 3GJNA 1IFIA 1K73Q 1R8EA 2O01N 1NTMG 2QSIA 1GD2E 3L71E 1IUQA 2C0WA 2C0XA 3G28A 4RKUJ 1ZMBA 1SQXD 3F5HA 2Q6QA 3AE5C 2M8LA 5F2NA 3TYYA 2K3RA 2KOPA 1SFCB 5KLVG 1PGQA 4QKOA 3M0DC 2KG9A 1SFCD 1NU1D 2N6ZA 3GHGA 2FYNB 1Q2NA 1KN7A 1T3JA 3CD6P 1AF8A 2WSCH 2BHVA 3GW6A 1DX7A 1J1DB 5CBOA 3DS5A 4JYBA 1R5SA 3RBXA 4R4MA
chains in the Genus database with same CATH topology
1RNIA 4U0DA 3CC4P 3G1IA 2EIAA 4COPA 5BS2A 2P9XA 1VQ7P 3CC2P 2KODA 3H47A 4XROA 2OARA 2OTJP 1Q81Q 4U0AA 1BAJA 1YJ9P 2PEMA 3VRLC 1RO2A 1Q86Q 2XT1A 3P05A 3CCUP 1VQ5P 4U0FA 1VQOP 2QEXP 3G6EP 3DS2A 1N8RQ 2PEQA 3G1GA 1K30A 3M1MA 2ONTA 3OW2O 2EFJA 1W2BO 3G4SP 3CCMP 1YJWP 2XXMA 1JJ2O 1EIAA 3DS1A 4XFZA 3B5IA 1EOQA 4QNBA 4XRQA 3CCLP 2PEJA 3E2DA 3H4EA 5HGMA 3DPHA 4U0EA 2EG5A 3CPWO 2JYGA 3G29A 4U0CA 1K8AQ 4GR2A 1A43A 1AUMA 2M8NA 3G0VA 2M8PA 4IPYA 2QA4P 1VQ9P 2PEOA 1KC8Q 3H0DA 2LF4A 2Z45A 4GR6A 3G71P 1YITP 3HZQA 1KQSO 1M6NA 3CCSP 2PEKA 3G26A 5F2OA 1K73Q 3CCJP 1VQPP 3NTEA 1M6EX 1NJIQ 5DCKA 4COCA 4PH1A 1PEMA 4XFXA 3CMAP 1RO0A 1PEOA 1M1KQ 2DGYA 1S72P 3DS0A 1A8OA 3I55P 1YIJP 1VQNP 1IUQA 1VQ6P 1PEUA 1K9MQ 4WYMA 3WBHA 1VQMP 3G28A 5HGOA 1ZMBA 5I4TG 3CCVP 3CXCO 2CWOA 1VQ8P 1QRJA 5F2KA 1YJNP 2E1MA 3DTJA 2Z44A 5HGNA 3Q20A 2JO0A 1YI2P 2M8LA 5F2NA 1M90Q 3I56P 1D1DA 3LRYA 5BS1A 2BQ1E 2XV6A 2L6EA 2PY8A 1YHQP 3CCQP 1VQLP 1VQKP 1QVFO 4U0BA 2PEIA 3CC7P 1KD1Q 1E6JP 2BUOA 3CCRP 3DS3A 1M74A 3CD6P 2PENA 2Z46A 2BHVA 4XFYA 1PEQA 2JYLA 3RG6C 3CCEP 1QVGO 1Q82Q 3DS5A 5HGLA 4PH0A 4M0IA 3MGEA 3G21A 3HYBA 5JPAA 2OTLP 1VQ4P 3CMEP 1Q7YQ 3DS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K Q;  3CC4 P;  1YHQ P;  1S72 P;  3CC2 P;  3I55 P;  1VQ7 P;  3CPW O;  3CCQ P;  1YIJ P;  1K8A Q;  1VQN P;  1VQL P;  1VQK P;  1QVF O;  1VQ6 P;  1K9M Q;  2OTJ P;  1Q81 Q;  1VQM P;  3CC7 P;  1KD1 Q;  3CCR P;  1YJ9 P;  3CCV P;  3CXC O;  1Q86 Q;  2QA4 P;  1VQ9 P;  3CD6 P;  1VQ8 P;  1KC8 Q;  1YJN P;  3CCU P;  1KQS O;  3G71 P;  1Q7Y Q;  1YIT P;  1VQ5 P;  1VQO P;  2QEX P;  3G6E P;  3CCS P;  1YI2 P;  1N8R Q;  1QVG O;  3CCE P;  1K73 Q;  3CCJ P;  1VQP P;  1Q82 Q;  3OW2 O;  1M90 Q;  3I56 P;  1NJI Q;  1W2B O;  3G4S P;  3CCM P;  1YJW P;  1JJ2 O;  2OTL P;  1VQ4 P;  3CME P;  3CMA P;  3CCL P; 
#chains in the Genus database with same CATH topology
 1SQX G;  3HD7 A;  3T97 A;  3LIE A;  3O8Z A;  3RL0 g;  2AXT E;  4L73 A;  2R32 A;  3TNU B;  1KQL A;  3GLM A;  3H1H G;  5H2F E;  1N8R Q;  3EWK A;  3G4S P;  2LKM A;  2QRX A;  2WPT A;  4GR2 A;  2JB0 A;  5KLI B;  2W6B A;  4Y99 B;  1HGV A;  4IPY A;  2MF4 A;  3WMM 0;  3A2A A;  3FX0 A;  1JY2 N;  1KC8 Q;  2VLO A;  3L74 G;  1YIT P;  4U3F E;  4ZMD A;  3G9R A;  5AVQ B;  1RF1 A;  1VQP P;  1LT9 C;  1NTZ G;  1L0H A;  3CX5 E;  3CMA P;  2H43 A;  1RQV A;  1IK7 A;  1VQN P;  1ACP A;  2WTY A;  2IBZ I;  4PJ0 H;  4W80 A;  5HGO A;  2QJP B;  5AW5 B;  4DJG A;  2XZ0 D;  3C1L A;  2LOL A;  3O6Q A;  1QRJ A;  4KT0 J;  1ZXG A;  1X22 A;  2OTK E;  4KHX A;  1ZV8 A;  2IX7 C;  1U57 A;  5AVS B;  1UIX A;  1T8Z A;  2OYH A;  3GMA A;  2ZJS E;  2Q7C A;  4U0B A;  1KD1 Q;  1N73 B;  1RF0 C;  1CI6 B;  2K9Y A;  3C9I A;  1QVG O;  1L0N J;  3EQ2 A;  1JCC A;  2YIU C;  2KYV A;  3SFE C;  1VQ4 P;  2OTL P;  2EIA A;  3CC2 P;  1DEE G;  2WVR A;  3H1J J;  3FXE A;  3H32 B;  1SS1 A;  2L91 A;  3PHL A;  3RK3 B;  3HE4 B;  5APX A;  4ZNC A;  1CEI A;  2AVA A;  1SQQ E;  3M06 A;  4JYC A;  1BGY G;  1GK6 A;  2N5H A;  1QLE D;  5HVC A;  4HYT B;  1W2B O;  2KP8 A;  1JMM A;  1EIA A;  2E74 B;  5KAI H;  1KV4 A;  2HOD A;  1AJY A;  3H4E A;  2GUS A;  2E74 D;  3GG2 A;  2N9Y B;  1YBK A;  3KZI H;  1SQQ G;  4I7Z C;  3CWB J;  2CG5 B;  2W6J H;  5CMZ A;  3Q5R A;  1LP1 A;  3S9O A;  2K0X A;  2IBZ D;  1G2C A;  1QEX A;  2H7H A;  2O1K A;  3L73 J;  3JCU H;  1GL2 C;  1SQP J;  2FHS C;  1S72 P;  1SQB G;  1X8Y A;  2D2C B;  1VQM P;  2D2C D;  1NQ4 A;  1L4A A;  2B87 A;  3GHG B;  1IFD A;  3D71 A;  2MD9 A;  3TDK A;  3LRY A;  3USS A;  3TGU G;  5CJ4 A;  3CXH I;  3P8C D;  1P84 E;  5CHX A;  3V4W A;  2IBZ G;  2MJZ A;  1L0N D;  3AEB C;  2KI7 B;  3TK1 A;  1KOR A;  3HD7 B;  3EJD A;  3HTK B;  1MFZ A;  1LTJ C;  3HD7 D;  1NTK E;  1GXH A;  3H1J D;  3HYB A;  3A0H E;  1E79 H;  1OVR A;  3DS4 A;  3H1L G;  1D7M A;  3MUD C;  1RY3 A;  4H0L B;  2PP6 A;  2OYI C;  2ZYA A;  5AW1 B;  4H0L D;  4C7R A;  2HG5 D;  1BAJ A;  3P05 A;  1EMV A;  1T2K D;  2A06 G;  2KZJ A;  2Z5H A;  2I1K A;  3CWB D;  2I1J A;  4DZO A;  1W5C E;  2FVA A;  2JDI H;  3UIA A;  1S2E A;  5B66 H;  4D6T E;  2EHT A;  5AVW B;  4UB6 E;  2KSJ A;  3G0V A;  1QL2 A;  1X79 B;  1Z6M A;  2B88 A;  1CZQ A;  3L73 D;  5AW8 B;  3A0B E;  4GR6 A;  1QX8 A;  1SQP D;  3EJE A;  3HZQ A;  4EI2 A;  3A0B H;  2R44 A;  3O6Q B;  4DOJ A;  1JTH A;  3I55 P;  1OXZ A;  1GTW A;  2ZT9 B;  3M91 A;  3CWB G;  1YTZ T;  5F2K A;  3H1K E;  4DCK A;  1GZL A;  2FYU J;  3I56 P;  2LTE A;  1AV1 A;  2YKP A;  3GF3 A;  3L73 G;  1SQP G;  4MN4 C;  5TIS H;  1JOC A;  2KK7 A;  2PEI A;  2H8P D;  2FBW C;  2IYP A;  2BUO A;  2OQQ A;  1ZR2 A;  3CXH H;  5APW A;  3Q5S A;  1JY2 P;  3RG6 C;  3PP5 A;  1G1J A;  4R4L A;  1DD3 A;  1LT9 A;  3RK2 B;  3SWF A;  4XE5 B;  3G1I A;  3VOP A;  2FYU K;  1EZV D;  2XV5 A;  4IFM A;  3RK2 D;  3AED C;  2OTJ P;  2P2U A;  4HKZ H;  1S1C X;  5KJ7 C;  3M1M A;  2JU1 A;  3WU2 H;  1J1E B;  4N78 E;  1EOQ A;  1VKU A;  1LP1 B;  1NVO A;  4PD4 D;  3CPW O;  1G2C B;  4ASV A;  1A02 F;  2OYO A;  2WPS A;  1QL1 A;  1Y47 A;  4BPF A;  1S3J A;  1KTM A;  3L70 E;  2PEK A;  4H44 B;  1NTM J;  2WPV B;  1PP9 E;  4IFD K;  1HQB A;  4H44 D;  1L4A B;  1LGH B;  3TNU A;  2B87 B;  1X3O A;  1L4A D;  4OGQ B;  1IZN B;  2QJY C;  2C9L Y;  4OGQ D;  2FY8 A;  2MR8 A;  2FYU D;  4XA4 A;  2QG4 A;  2JR8 A;  2JQ4 A;  2FQ1 A;  1VF5 B;  2Z5I A;  1VF5 D;  5KLV J;  1VDF A;  2WIT A;  4I2L C;  3MIW A;  2YMK A;  1JM0 A;  4LC1 A;  2O01 J;  3MGN A;  5AVX B;  2IFN A;  2PEN A;  1PPJ D;  1PEQ A;  1NGM B;  3NFQ A;  3AEA C;  1SQV K;  2R5D A;  3BVH A;  4CPG A;  1E5W A;  1PZQ A;  5CCG C;  2JU2 A;  2POH A;  2VRS A;  1T6A A;  1GL2 A;  2GYK A;  1LT1 A;  3GKL C;  3GZM A;  5KLV K;  1FZE A;  1FOS F;  3V2P A;  1KMI Z;  1ZRT E;  1Q86 Q;  3MD0 A;  2LIW A;  3QWO C;  2HLO A;  2YMY A;  3H1H J;  1VQO P;  3G1G A;  1K30 A;  4Y28 J;  2B89 A;  1N73 A;  2PRR A;  1CI6 A;  1PPJ G;  1SQX K;  3W68 A;  2M3B A;  1NTM D;  2VSQ A;  5AW3 B;  3L74 J;  3AEE C;  1JTH B;  2IZ1 A;  2P10 A;  2K94 A;  4AUW A;  3NY7 B;  3BAT A;  2C9N Y;  2FXM A;  3H32 A;  3EFF K;  1NTZ J;  1IFP A;  2YO2 A;  1LTJ A;  3R4Y A;  2WPQ A;  1S9K E;  1NU1 K;  1JY3 P;  3C8V A;  5APY A;  5AW6 B;  3TSI A;  4YPC A;  1MZ8 A;  3VN0 A;  4WY4 C;  3MUD A;  5GTI H;  2WQY C;  4GOE A;  2MVV A;  5KLV D;  3Q1M A;  5EW5 E;  1L0L E;  3FXD A;  3H25 A;  1OW7 A;  1OW8 A;  3CX5 I;  4H2W C;  2JJL A;  1H0T A;  4IOI H;  4BWN A;  4UHP B;  1MZ9 A;  1EXJ A;  1NHL A;  5EFW B;  1LT9 B;  2E5Y A;  1IFN A;  1SQV E;  1HTL C;  2K9J A;  5KKZ C;  1AQ5 A;  4IL6 E;  3F89 A;  4PH0 A;  2HPC A;  3L71 G;  2O01 H;  1PL5 A;  4EIJ A;  2WSS H;  3H1H D;  1KQF B;  1M57 D;  1RE3 C;  3WUV A;  2JWA A;  2YNY A;  4WB4 A;  2XT1 A;  4U7J A;  2K92 A;  1L2P A;  1BGY J;  3E1R A;  2QVA A;  3RBZ A;  4L74 A;  5TJH A;  3L74 D;  2EG5 A;  3HTK A;  1SQQ J;  3L36 A;  3Q3D A;  1NTZ D;  1RH5 B;  1VQ9 P;  4M3L A;  2YIU B;  4L75 A;  2L4B A;  2Z45 A;  2AXT H;  2M5A B;  2J5U A;  1H8A A;  1NU1 E;  1NJI Q;  2ROQ A;  3EFG A;  4PH1 A;  1NYH A;  5H2F H;  1SQB J;  4R0M A;  2E43 A;  1YIJ P;  1BSN A;  2Y0C A;  1ZLL A;  1H88 A;  1FE6 A;  2P1J A;  3U59 A;  2ERH A;  5HGN A;  4L76 A;  2B9B A;  2VLP A;  3JC2 2;  3E7K A;  2NPS C;  5KJ7 A;  4UB8 E;  3TGU J;  2L9F A;  1KB9 E;  4I7Z B;  2L6E A;  2PY8 A;  5M1B A;  1NAF A;  3CCQ P;  2QIW A;  3S1K A;  1ZN5 A;  3CX5 H;  1SQB K;  4U3F G;  3IF4 A;  1GL2 B;  1AVY A;  4PWV B;  1M8O B;  1DD4 A;  1WMK A;  1GL2 D;  4ZKU A;  5HGL A;  1BXI A;  1FZC C;  2CNR A;  1K04 A;  3H1L J;  5GTH E;  3ABV C;  1P84 I;  3AE3 C;  1ZR4 A;  1BGY D;  2OAR A;  1FZF A;  2CPB A;  2KUB A;  4NPD A;  5KAF E;  2KG8 A;  3D70 A;  1M1J C;  2AEF A;  1SQQ D;  2W90 A;  3CCM P;  1NAY A;  2Q3I A;  3E1I A;  4MRT C;  3B5N C;  1KFM A;  1SLQ A;  1GPJ A;  3DPH A;  5E79 E;  4U0C A;  3L72 E;  1OMI A;  1LTJ B;  3SWK A;  5E79 H;  2GM4 A;  3CI9 A;  5B5E E;  1RE4 A;  3RK3 D;  1SQB D;  3NTE A;  1QGK B;  1M6E X;  5DCK A;  4D6T J;  2GDX A;  1XTG B;  2OYI B;  1JUN A;  4XFX A;  3B4Q A;  1HJ0 A;  4BRY B;  2H89 C;  3DS0 A;  1L0N K;  1LTG C;  1VHN A;  5CCG A;  7CEI A;  3KHU A;  2GA1 A;  2V7Q H;  3H1I E;  4F37 A;  3VTP C;  3TGU D;  1H0T B;  3AE2 C;  1E0H A;  4CA3 A;  2MVU A;  3L4F A;  5APS A;  3VYI A;  2K9J B;  4HB1 A;  4H13 C;  1N7S C;  4ZKP A;  4NEO A;  2HPC B;  2J58 A;  3H1L D;  2JKV A;  1IC2 A;  4LGD E;  5CCH C;  1YQ4 C;  1UII A;  2KGC A;  2GUV A;  4N3Y B;  2IDB A;  3WUT A;  1L0I A;  2GDW A;  3CC4 P;  5CJ0 A;  2BCC E;  3II6 A;  2A06 D;  4DT0 A;  1SQP K;  2Q9I A;  1P84 H;  4WY4 A;  2FFD C;  2W83 C;  4OWF A;  1OIP A;  1T8K A;  1JY3 N;  4QNB A;  3LMO A;  3HRN A;  2P7J A;  3A0H H;  2RMZ A;  1TU3 F;  1KIL E;  3BRT B;  3OAK A;  4D6T D;  1NTK G;  2PGD A;  3PLN A;  3G26 A;  2JP3 A;  2L5G B;  4PV1 C;  1ZME C;  1L0N E;  4HH2 A;  2FAC A;  1GK4 A;  2Q5U A;  1VQ6 P;  1PEU A;  1K9M Q;  3L70 J;  3M0D A;  3WBH A;  3MZW B;  1RE3 A;  2FXP A;  3H1J E;  2FAD A;  5KJ7 D;  4UB6 H;  2FYZ A;  2KWL A;  3BCC E;  3L35 A;  1URQ C;  1FDI A;  3HUS C;  3M9B A;  4D6T G;  1YHQ P;  2LPK A;  5AW4 B;  2Y9Y A;  1MUU A;  2FXO A;  4H2Y C;  1PGJ A;  3CXH D;  2ZT9 D;  1EQ7 A;  1LWU C;  3AE9 C;  4RO0 A;  2QJY B;  2ZXE B;  1KIL C;  1JY2 O;  3V2R A;  5BS2 A;  2P9X A;  3V5B A;  1FJK A;  3H1K G;  1FOS E;  2JGP A;  1YJ9 P;  1LNQ A;  5BVZ A;  1OWA A;  3CCU P;  4TT3 H;  1BCC E;  2P58 A;  1DV5 A;  2ONT A;  3AEF C;  3AE1 C;  1JJ2 O;  3V2Q A;  1LTI C;  2XKM A;  4XRQ A;  2XZ1 C;  3E2D A;  2NPS A;  4U0E A;  1OW6 A;  1HGZ A;  3G3Z A;  1FJP A;  2GZE A;  4WWI A;  2ITA A;  2M8P A;  1KYO E;  2LXB A;  5AW9 B;  1AA0 A;  1FDM A;  1M6N A;  4Z1M H;  2M0B A;  5CCG D;  3RL0 C;  3L70 D;  4YXW H;  3VMZ A;  3MHV A;  1FZA A;  2KGA A;  2FQ0 A;  1Y9B A;  2QNW A;  4N6J A;  1FAV A;  3OJA B;  2W27 A;  1RF1 C;  1VQ8 P;  2QJK C;  1EXI A;  3DTJ A;  2I8D A;  1RF0 A;  1EZV E;  2KIK A;  2LKI A;  3JSV C;  2GZG A;  2M5A A;  1VQL P;  3B5N A;  1MFT A;  1L0L J;  3TF5 A;  2O3J A;  3CCR P;  3SFD C;  3DS3 A;  3L70 G;  1M74 A;  3GF7 A;  1PGO A;  2KG6 A;  1PP9 G;  1JO5 A;  1U7J A;  2KSE A;  4PD4 E;  2OYH C;  2PNG A;  1OR5 A;  3L71 J;  3IR9 A;  3CME P;  4WY4 B;  2N6Y A;  5KTB A;  4COP A;  1VQ7 P;  2JWD A;  4WY4 D;  2WSF H;  1NTM K;  4IFF A;  2KXP B;  1SVF A;  4OH8 B;  4WBA A;  2GZJ A;  2KOQ A;  2A45 I;  1JMB A;  1IMP A;  1RO2 A;  1U7M A;  2XZR A;  2DW3 A;  3RG2 A;  3G6E P;  2PEQ A;  5APQ A;  3OW2 O;  2V4H A;  4XFZ A;  2LML A;  1S5L E;  2FYU E;  1EDJ A;  4GOD A;  2JYG A;  3M9H A;  2IFM A;  4A7P A;  3L37 A;  5KKZ B;  1BE3 E;  5KP8 B;  1Y8A A;  2MY5 A;  1N7S A;  3VP8 A;  1KQS O;  3ITK A;  2AFD A;  1XTC C;  3CCS P;  2YKO A;  1J2J B;  3CCJ P;  4O9B A;  2LL8 A;  1PEM A;  1DEB A;  1RO0 A;  1PEO A;  2DGY A;  1YTZ I;  1GU4 A;  2N98 A;  1PV3 A;  1S9K D;  3GZL A;  2K1A A;  2R3C A;  4K3A A;  2OGU A;  1YJN P;  1AQT A;  2Z44 A;  3R2P A;  2E75 C;  5AVR B;  2SPZ A;  3S4R A;  2E76 C;  1L0L D;  5AVZ B;  2WT7 B;  5BU5 A;  1LTA C;  4GOF A;  2JAZ A;  1KZU B;  2BEZ F;  3N7N A;  1MV8 A;  3NMD A;  1NWQ A;  4BPH A;  1L4A C;  1QVF O;  4U3F J;  2K88 A;  3L71 D;  1FR2 A;  1S4X A;  2OYI A;  4B86 A;  4BRY A;  3VMA A;  3L75 E;  2KS1 A;  1KB9 I;  3WUU A;  1LTS C;  2XND H;  1NTZ K;  2AXC A;  2ZVO B;  2K37 A;  1OFC X;  1L0L G;  2PEM A;  3A5T A;  5AW2 B;  1JNM A;  1GW3 A;  1G1I A;  2NPS B;  2AFE A;  2NPS D;  2KGE A;  2A45 H;  1IFJ A;  4BXL A;  1YJW P;  1AFO A;  2Y9Z A;  2Y0D A;  4IL6 H;  1M56 D;  1URQ A;  5KLV E;  3HUS A;  4XFJ A;  2A45 G;  1SQV G;  3AE7 C;  2QA4 P;  2KW2 A;  3HE5 A;  1FZC B;  4WVZ A;  2HR3 A;  1JCD A;  1EC5 A;  1JB0 J;  2UWJ E;  2N1T C;  2R3S A;  1LWU A;  5DJU B;  3L72 J;  1KIL A;  1SQX E;  2M3E A;  1GXG A;  2KOO A;  1GDT A;  2PAJ A;  1M1J B;  3CXC O;  3U1C A;  4DG9 A;  3LW5 H;  3B5N B;  4H2X C;  1MKM A;  3AE4 C;  4YTP C;  3B5N D;  1D1D A;  2V7Q J;  3H1H E;  1BSH A;  1NO4 A;  2BQ1 E;  4U3F D;  1YQ3 C;  3H1I J;  2WPR A;  1OZH A;  2LR2 A;  1KB9 D;  3CX5 D;  4BPG A;  1HBW A;  1FZB A;  2WZ7 A;  3KQG A;  2IYO A;  4XFY A;  2K2Q A;  1SQQ K;  1GW4 A;  1NU1 G;  1Q82 Q;  3L74 E;  4RJT A;  4KJM A;  4ASW A;  2VLN A;  1HH0 A;  2L22 A;  4W7Y A;  1PFI A;  2O1J A;  5K5G B;  1NTZ E;  4JQ0 D;  2XNX A;  3V4Q A;  4UB8 H;  3V6I A;  3SSU A;  1NOH A;  1KB9 H;  2LXC B;  4EOT A;  1LTT C;  1IO4 A;  2KOS A;  2KB7 P;  1NH4 A;  3I5C A;  1JEK A;  1VQ5 P;  4U0F A;  4HKG A;  2ZYG A;  3DS2 A;  1HVV A;  3QH9 A;  2BCC J;  5APU A;  3U43 A;  3KYQ A;  4EDF A;  4H13 B;  3DS1 A;  1N7S B;  3B5I A;  4PJ0 E;  2HYN A;  4EYY Q;  4H13 D;  1N7S D;  1GU5 A;  4I6M C;  5GTH H;  1SFC C;  5AVV B;  2YXQ B;  1SP4 A;  4LLH A;  5CCH D;  1NTK J;  2LIU A;  3L72 D;  3N4X A;  2LF4 A;  1DH3 A;  1EDL A;  2FYN C;  2NRG A;  4JBZ A;  4NPE A;  1F80 D;  2IPP A;  3FWL A;  5KAF H;  4COC A;  2N50 A;  2VLQ A;  2NO8 A;  5KP7 B;  2ZVN B;  1J1D C;  1M1K Q;  1A02 J;  1A8O A;  2FFD B;  3BRV B;  3IN6 A;  4NPF X;  3AE8 C;  3CCV P;  3IAO A;  4C7N A;  1AVO A;  3Q20 A;  3H1I D;  1IK9 A;  1NTK K;  5B5E H;  1BGY E;  3H6P A;  5CBN A;  5AW0 B;  1DIP A;  3L72 G;  2E5T A;  2KS1 B;  1N2D C;  2Q1K A;  3BCC J;  2X2B A;  4PV1 B;  1FU1 A;  5KLI C;  5KAI E;  5AVU B;  4Y99 C;  4PV1 D;  2R5B A;  3MGE A;  2YXR B;  3KZI E;  2FVF A;  4GDO A;  4U0D A;  2P67 A;  1NKZ B;  2BAS A;  1KFN A;  2CPS A;  3H1I G;  3RK3 E;  3H1K J;  1SQB E;  2WSE J;  2BCC D;  1Z56 A;  2M8R A;  3AEG C;  2NZ2 A;  1P84 D;  2N9B A;  1URQ B;  3PRJ A;  3JCU E;  3HUS B;  1BDD A;  2QJP C;  1URQ D;  1UNK A;  2L0Q A;  1S5L X;  2XXM A;  1OVV A;  2K5X A;  3KDP B;  3CCL P;  2W8Z A;  3HE5 B;  1HF9 A;  2PEJ A;  1NTK D;  3TGU E;  1Q90 D;  1LWU B;  1BCC J;  3PH0 A;  2IBZ E;  4QMA A;  2J59 M;  3PTZ A;  1KIL B;  1EDI A;  4I1L A;  1KIL D;  1N73 C;  3Q5P A;  3NTN A;  5AVT B;  2BCC G;  3SWY A;  2K93 A;  2KNC A;  2ZXX A;  4IZ6 A;  3NXS A;  3H1L E;  1FC2 C;  4WYM A;  2GZI A;  1KYO I;  2Z4E A;  2KOG A;  2AF8 A;  2E1M A;  3T97 B;  1WT6 A;  3A7O A;  1LJ2 A;  3B4S A;  3RK3 C;  3P8C E;  4RES B;  2KOR A;  2A06 E;  3RGU A;  3BCC D;  2CK3 H;  1VQK P;  2E74 C;  3LID A;  2JEE A;  3CL3 D;  1HJB A;  2Y0E A;  3RL0 B;  3W67 A;  3FWN A;  3FGA D;  1HUC A;  1PP9 J;  3RL0 D;  2GDY A;  2KR5 A;  3CCE P;  1EZV I;  3VMY A;  1ZW0 A;  1L0N G;  2W6A A;  1HWT C;  3H1K D;  5B66 E;  3IFM A;  2N1T A;  1NKN A;  3VMX A;  1IJD B;  2KZI A;  1RF1 B;  2KOD A;  2QJK B;  2FVE A;  4JPZ B;  3H1J G;  1Q81 Q;  2QM8 A;  1FBM A;  3VRL C;  4JF7 A;  3B71 A;  2WT7 A;  4IL6 X;  2WSF J;  3BCC G;  2D2C C;  3CWB E;  2RH0 A;  2QEX P;  2CQ8 A;  4PD4 I;  2EFJ A;  1BCC D;  1ZP0 C;  3GHG C;  2WSE H;  1USD A;  1T3U A;  3EJB A;  2WMM A;  3KPE A;  3L73 E;  1A43 A;  1AUM A;  1SQP E;  1X0T A;  1DNY A;  2YKQ A;  2QE7 H;  2OYH B;  2G8Y A;  5C39 A;  3G71 P;  1R5L A;  4TLF A;  1KYO D;  3B8E B;  3BAS A;  5AW7 B;  3HD7 C;  5TIS E;  2EHS A;  2FKW B;  5HV8 A;  1BE3 J;  1OX3 A;  4C7N B;  3CXH E;  5L8R J;  4N78 D;  1KQG B;  1CW5 A;  2IZ0 A;  3K5B A;  1BCC G;  2HFE D;  4H0L C;  2ZYD A;  2JO0 A;  5APV A;  1M90 Q;  1KYO H;  1T2K C;  2XV6 A;  1FZC A;  1M7L A;  3D6Y A;  1PP9 D;  1RHZ B;  3CC7 P;  1E6J P;  2K0Y A;  3PJS K;  2HOD B;  1N86 A;  3WU2 E;  2Z46 A;  1SFC A;  2E42 A;  1H89 A;  2MR7 A;  1IMQ A;  1WRG A;  4M0I A;  3G21 A;  3VP9 A;  3OA7 A;  1Q7Y Q;  1M1J A;  2DNW A;  3D6Z A;  4GT1 A;  4GIF A;  3H47 A;  4YXD C;  5EJD A;  4XRO A;  5DJT B;  4U0A A;  2E75 B;  3L75 J;  1ZOY C;  5BU8 B;  1HY8 A;  5AVY B;  4C46 A;  3V2N A;  1USE A;  2E75 D;  2E76 B;  2JBG A;  1EZV G;  2ZT9 C;  3AE6 C;  2E76 D;  2Q3E A;  2CGQ A;  5APT A;  2KGD A;  3P32 A;  3AEC C;  4PD4 H;  4HJG H;  4PXH B;  1W2E A;  1SQV J;  1UJZ A;  2K0D X;  2AEM A;  2KNC B;  2G3A A;  3H0D A;  1L0L K;  1BE3 D;  2QM7 A;  2ZAE B;  5F2O A;  1ZRT D;  2RN0 A;  3P8M C;  1FZG A;  3RK2 C;  1BDC A;  1RE4 C;  5I4T G;  1S5L H;  2CWO A;  1YI2 P;  1EDK A;  2WWW A;  3Q2Y A;  1SQX J;  2WSC J;  5CCH A;  5BS1 A;  2FYU G;  4OVN F;  2KLU A;  1N7L A;  1FS0 E;  3LW5 J;  4AQR D;  1BE3 G;  1J1E C;  1PGP A;  3M9Q A;  3KXD A;  1PPJ E;  1OVU A;  1ZNV A;  4W7Z A;  1JY3 O;  2JO1 A;  2N1T B;  1NU1 J;  2N1T D;  2JYL A;  2ZFC A;  2FAE A;  1LTB C;  2FFD A;  5JPA A;  1K05 A;  4K35 A;  3L75 D;  1PIX A;  2N5I A;  1YYC A;  1RNI A;  2XU6 A;  4H44 C;  5CZD B;  1RQU A;  1FDO A;  2MKV A;  2M5R A;  4GKG A;  2KLV A;  3MP7 B;  2XDJ A;  4OGQ C;  1VL2 A;  3ZDM A;  2RKL A;  3CLQ A;  1SQV D;  3MTU E;  2YO3 A;  1VF5 C;  2H88 C;  3HE4 A;  5GTI E;  5HGM A;  2BEQ D;  1CSB A;  3P7K A;  1IFM A;  1NTM E;  2GZF A;  2AEJ A;  3G29 A;  1K8A Q;  1VPC A;  1GMJ A;  5KP6 B;  1KLP A;  2M8N A;  3M0A A;  3L75 G;  2FQ2 A;  2PEO A;  1X9V A;  4AYC A;  3A3Y B;  3CE7 A;  3U1A A;  1AYI A;  2PFX A;  3GJN A;  1IFI A;  1K73 Q;  1R8E A;  2O01 N;  1NTM G;  2QSI A;  1GD2 E;  3L71 E;  1IUQ A;  2C0W A;  2C0X A;  3G28 A;  4RKU J;  1ZMB A;  1SQX D;  3F5H A;  2Q6Q A;  3AE5 C;  2M8L A;  5F2N A;  3TYY A;  2K3R A;  2KOP A;  1SFC B;  5KLV G;  1PGQ A;  4QKO A;  3M0D C;  2KG9 A;  1SFC D;  1NU1 D;  2N6Z A;  3GHG A;  2FYN B;  1Q2N A;  1KN7 A;  1T3J A;  3CD6 P;  1AF8 A;  2WSC H;  2BHV A;  3GW6 A;  1DX7 A;  1J1D B;  5CBO A;  3DS5 A;  4JYB A;  1R5S A;  3RBX A;  4R4M A; 
#chains in the Genus database with same CATH homology
 1RNI A;  4U0D A;  3CC4 P;  3G1I A;  2EIA A;  4COP A;  5BS2 A;  2P9X A;  1VQ7 P;  3CC2 P;  2KOD A;  3H47 A;  4XRO A;  2OAR A;  2OTJ P;  1Q81 Q;  4U0A A;  1BAJ A;  1YJ9 P;  2PEM A;  3VRL C;  1RO2 A;  1Q86 Q;  2XT1 A;  3P05 A;  3CCU P;  1VQ5 P;  4U0F A;  1VQO P;  2QEX P;  3G6E P;  3DS2 A;  1N8R Q;  2PEQ A;  3G1G A;  1K30 A;  3M1M A;  2ONT A;  3OW2 O;  2EFJ A;  1W2B O;  3G4S P;  3CCM P;  1YJW P;  2XXM A;  1JJ2 O;  1EIA A;  3DS1 A;  4XFZ A;  3B5I A;  1EOQ A;  4QNB A;  4XRQ A;  3CCL P;  2PEJ A;  3E2D A;  3H4E A;  5HGM A;  3DPH A;  4U0E A;  2EG5 A;  3CPW O;  2JYG A;  3G29 A;  4U0C A;  1K8A Q;  4GR2 A;  1A43 A;  1AUM A;  2M8N A;  3G0V A;  2M8P A;  4IPY A;  2QA4 P;  1VQ9 P;  2PEO A;  1KC8 Q;  3H0D A;  2LF4 A;  2Z45 A;  4GR6 A;  3G71 P;  1YIT P;  3HZQ A;  1KQS O;  1M6N A;  3CCS P;  2PEK A;  3G26 A;  5F2O A;  1K73 Q;  3CCJ P;  1VQP P;  3NTE A;  1M6E X;  1NJI Q;  5DCK A;  4COC A;  4PH1 A;  1PEM A;  4XFX A;  3CMA P;  1RO0 A;  1PEO A;  1M1K Q;  2DGY A;  1S72 P;  3DS0 A;  1A8O A;  3I55 P;  1YIJ P;  1VQN P;  1IUQ A;  1VQ6 P;  1PEU A;  1K9M Q;  4WYM A;  3WBH A;  1VQM P;  3G28 A;  5HGO A;  1ZMB A;  5I4T G;  3CCV P;  3CXC O;  2CWO A;  1VQ8 P;  1QRJ A;  5F2K A;  1YJN P;  2E1M A;  3DTJ A;  2Z44 A;  5HGN A;  3Q20 A;  2JO0 A;  1YI2 P;  2M8L A;  5F2N A;  1M90 Q;  3I56 P;  1D1D A;  3LRY A;  5BS1 A;  2BQ1 E;  2XV6 A;  2L6E A;  2PY8 A;  1YHQ P;  3CCQ P;  1VQL P;  1VQK P;  1QVF O;  4U0B A;  2PEI A;  3CC7 P;  1KD1 Q;  1E6J P;  2BUO A;  3CCR P;  3DS3 A;  1M74 A;  3CD6 P;  2PEN A;  2Z46 A;  2BHV A;  4XFY A;  1PEQ A;  2JYL A;  3RG6 C;  3CCE P;  1QVG O;  1Q82 Q;  3DS5 A;  5HGL A;  4PH0 A;  4M0I A;  3MGE A;  3G21 A;  3HYB A;  5JPA A;  2OTL P;  1VQ4 P;  3CME P;  1Q7Y Q;  3DS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...