1VQPP

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqpP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqpP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqpP02
3CCUP 3CMAP 1VQ5P 1KC8Q 3CCLP 2OTJP 1VQ6P 3CCQP 3G4SP 3I56P 3CCJP 1YJWP 1Q7YQ 3CXCO 1KD1Q 1QVGO 3CPWO 3CCEP 1M1KQ 1VQ7P 2QEXP 1K9MQ 3CMEP 3CCVP 3G71P 1N8RQ 3CD6P 1Q82Q 1VQKP 1QVFO 2QA4P 3I55P 1VQPP 1YHQP 3CC7P 1YIJP 1VQOP 1VQ4P 1VQ9P 3CCSP 1S72P 1VQ8P 1YJ9P 2OTLP 1M90Q 1YI2P 1Q86Q 1VQLP 1VQMP 1VQNP 3CCRP 3G6EP 1K8AQ 1NJIQ 3CCMP 1K73Q 3CC2P 1W2BO 3CC4P 1YITP 1KQSO 1JJ2O 1Q81Q 3OW2O 1YJNP
chains in the Genus database with same CATH superfamily
2JU1A 2FAEA 1Q7YQ 3S1KA 5APVA 4UB6H 3GF3A 3HTKB 4PV1B 5EFWB 3RG2A 4I6MC 4MRTC 1E79H 1YTZI 2UWJE 2OYIA 1P84D 4K35A 3H1JE 1NHLA 1SQVJ 1NTZD 2IZ0A 4JYCA 2Q9IA 1N7LA 1GW3A 2QA4P 2L9FA 2EG5A 1P84H 1A02J 3G26A 3G1IA 5KLVJ 4W7ZA 2LKMA 3H1KG 2K3RA 4JF7A 3VMXA 5AW6B 1RF1A 1NJIQ 5BU8B 2XZRA 3EWKA 3DPHA 1SQPK 3F5HA 2N9BA 1IJDB 1OXZA 1L0IA 1OX3A 3M1MA 2N98A 2VRSA 1PZQA 1AVOA 2N5IA 2H88C 2ZYGA 2W8ZA 2FQ1A 2K0XA 2FQ2A 5E79E 5DJUB 2KP8A 5AVSB 3DS3A 1GL2D 2Y9ZA 2N50A 4JQ0D 3L75J 1AQ5A 4PV1C 4RESB 1NVOA 5APUA 2CGQA 3M91A 5GTHE 3R2PA 3L73E 1SQQK 1VQMP 1NKNA 4PJ0H 1IZNB 2ERHA 3CCMP 5CCGD 1JJ2O 2BEQD 2FYNB 3AE2C 1DEEG 2C9LY 3L74D 1SP4A 1BE3J 1MFZA 2L6EA 2QJYB 3N4XA 3DS4A 2IDBA 5AVXB 1S2EA 2EFJA 4XROA 2M0BA 2OYHB 5EW5E 3CXCO 3E1IA 1RHZB 1QEXA 2LF4A 1BDCA 1NU1K 1YHQP 2IBZD 3L36A 1KQFB 2Y0DA 2ZJSE 3AE5C 2E5TA 4GOFA 1XTCC 1N7SD 1EQ7A 1KC8Q 2N1TD 2OQQA 3CXHD 3H32B 2JGPA 2Y0CA 1PGQA 3RK3E 1H0TA 2JO1A 5CCHC 2E5YA 1X8YA 2L4BA 1KZUB 1AFOA 3KZIH 1HBWA 3JSVC 2Q1KA 3CXHH 3LW5H 4AYCA 1A43A 1FJKA 3B4SA 1HY8A 1S3JA 3AEFC 2AEMA 4XFZA 2LKIA 4U3FJ 5KAFH 3USSA 2QJYC 3HD7B 1BAJA 1LJ2A 1CI6A 2ONTA 1R5SA 3Q20A 2JYGA 1SQBK 1PEUA 4GR2A 3IF4A 2OYHC 1L0NJ 4COPA 2ZXXA 1ZRTD 1KB9H 2YIUB 3CX5D 1ZMEC 5APQA 1PPJG 2BASA 1KYOE 1BCCD 2XU6A 1YQ3C 2DW3A 5BVZA 5DCKA 1WMKA 4KJMA 3RBXA 4OH8B 3CCRP 2N5HA 2KI7B 3CX5H 1AV1A 2FADA 1Q81Q 3I56P 3OW2O 1NTZE 2FFDB 3BRTB 1FOSF 3E7KA 4GR6A 1K9MQ 1NTMK 2QJKB 1L0LJ 3NTNA 4IL6H 4Y99B 2KS1B 3U1AA 3NXSA 2JYLA 2Q3IA 5GTIH 4EIJA 4OVNF 2KG8A 4BPHA 1IK9A 3HD7C 1HF9A 4DG9A 1KMIZ 1JUNA 1AF8A 2CQ8A 3AEDC 2R5DA 2P2UA 2LR2A 2KK7A 1JY2N 1E6JP 2BCCJ 2JP3A 3L4FA 2B88A 2LIUA 1PP9G 4GOEA 1LGHB 4W7YA 1NH4A 2CG5B 1LTIC 3CPWO 1KFNA 1QL1A 4MN4C 5AVQB 2BHVA 5AW0B 2M8NA 3H1LJ 2CPBA 2O1KA 4WY4B 3I55P 3RK3B 3CC7P 2E42A 2E74B 1QL2A 2XDJA 1VQOP 3TSIA 5AW2B 2W6BA 1YI2P 3HTKA 3G0VA 2AXTH 1YYCA 4D6TD 5AW8B 5EJDA 2MJZA 2QJKC 3TNUB 3NMDA 3L70J 3VOPA 1VL2A 4Y99C 4H44B 1SQPD 2IYOA 2H89C 3L75E 3ITKA 2JO0A 4PH1A 5B5EH 1JNMA 3H1JJ 2R3SA 4A7PA 5JPAA 1JEKA 3QH9A 1LWUC 5AW5B 2OGUA 1H89A 3H1HJ 1LT1A 1KD1Q 2K0DX 3EJDA 2IBZE 2QVAA 1LTBC 1GDTA 4AUWA 1EZVI 2KLUA 2OTLP 1BGYD 1K05A 3KZIE 5H2FH 1K8AQ 1BE3E 1X22A 1E5WA 3FGAD 1OW7A 1OFCX 4YXWH 4QNBA 1A8OA 1NTKG 1Q2NA 4UB8H 1SQQD 4WY4C 2AEFA 2PEKA 1NU1J 2K9JA 5CJ0A 4PXHB 1HGVA 1M1JB 3G28A 2C9NY 3B71A 5KJ7D 2V7QJ 2FVAA 1T2KD 5AVUB 3AEAC 5CCHA 4NPDA 3CWBD 3AECC 2B87A 4TLFA 2IFMA 1T3JA 3RK2D 3L73J 1OW6A 3GG2A 1KQGB 3TGUD 1NQ4A 3WUVA 3L35A 1EIAA 2NZ2A 1GL2B 3H47A 1VPCA 1ZMBA 2KSEA 3CX5E 2MVVA 1QVGO 2WMMA 2FYZA 3L71G 2VLQA 1N8RQ 2Z46A 2H7HA 2WPRA 2OYHA 4U0CA 1QLED 1EOQA 2DGYA 1AQTA 2W6JH 1RO2A 1YQ4C 2E75D 1OW8A 3VTPC 1SLQA 2M8LA 5AW3B 2P10A 2Z5HA 3Q5SA 1JCCA 3V4WA 4BWNA 1M1JC 1VF5C 1L0NE 2GZIA 1GPJA 3A5TA 2FXPA 2A06G 3SWKA 1FZFA 5AW1B 3RGUA 2JB0A 2NPSD 2FXOA 4BRYA 1SQBD 2VSQA 2GZFA 1WT6A 2YMKA 2WPTA 2PENA 2ROQA 2JU2A 2K1AA 1J1EB 2PAJA 1GL2C 2KOQA 3HD7A 4YXDC 1GW4A 2JJLA 2PRRA 5CZDB 2P67A 4UHPB 1N7SB 2JDIH 1ZOYC 2N1TB 3H1IG 3MTUE 5TJHA 2KZJA 2HYNA 3L72J 4H2XC 3FWNA 1SQXJ 4WY4D 5CCGC 4D6TE 2G3AA 5APTA 4L75A 2E76D 3JCUE 1SQPE 2KOSA 2KSJA 2PGDA 2BCCE 2XNXA 1VQ7P 4M0IA 3NTEA 1MV8A 2KUBA 2MY5A 4NPEA 2FFDA 3U1CA 3H1LE 1NTZJ 2GA1A 2IFNA 1EXIA 2JEEA 2Y9YA 2KS1A 3NY7B 3AE3C 2WPSA 4BPFA 5AW9B 1J1EC 2O1JA 5TISH 5F2OA 2QE7H 4UB8E 5BS2A 2J58A 1G2CA 1BGYE 4M3LA 1GZLA 3L70E 2FY8A 1LWUA 1EC5A 1N7SC 5B66H 3BCCD 1SQQE 2N1TC 1DX7A 2XZ1C 1KQSO 3RG6C 2FHSC 5APYA 3WUUA 3ZDMA 2WVRA 1EDKA 1PIXA 1SQVG 1VKUA 2PEMA 1CZQA 2IPPA 3AEGC 3G21A 2WWWA 3H1HE 3WUTA 1VF5D 2KGEA 2R32A 1M90Q 5KLVG 4WY4A 3CWBE 1SFCD 1MKMA 2KNCA 3GJNA 1KQLA 2WSEH 3M9HA 4N78E 3HE5B 2PEJA 4N6JA 1NAFA 3FX0A 4H0LD 1OZHA 3VMZA 1VDFA 1KILC 1DV5A 1VQKP 2CWOA 3TNUA 2FYUG 4HB1A 5BS1A 1NU1E 3FXDA 1BSHA 2MF4A 2FXMA 4LGDE 3Q1MA 2N9YB 1W2BO 3L74J 1URQD 5BU5A 2K9JB 2PEQA 4DZOA 4GKGA 2KODA 2GUSA 2B9BA 1IMQA 1KYOI 5HGNA 2AXCA 1LTJB 3V5BA 3V2RA 1FDIA 2YKQA 2KWLA 2B87B 1ZR4A 3AE6C 4YPCA 5APSA 3H1KD 2LOLA 2R44A 2PEIA 2ZT9D 4WYMA 4H2YC 1QX8A 1ZN5A 2CK3H 2I1JA 3LW5J 1BE3G 4K3AA 1M1JA 3AE8C 1SQBE 2FYUD 3FWLA 1M74A 2YKPA 2K0YA 1RE3C 3BASA 3GLMA 3HUSB 2AEJA 5AW7B 1MFTA 3AE7C 3SWYA 1U7JA 3A0HE 3D6YA 4DJGA 1YBKA 3BVHA 1QVFO 3BATA 3MGNA 4WB4A 1MZ8A 2QG4A 4IL6X 2ZAEB 4EDFA 1W5CE 2EIAA 1NTKK 3DS0A 1GL2A 3K5BA 2KOOA 2IYPA 1LTJC 1M1KQ 3LIEA 2KG9A 1IFDA 4JBZA 3MUDC 1NTME 2XKMA 3T97B 1LP1A 2JQ4A 1KFMA 4BRYB 4B86A 1NKZB 1BCCJ 4R4LA 1TU3F 3N7NA 2CPSA 3KPEA 4L76A 2WSFH 5CCGA 2D2CC 4U3FG 3RK2B 5APXA 1KB9D 3V4QA 4UB6E 2YNYA 4PD4D 1KILD 4JYBA 3L72E 1SQXE 3HUSC 4C7RA 2J59M 2AF8A 2IBZI 2PFXA 4PD4H 4TT3H 3A2AA 3O8ZA 1FJPA 1PGJA 4XFXA 3SFEC 2Z44A 2O3JA 3B8EB 2VLPA 3CCSP 3BCCE 4EOTA 1VHNA 1P84E 5AVVB 2E75B 4C7NB 1S9KD 1S1CX 3P8CD 3Q5RA 1D7MA 3GHGC 5KAIH 2KIKA 1N7SA 5KJ7C 2L0QA 1AVYA 3D71A 2N1TA 1GXHA 3WU2H 1T2KC 1EZVG 1UJZA 3FXEA 1L0LG 3M9BA 1JO5A 1KV4A 3EJBA 1FE6A 3B5NC 1Q90D 1IFIA 2WQYC 1L4AC 1PEQA 1KTMA 2NPSB 2PEOA 1G2CB 3RK2C 1LTTC 4NEOA 4H2WC 3KHUA 4D6TJ 4IOIH 1LWUB 2YMYA 2L91A 1L2PA 1XTGB 2P9XA 5KP8B 2GDXA 1PPJD 4WWIA 1SQPJ 4ASWA 4O9BA 1JY2P 1GXGA 2A45I 1FC2C 4BXLA 3CX5I 2IZ1A 2BCCG 1PL5A 1KILA 4PJ0E 4BPGA 4GT1A 2FBWC 2R5BA 2NO8A 3U59A 2MR8A 4W80A 3G71P 2WPQA 1S5LX 5C39A 2Q7CA 3H1LG 2E75C 2C0WA 5KLIC 2KNCB 4U0FA 4HKGA 1DD4A 1IFJA 1Q86Q 1ZR2A 1PGOA 5KP7B 3PJSK 2E76B 2W90A 3H1KE 2M8PA 3F89A 2POHA 1BGYJ 1EXJA 3L74E 3O6QA 3L70G 1UIIA 2PP6A 2K94A 4ZNCA 2KOGA 1SQQJ 2D2CD 2KOPA 1FOSE 1FR2A 1SS1A 2NPSC 3A0BH 2HODB 2KZIA 1FDOA 3H1JG 1OR5A 3OAKA 3M9QA 3CCEP 1KN7A 3H1HG 2AFEA 1AA0A 1PP9D 5AVWB 3HE5A 3CWBJ 4L74A 3AEBC 1JY2O 3JC22 1RE3A 5M1BA 2P58A 3G6EP 2WSCH 3TGUJ 2FVEA 3CXHE 3C8VA 4XA4A 1GK6A 5HVCA 2RKLA 1N86A 2PNGA 3PH0A 2KW2A 3VMAA 1M6NA 1NOHA 1SQVK 4JPZB 5KAFE 1OVUA 3BRVB 2VLNA 2E76C 1VF5B 1YTZT 5KLVK 4GIFA 3P05A 1E0HA 1LTJA 1SFCB 1X79B 2G8YA 1LNQA 3MUDA 1S5LH 4NPFX 1M6EX 2LIWA 3B5ND 1L4AD 1OMIA 1CSBA 4H0LB 2QEXP 1RQVA 1KB9E 4PD4E 3CI9A 1KILE 3L73G 1VQPP 4LLHA 2DNWA 2FYUK 1QGKB 4DOJA 2J5UA 1HTLC 3I5CA 4DCKA 4WBAA 2M5RA 2GZJA 3VRLC 1ZRTE 3KQGA 1FZAA 3GZMA 3H0DA 1URQB 3RL0C 5AW4B 3II6A 2BQ1E 1DEBA 1LP1B 1BCCE 5CMZA 1NTKD 5AVZB 1L0HA 3HUSA 5KAIE 5DJTB 3IN6A 3V2QA 1SQBJ 4I1LA 3P8MC 3R4YA 4ZKUA 4ZKPA 4XFYA 3WU2E 4IL6E 4LC1A 2X2BA 1S9KE 3P8CE 1IUQA 5GTIE 1M56D 2EHSA 1HJ0A 5E79H 3P32A 3CCVP 3G29A 3TK1A 2ZT9B 2KB7P 3AE1C 1BSNA 1K30A 5CJ4A 2QNWA 2K93A 1SFCC 3KXDA 1DH3A 2N6YA 2H8PD 2Y0EA 3T97A 3MGEA 3GHGA 1JY3N 4H0LC 5KJ7A 1RY3A 1HGZA 2M3BA 3EQ2A 2E43A 1NTMJ 1CEIA 2XT1A 2YO2A 5GTHH 2R3CA 1AJYA 1IMPA 1T3UA 3B5NA 1ZNVA 1RE4C 1PPJE 3NFQA 1L4AA 5AVRB 3L71D 1URQC 2MD9A 3L37A 4XE5B 3SFDC 2AXTE 2O01H 2P7JA 1H88A 3AEEC 1AUMA 3LRYA 1JM0A 1SQXG 3D70A 2I1KA 3PRJA 1W2EA 3ABVC 3DS1A 1J1DB 2ITAA 3GF7A 5B5EE 2AVAA 3A0BE 3IAOA 2A06D 4C7NA 2ZT9C 3BCCJ 3CD6P 1PGPA 1NWQA 2LXBA 3V6IA 2VLOA 1KILB 2M5AA 1RH5B 1GMJA 4QMAA 3LIDA 1QRJA 1NTZG 2MKVA 2WSEJ 3DTJA 5H2FE 1VQ6P 1U7MA 3RL0D 1NAYA 3PHLA 3S9OA 2NPSA 2OYOA 2GDYA 5I4TG 3H1ID 2GZGA 1FAVA 1SVFA 5APWA 2LL8A 4QKOA 1HJBA 3H4EA 3OA7A 2JBGA 4F37A 3O6QB 4I2LC 2GDWA 1EDIA 1S5LE 3B4QA 1N73C 1HWTC 1HVVA 1KYOD 3DS2A 1L0LK 1J1DC 1K04A 4H13D 5KKZB 3CLQA 1IO4A 2HLOA 2Q3EA 2XNDH 3TGUE 1KYOH 3A7OA 3SWFA 1LT9B 2KG6A 3H1KJ 3KDPB 1OWAA 3VMYA 1FDMA 1VQNP 3GKLC 2N6ZA 2WSSH 3L74G 3G4SP 2HODA 2FQ0A 1NTKE 1Y9BA 1ZW0A 3TF5A 3L75G 3QWOC 2FYUJ 2WT7B 3W68A 1HUCA 1FZCB 1P84I 1VQ8P 1SQVD 4GDOA 3HE4A 1NO4A 4OGQB 2WITA 3PTZA 5KP6B 5KLVD 2IBZG 3SSUA 2QRXA 3A3YB 3MZWB 2YKOA 1JMMA 1G1IA 4GODA 2HG5D 2B89A 5KKZC 2D2CB 1NYHA 5L8RJ 3KYQA 3GMAA 1T8KA 4PH0A 1D1DA 4XRQA 2WSFJ 3CCQP 3H25A 1LT9C 1SFCA 2WTYA 2Z4EA 3L71E 4HKZH 1F80D 1Z56A 3L75D 5CBOA 1MUUA 1CW5A 3MD0A 3DS5A 2KGCA 1RNIA 1T8ZA 1YJNP 1FBMA 1RE4A 3VP9A 1FZCC 1X3OA 1URQA 1Y8AA 3C9IA 3AE9C 2M8RA 2BEZF 2XV6A 1VQ9P 3C1LA 4OGQC 3GHGB 1DD3A 2GM4A 2ZVNB 2A45G 2WZ7A 2K88A 2A06E 4R4MA 1BE3D 3CCLP 1BCCG 4CA3A 3B5NB 3Q3DA 1RF0C 3E2DA 1L4AB 5TISE 4IPYA 1S4XA 3E1RA 1USDA 2L5GB 4IFFA 2FYNC 2Q6QA 2XV5A 2GYKA 5B66E 1M57D 2KORA 1L0NG 1OVRA 2LXCB 4RO0A 1ZP0C 3H1IE 2W83C 1A02F 1Q82Q 2K37A 4IFDK 1AYIA 5HGLA 5HGMA 1EMVA 3OJAB 3M06A 3CXHI 5KLIB 5F2NA 4RJTA 3EJEA 3G9RA 5HV8A 4IFMA 1DNYA 3VP8A 4AQRD 2K5XA 4U0AA 4PV1D 2M5AB 1Z6MA 2LTEA 4U0DA 4ASVA 4U3FD 2A45H 2C0XA 2P1JA 1JTHB 1R5LA 3U43A 1N73A 2OARA 3WMM0 4L73A 2ZVOB 2E1MA 1J2JB 1KB9I 4PD4I 2K92A 1ZV8A 2LPKA 4D6TG 1L0ND 2MVUA 2AFDA 5F2KA 1IK7A 4HYTB 3TYYA 1UNKA 1SQPG 1LTSC 3PP5A 4U0BA 4U0EA 1JB0J 2YO3A 3P7KA 1FZBA 1GD2E 1Y47A 1GU4A 1SQVE 2HPCA 2HFED 2OYIB 2YXRB 4HH2A 1H8AA 1SQXK 2WSCJ 1VQLP 2RN0A 2LMLA 3LMOA 2YIUC 1PP9J 2I8DA 4OGQD 5KLVE 1EZVD 3HYBA 2QIWA 1L0LD 2XZ0D 3D6ZA 4ZMDA 3Q5PA 1BGYG 1FU1A 2ZYAA 3M0DC 5AVTB 1RF1B 3M0AA 5CCHD 1IC2A 1G1JA 2FYUE 1SQQG 2FFDC 2KGDA 4OWFA 1NTZK 1EDJA 1BDDA 1X9VA 2GUVA 2RH0A 2JAZA 5CHXA 3RL0B 2CNRA 2BCCD 1ACPA 2FACA 3HE4B 5KTBA 2XXMA 1YJ9P 3CWBG 1PEOA 1LT9A 3Q2YA 3JCUH 3H1LD 3TGUG 2KR5A 1USEA 3CCUP 2PY8A 7CEIA 2SPZA 2OYIC 4KT0J 1NU1G 2NRGA 3UIAA 5K5GB 2WT7A 2Z5IA 1ZLLA 3L70D 3EFGA 1IFNA 1PEMA 1FZCA 1NTKJ 4H13B 3S4RA 4XFJA 4Z1MH 1M8OB 3RK3C 2E74C 2ZFCA 1RF1C 3H1JD 2V4HA 1BXIA 2ZYDA 4I7ZB 1WRGA 3MHVA 3H1HD 3V2NA 1RF0A 5AVYB 4H44C 1PV3A 2M3EA 3VN0A 2OTJP 3RL0g 1X0TA 4N78D 1JMBA 3HRNA 3HD7D 2ZXEB 2BUOA 3RBZA 4COCA 2WPVB 2FVFA 2KGAA 1JOCA 1SQBG 3IR9A 3W67A 1NU1D 4IZ6A 2O01J 1H0TB 3CMAP 1VQ5P 4HJGH 3L71J 4KHXA 3CMEP 2K9YA 1LTAC 4U3FE 2O01N 4H13C 2K2QA 1OIPA 4C46A 1R8EA 1LTGC 2KYVA 1KORA 2JR8A 3CE7A 3HZQA 2V7QH 1EDLA 3L73D 1GK4A 2RMZA 5HGOA 2QSIA 3GZLA 3VYIA 1FS0E 1JY3P 1CI6B 3IFMA 1T6AA 4R0MA 4RKUJ 1NTMG 4I7ZC 1KLPA 3H32A 1FZGA 4PWVB 2JWAA 4Y28J 2H43A 3B5IA 4N3YB 3H6PA 2QJPB 3G1GA 1JCDA 3GW6A 3PLNA 2Z45A 1YJWP 3CCJP 2QM8A 1NGMB 4CPGA 1N2DC 1IFPA 2L22A 1MZ9A 2OTKE 1RQUA 3G3ZA 3L72G 1HQBA 3MIWA 1N73B 4WVZA 1EZVE 1L0LE 1ZXGA 3CC4P 3CL3D 2QM7A 3H1IJ 1PFIA 1FZEA 3A0HH 5CBNA 2EHTA 1GTWA 3RK3D 3TDKA 3BCCG 2E74D 2HR3A 2GZEA 1YIJP 1UIXA 1NTMD 3V2PA 2KLVA 1JY3O 3CC2P 1HH0A 1YITP 2JKVA 2W27A 4U7JA 4DT0A 3M0DA 1RO0A 2KXPB 1JTHA 1L0NK 2HPCB 2W6AA 4H44D 1PP9E 3EFFK 1OVVA 2Q5UA 4EYYQ 2YXQB 1DIPA 2FKWB 1IFMA 3MP7B 2QJPC 2IX7C 1VQ4P 2MR7A 1S72P 1GU5A 1U57A 2JWDA 3WBHA 1M7LA 3AE4C 4EI2A 1K73Q 3L72D 4YTPC 1SQXD
chains in the Genus database with same CATH topology
3CCUP 2OARA 2PEQA 1M6EX 2KODA 2PY8A 1Q7YQ 1QVGO 2E1MA 1VQ7P 4M0IA 2QEXP 3NTEA 3G71P 1N8RQ 5HGNA 2Z46A 1AUMA 3LRYA 1VQPP 4U0CA 1EOQA 2DGYA 4U0FA 2XV6A 1VQ9P 2JO0A 2L6EA 3B5IA 4PH1A 1RO2A 5F2KA 5DCKA 1Q86Q 3DS4A 1VQNP 3CCRP 2EFJA 3VRLC 1PEMA 2M8LA 3DS1A 3G1GA 4XROA 5JPAA 1Q81Q 2M8PA 3I56P 3OW2O 3H0DA 3CCLP 2Z45A 1YJWP 3G4SP 2BQ1E 3CCJP 3CXCO 4U0BA 5F2OA 1KD1Q 3E2DA 4U0EA 4GR6A 5BS2A 1K9MQ 3CD6P 2PEIA 4IPYA 2LF4A 4XFXA 2QA4P 4WYMA 1YHQP 2EG5A 2Z44A 3G26A 3G1IA 2JYLA 3CCSP 1VQ8P 2OTLP 4XFYA 1VQLP 1K8AQ 1NJIQ 1QRJA 3CC4P 1IUQA 3DPHA 1KQSO 3HYBA 1M74A 4QNBA 3DTJA 1A8OA 3RG6C 1KC8Q 2OTJP 1VQ6P 3M1MA 2PEKA 3CCEP 2PENA 2PEMA 3CCVP 1Q82Q 5I4TG 3G29A 1QVFO 3G21A 1K30A 3G28A 2BUOA 1YIJP 4COCA 5HGLA 5HGMA 1M90Q 3H4EA 3DS3A 1E6JP 3G6EP 1A43A 3MGEA 5F2NA 3CC2P 1YITP 1PEQA 4PH0A 1D1DA 4XRQA 2EIAA 3CMAP 2PEOA 1VQ5P 3CCQP 1RO0A 3DS0A 2PEJA 4XFZA 3CPWO 2BHVA 1M6NA 1M1KQ 2M8NA 2XT1A 3CMEP 1BAJA 4U0AA 1VQKP 2CWOA 3I55P 3CC7P 2ONTA 2P9XA 3Q20A 1VQOP 5BS1A 1VQ4P 2XXMA 3DS2A 1S72P 1YJ9P 1EIAA 2JYGA 4U0DA 1YI2P 1PEOA 1VQMP 1PEUA 3G0VA 3HZQA 3P05A 4GR2A 3WBHA 3DS5A 3H47A 3CCMP 1K73Q 1RNIA 1W2BO 5HGOA 1JJ2O 1ZMBA 4COPA 1YJNP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU P;  3CMA P;  1VQ5 P;  1KC8 Q;  3CCL P;  2OTJ P;  1VQ6 P;  3CCQ P;  3G4S P;  3I56 P;  3CCJ P;  1YJW P;  1Q7Y Q;  3CXC O;  1KD1 Q;  1QVG O;  3CPW O;  3CCE P;  1M1K Q;  1VQ7 P;  2QEX P;  1K9M Q;  3CME P;  3CCV P;  3G71 P;  1N8R Q;  3CD6 P;  1Q82 Q;  1VQK P;  1QVF O;  2QA4 P;  3I55 P;  1VQP P;  1YHQ P;  3CC7 P;  1YIJ P;  1VQO P;  1VQ4 P;  1VQ9 P;  3CCS P;  1S72 P;  1VQ8 P;  1YJ9 P;  2OTL P;  1M90 Q;  1YI2 P;  1Q86 Q;  1VQL P;  1VQM P;  1VQN P;  3CCR P;  3G6E P;  1K8A Q;  1NJI Q;  3CCM P;  1K73 Q;  3CC2 P;  1W2B O;  3CC4 P;  1YIT P;  1KQS O;  1JJ2 O;  1Q81 Q;  3OW2 O;  1YJN P; 
#chains in the Genus database with same CATH topology
 2JU1 A;  2FAE A;  1Q7Y Q;  3S1K A;  5APV A;  4UB6 H;  3GF3 A;  3HTK B;  4PV1 B;  5EFW B;  3RG2 A;  4I6M C;  4MRT C;  1E79 H;  1YTZ I;  2UWJ E;  2OYI A;  1P84 D;  4K35 A;  3H1J E;  1NHL A;  1SQV J;  1NTZ D;  2IZ0 A;  4JYC A;  2Q9I A;  1N7L A;  1GW3 A;  2QA4 P;  2L9F A;  2EG5 A;  1P84 H;  1A02 J;  3G26 A;  3G1I A;  5KLV J;  4W7Z A;  2LKM A;  3H1K G;  2K3R A;  4JF7 A;  3VMX A;  5AW6 B;  1RF1 A;  1NJI Q;  5BU8 B;  2XZR A;  3EWK A;  3DPH A;  1SQP K;  3F5H A;  2N9B A;  1IJD B;  1OXZ A;  1L0I A;  1OX3 A;  3M1M A;  2N98 A;  2VRS A;  1PZQ A;  1AVO A;  2N5I A;  2H88 C;  2ZYG A;  2W8Z A;  2FQ1 A;  2K0X A;  2FQ2 A;  5E79 E;  5DJU B;  2KP8 A;  5AVS B;  3DS3 A;  1GL2 D;  2Y9Z A;  2N50 A;  4JQ0 D;  3L75 J;  1AQ5 A;  4PV1 C;  4RES B;  1NVO A;  5APU A;  2CGQ A;  3M91 A;  5GTH E;  3R2P A;  3L73 E;  1SQQ K;  1VQM P;  1NKN A;  4PJ0 H;  1IZN B;  2ERH A;  3CCM P;  5CCG D;  1JJ2 O;  2BEQ D;  2FYN B;  3AE2 C;  1DEE G;  2C9L Y;  3L74 D;  1SP4 A;  1BE3 J;  1MFZ A;  2L6E A;  2QJY B;  3N4X A;  3DS4 A;  2IDB A;  5AVX B;  1S2E A;  2EFJ A;  4XRO A;  2M0B A;  2OYH B;  5EW5 E;  3CXC O;  3E1I A;  1RHZ B;  1QEX A;  2LF4 A;  1BDC A;  1NU1 K;  1YHQ P;  2IBZ D;  3L36 A;  1KQF B;  2Y0D A;  2ZJS E;  3AE5 C;  2E5T A;  4GOF A;  1XTC C;  1N7S D;  1EQ7 A;  1KC8 Q;  2N1T D;  2OQQ A;  3CXH D;  3H32 B;  2JGP A;  2Y0C A;  1PGQ A;  3RK3 E;  1H0T A;  2JO1 A;  5CCH C;  2E5Y A;  1X8Y A;  2L4B A;  1KZU B;  1AFO A;  3KZI H;  1HBW A;  3JSV C;  2Q1K A;  3CXH H;  3LW5 H;  4AYC A;  1A43 A;  1FJK A;  3B4S A;  1HY8 A;  1S3J A;  3AEF C;  2AEM A;  4XFZ A;  2LKI A;  4U3F J;  5KAF H;  3USS A;  2QJY C;  3HD7 B;  1BAJ A;  1LJ2 A;  1CI6 A;  2ONT A;  1R5S A;  3Q20 A;  2JYG A;  1SQB K;  1PEU A;  4GR2 A;  3IF4 A;  2OYH C;  1L0N J;  4COP A;  2ZXX A;  1ZRT D;  1KB9 H;  2YIU B;  3CX5 D;  1ZME C;  5APQ A;  1PPJ G;  2BAS A;  1KYO E;  1BCC D;  2XU6 A;  1YQ3 C;  2DW3 A;  5BVZ A;  5DCK A;  1WMK A;  4KJM A;  3RBX A;  4OH8 B;  3CCR P;  2N5H A;  2KI7 B;  3CX5 H;  1AV1 A;  2FAD A;  1Q81 Q;  3I56 P;  3OW2 O;  1NTZ E;  2FFD B;  3BRT B;  1FOS F;  3E7K A;  4GR6 A;  1K9M Q;  1NTM K;  2QJK B;  1L0L J;  3NTN A;  4IL6 H;  4Y99 B;  2KS1 B;  3U1A A;  3NXS A;  2JYL A;  2Q3I A;  5GTI H;  4EIJ A;  4OVN F;  2KG8 A;  4BPH A;  1IK9 A;  3HD7 C;  1HF9 A;  4DG9 A;  1KMI Z;  1JUN A;  1AF8 A;  2CQ8 A;  3AED C;  2R5D A;  2P2U A;  2LR2 A;  2KK7 A;  1JY2 N;  1E6J P;  2BCC J;  2JP3 A;  3L4F A;  2B88 A;  2LIU A;  1PP9 G;  4GOE A;  1LGH B;  4W7Y A;  1NH4 A;  2CG5 B;  1LTI C;  3CPW O;  1KFN A;  1QL1 A;  4MN4 C;  5AVQ B;  2BHV A;  5AW0 B;  2M8N A;  3H1L J;  2CPB A;  2O1K A;  4WY4 B;  3I55 P;  3RK3 B;  3CC7 P;  2E42 A;  2E74 B;  1QL2 A;  2XDJ A;  1VQO P;  3TSI A;  5AW2 B;  2W6B A;  1YI2 P;  3HTK A;  3G0V A;  2AXT H;  1YYC A;  4D6T D;  5AW8 B;  5EJD A;  2MJZ A;  2QJK C;  3TNU B;  3NMD A;  3L70 J;  3VOP A;  1VL2 A;  4Y99 C;  4H44 B;  1SQP D;  2IYO A;  2H89 C;  3L75 E;  3ITK A;  2JO0 A;  4PH1 A;  5B5E H;  1JNM A;  3H1J J;  2R3S A;  4A7P A;  5JPA A;  1JEK A;  3QH9 A;  1LWU C;  5AW5 B;  2OGU A;  1H89 A;  3H1H J;  1LT1 A;  1KD1 Q;  2K0D X;  3EJD A;  2IBZ E;  2QVA A;  1LTB C;  1GDT A;  4AUW A;  1EZV I;  2KLU A;  2OTL P;  1BGY D;  1K05 A;  3KZI E;  5H2F H;  1K8A Q;  1BE3 E;  1X22 A;  1E5W A;  3FGA D;  1OW7 A;  1OFC X;  4YXW H;  4QNB A;  1A8O A;  1NTK G;  1Q2N A;  4UB8 H;  1SQQ D;  4WY4 C;  2AEF A;  2PEK A;  1NU1 J;  2K9J A;  5CJ0 A;  4PXH B;  1HGV A;  1M1J B;  3G28 A;  2C9N Y;  3B71 A;  5KJ7 D;  2V7Q J;  2FVA A;  1T2K D;  5AVU B;  3AEA C;  5CCH A;  4NPD A;  3CWB D;  3AEC C;  2B87 A;  4TLF A;  2IFM A;  1T3J A;  3RK2 D;  3L73 J;  1OW6 A;  3GG2 A;  1KQG B;  3TGU D;  1NQ4 A;  3WUV A;  3L35 A;  1EIA A;  2NZ2 A;  1GL2 B;  3H47 A;  1VPC A;  1ZMB A;  2KSE A;  3CX5 E;  2MVV A;  1QVG O;  2WMM A;  2FYZ A;  3L71 G;  2VLQ A;  1N8R Q;  2Z46 A;  2H7H A;  2WPR A;  2OYH A;  4U0C A;  1QLE D;  1EOQ A;  2DGY A;  1AQT A;  2W6J H;  1RO2 A;  1YQ4 C;  2E75 D;  1OW8 A;  3VTP C;  1SLQ A;  2M8L A;  5AW3 B;  2P10 A;  2Z5H A;  3Q5S A;  1JCC A;  3V4W A;  4BWN A;  1M1J C;  1VF5 C;  1L0N E;  2GZI A;  1GPJ A;  3A5T A;  2FXP A;  2A06 G;  3SWK A;  1FZF A;  5AW1 B;  3RGU A;  2JB0 A;  2NPS D;  2FXO A;  4BRY A;  1SQB D;  2VSQ A;  2GZF A;  1WT6 A;  2YMK A;  2WPT A;  2PEN A;  2ROQ A;  2JU2 A;  2K1A A;  1J1E B;  2PAJ A;  1GL2 C;  2KOQ A;  3HD7 A;  4YXD C;  1GW4 A;  2JJL A;  2PRR A;  5CZD B;  2P67 A;  4UHP B;  1N7S B;  2JDI H;  1ZOY C;  2N1T B;  3H1I G;  3MTU E;  5TJH A;  2KZJ A;  2HYN A;  3L72 J;  4H2X C;  3FWN A;  1SQX J;  4WY4 D;  5CCG C;  4D6T E;  2G3A A;  5APT A;  4L75 A;  2E76 D;  3JCU E;  1SQP E;  2KOS A;  2KSJ A;  2PGD A;  2BCC E;  2XNX A;  1VQ7 P;  4M0I A;  3NTE A;  1MV8 A;  2KUB A;  2MY5 A;  4NPE A;  2FFD A;  3U1C A;  3H1L E;  1NTZ J;  2GA1 A;  2IFN A;  1EXI A;  2JEE A;  2Y9Y A;  2KS1 A;  3NY7 B;  3AE3 C;  2WPS A;  4BPF A;  5AW9 B;  1J1E C;  2O1J A;  5TIS H;  5F2O A;  2QE7 H;  4UB8 E;  5BS2 A;  2J58 A;  1G2C A;  1BGY E;  4M3L A;  1GZL A;  3L70 E;  2FY8 A;  1LWU A;  1EC5 A;  1N7S C;  5B66 H;  3BCC D;  1SQQ E;  2N1T C;  1DX7 A;  2XZ1 C;  1KQS O;  3RG6 C;  2FHS C;  5APY A;  3WUU A;  3ZDM A;  2WVR A;  1EDK A;  1PIX A;  1SQV G;  1VKU A;  2PEM A;  1CZQ A;  2IPP A;  3AEG C;  3G21 A;  2WWW A;  3H1H E;  3WUT A;  1VF5 D;  2KGE A;  2R32 A;  1M90 Q;  5KLV G;  4WY4 A;  3CWB E;  1SFC D;  1MKM A;  2KNC A;  3GJN A;  1KQL A;  2WSE H;  3M9H A;  4N78 E;  3HE5 B;  2PEJ A;  4N6J A;  1NAF A;  3FX0 A;  4H0L D;  1OZH A;  3VMZ A;  1VDF A;  1KIL C;  1DV5 A;  1VQK P;  2CWO A;  3TNU A;  2FYU G;  4HB1 A;  5BS1 A;  1NU1 E;  3FXD A;  1BSH A;  2MF4 A;  2FXM A;  4LGD E;  3Q1M A;  2N9Y B;  1W2B O;  3L74 J;  1URQ D;  5BU5 A;  2K9J B;  2PEQ A;  4DZO A;  4GKG A;  2KOD A;  2GUS A;  2B9B A;  1IMQ A;  1KYO I;  5HGN A;  2AXC A;  1LTJ B;  3V5B A;  3V2R A;  1FDI A;  2YKQ A;  2KWL A;  2B87 B;  1ZR4 A;  3AE6 C;  4YPC A;  5APS A;  3H1K D;  2LOL A;  2R44 A;  2PEI A;  2ZT9 D;  4WYM A;  4H2Y C;  1QX8 A;  1ZN5 A;  2CK3 H;  2I1J A;  3LW5 J;  1BE3 G;  4K3A A;  1M1J A;  3AE8 C;  1SQB E;  2FYU D;  3FWL A;  1M74 A;  2YKP A;  2K0Y A;  1RE3 C;  3BAS A;  3GLM A;  3HUS B;  2AEJ A;  5AW7 B;  1MFT A;  3AE7 C;  3SWY A;  1U7J A;  3A0H E;  3D6Y A;  4DJG A;  1YBK A;  3BVH A;  1QVF O;  3BAT A;  3MGN A;  4WB4 A;  1MZ8 A;  2QG4 A;  4IL6 X;  2ZAE B;  4EDF A;  1W5C E;  2EIA A;  1NTK K;  3DS0 A;  1GL2 A;  3K5B A;  2KOO A;  2IYP A;  1LTJ C;  1M1K Q;  3LIE A;  2KG9 A;  1IFD A;  4JBZ A;  3MUD C;  1NTM E;  2XKM A;  3T97 B;  1LP1 A;  2JQ4 A;  1KFM A;  4BRY B;  4B86 A;  1NKZ B;  1BCC J;  4R4L A;  1TU3 F;  3N7N A;  2CPS A;  3KPE A;  4L76 A;  2WSF H;  5CCG A;  2D2C C;  4U3F G;  3RK2 B;  5APX A;  1KB9 D;  3V4Q A;  4UB6 E;  2YNY A;  4PD4 D;  1KIL D;  4JYB A;  3L72 E;  1SQX E;  3HUS C;  4C7R A;  2J59 M;  2AF8 A;  2IBZ I;  2PFX A;  4PD4 H;  4TT3 H;  3A2A A;  3O8Z A;  1FJP A;  1PGJ A;  4XFX A;  3SFE C;  2Z44 A;  2O3J A;  3B8E B;  2VLP A;  3CCS P;  3BCC E;  4EOT A;  1VHN A;  1P84 E;  5AVV B;  2E75 B;  4C7N B;  1S9K D;  1S1C X;  3P8C D;  3Q5R A;  1D7M A;  3GHG C;  5KAI H;  2KIK A;  1N7S A;  5KJ7 C;  2L0Q A;  1AVY A;  3D71 A;  2N1T A;  1GXH A;  3WU2 H;  1T2K C;  1EZV G;  1UJZ A;  3FXE A;  1L0L G;  3M9B A;  1JO5 A;  1KV4 A;  3EJB A;  1FE6 A;  3B5N C;  1Q90 D;  1IFI A;  2WQY C;  1L4A C;  1PEQ A;  1KTM A;  2NPS B;  2PEO A;  1G2C B;  3RK2 C;  1LTT C;  4NEO A;  4H2W C;  3KHU A;  4D6T J;  4IOI H;  1LWU B;  2YMY A;  2L91 A;  1L2P A;  1XTG B;  2P9X A;  5KP8 B;  2GDX A;  1PPJ D;  4WWI A;  1SQP J;  4ASW A;  4O9B A;  1JY2 P;  1GXG A;  2A45 I;  1FC2 C;  4BXL A;  3CX5 I;  2IZ1 A;  2BCC G;  1PL5 A;  1KIL A;  4PJ0 E;  4BPG A;  4GT1 A;  2FBW C;  2R5B A;  2NO8 A;  3U59 A;  2MR8 A;  4W80 A;  3G71 P;  2WPQ A;  1S5L X;  5C39 A;  2Q7C A;  3H1L G;  2E75 C;  2C0W A;  5KLI C;  2KNC B;  4U0F A;  4HKG A;  1DD4 A;  1IFJ A;  1Q86 Q;  1ZR2 A;  1PGO A;  5KP7 B;  3PJS K;  2E76 B;  2W90 A;  3H1K E;  2M8P A;  3F89 A;  2POH A;  1BGY J;  1EXJ A;  3L74 E;  3O6Q A;  3L70 G;  1UII A;  2PP6 A;  2K94 A;  4ZNC A;  2KOG A;  1SQQ J;  2D2C D;  2KOP A;  1FOS E;  1FR2 A;  1SS1 A;  2NPS C;  3A0B H;  2HOD B;  2KZI A;  1FDO A;  3H1J G;  1OR5 A;  3OAK A;  3M9Q A;  3CCE P;  1KN7 A;  3H1H G;  2AFE A;  1AA0 A;  1PP9 D;  5AVW B;  3HE5 A;  3CWB J;  4L74 A;  3AEB C;  1JY2 O;  3JC2 2;  1RE3 A;  5M1B A;  2P58 A;  3G6E P;  2WSC H;  3TGU J;  2FVE A;  3CXH E;  3C8V A;  4XA4 A;  1GK6 A;  5HVC A;  2RKL A;  1N86 A;  2PNG A;  3PH0 A;  2KW2 A;  3VMA A;  1M6N A;  1NOH A;  1SQV K;  4JPZ B;  5KAF E;  1OVU A;  3BRV B;  2VLN A;  2E76 C;  1VF5 B;  1YTZ T;  5KLV K;  4GIF A;  3P05 A;  1E0H A;  1LTJ A;  1SFC B;  1X79 B;  2G8Y A;  1LNQ A;  3MUD A;  1S5L H;  4NPF X;  1M6E X;  2LIW A;  3B5N D;  1L4A D;  1OMI A;  1CSB A;  4H0L B;  2QEX P;  1RQV A;  1KB9 E;  4PD4 E;  3CI9 A;  1KIL E;  3L73 G;  1VQP P;  4LLH A;  2DNW A;  2FYU K;  1QGK B;  4DOJ A;  2J5U A;  1HTL C;  3I5C A;  4DCK A;  4WBA A;  2M5R A;  2GZJ A;  3VRL C;  1ZRT E;  3KQG A;  1FZA A;  3GZM A;  3H0D A;  1URQ B;  3RL0 C;  5AW4 B;  3II6 A;  2BQ1 E;  1DEB A;  1LP1 B;  1BCC E;  5CMZ A;  1NTK D;  5AVZ B;  1L0H A;  3HUS A;  5KAI E;  5DJT B;  3IN6 A;  3V2Q A;  1SQB J;  4I1L A;  3P8M C;  3R4Y A;  4ZKU A;  4ZKP A;  4XFY A;  3WU2 E;  4IL6 E;  4LC1 A;  2X2B A;  1S9K E;  3P8C E;  1IUQ A;  5GTI E;  1M56 D;  2EHS A;  1HJ0 A;  5E79 H;  3P32 A;  3CCV P;  3G29 A;  3TK1 A;  2ZT9 B;  2KB7 P;  3AE1 C;  1BSN A;  1K30 A;  5CJ4 A;  2QNW A;  2K93 A;  1SFC C;  3KXD A;  1DH3 A;  2N6Y A;  2H8P D;  2Y0E A;  3T97 A;  3MGE A;  3GHG A;  1JY3 N;  4H0L C;  5KJ7 A;  1RY3 A;  1HGZ A;  2M3B A;  3EQ2 A;  2E43 A;  1NTM J;  1CEI A;  2XT1 A;  2YO2 A;  5GTH H;  2R3C A;  1AJY A;  1IMP A;  1T3U A;  3B5N A;  1ZNV A;  1RE4 C;  1PPJ E;  3NFQ A;  1L4A A;  5AVR B;  3L71 D;  1URQ C;  2MD9 A;  3L37 A;  4XE5 B;  3SFD C;  2AXT E;  2O01 H;  2P7J A;  1H88 A;  3AEE C;  1AUM A;  3LRY A;  1JM0 A;  1SQX G;  3D70 A;  2I1K A;  3PRJ A;  1W2E A;  3ABV C;  3DS1 A;  1J1D B;  2ITA A;  3GF7 A;  5B5E E;  2AVA A;  3A0B E;  3IAO A;  2A06 D;  4C7N A;  2ZT9 C;  3BCC J;  3CD6 P;  1PGP A;  1NWQ A;  2LXB A;  3V6I A;  2VLO A;  1KIL B;  2M5A A;  1RH5 B;  1GMJ A;  4QMA A;  3LID A;  1QRJ A;  1NTZ G;  2MKV A;  2WSE J;  3DTJ A;  5H2F E;  1VQ6 P;  1U7M A;  3RL0 D;  1NAY A;  3PHL A;  3S9O A;  2NPS A;  2OYO A;  2GDY A;  5I4T G;  3H1I D;  2GZG A;  1FAV A;  1SVF A;  5APW A;  2LL8 A;  4QKO A;  1HJB A;  3H4E A;  3OA7 A;  2JBG A;  4F37 A;  3O6Q B;  4I2L C;  2GDW A;  1EDI A;  1S5L E;  3B4Q A;  1N73 C;  1HWT C;  1HVV A;  1KYO D;  3DS2 A;  1L0L K;  1J1D C;  1K04 A;  4H13 D;  5KKZ B;  3CLQ A;  1IO4 A;  2HLO A;  2Q3E A;  2XND H;  3TGU E;  1KYO H;  3A7O A;  3SWF A;  1LT9 B;  2KG6 A;  3H1K J;  3KDP B;  1OWA A;  3VMY A;  1FDM A;  1VQN P;  3GKL C;  2N6Z A;  2WSS H;  3L74 G;  3G4S P;  2HOD A;  2FQ0 A;  1NTK E;  1Y9B A;  1ZW0 A;  3TF5 A;  3L75 G;  3QWO C;  2FYU J;  2WT7 B;  3W68 A;  1HUC A;  1FZC B;  1P84 I;  1VQ8 P;  1SQV D;  4GDO A;  3HE4 A;  1NO4 A;  4OGQ B;  2WIT A;  3PTZ A;  5KP6 B;  5KLV D;  2IBZ G;  3SSU A;  2QRX A;  3A3Y B;  3MZW B;  2YKO A;  1JMM A;  1G1I A;  4GOD A;  2HG5 D;  2B89 A;  5KKZ C;  2D2C B;  1NYH A;  5L8R J;  3KYQ A;  3GMA A;  1T8K A;  4PH0 A;  1D1D A;  4XRQ A;  2WSF J;  3CCQ P;  3H25 A;  1LT9 C;  1SFC A;  2WTY A;  2Z4E A;  3L71 E;  4HKZ H;  1F80 D;  1Z56 A;  3L75 D;  5CBO A;  1MUU A;  1CW5 A;  3MD0 A;  3DS5 A;  2KGC A;  1RNI A;  1T8Z A;  1YJN P;  1FBM A;  1RE4 A;  3VP9 A;  1FZC C;  1X3O A;  1URQ A;  1Y8A A;  3C9I A;  3AE9 C;  2M8R A;  2BEZ F;  2XV6 A;  1VQ9 P;  3C1L A;  4OGQ C;  3GHG B;  1DD3 A;  2GM4 A;  2ZVN B;  2A45 G;  2WZ7 A;  2K88 A;  2A06 E;  4R4M A;  1BE3 D;  3CCL P;  1BCC G;  4CA3 A;  3B5N B;  3Q3D A;  1RF0 C;  3E2D A;  1L4A B;  5TIS E;  4IPY A;  1S4X A;  3E1R A;  1USD A;  2L5G B;  4IFF A;  2FYN C;  2Q6Q A;  2XV5 A;  2GYK A;  5B66 E;  1M57 D;  2KOR A;  1L0N G;  1OVR A;  2LXC B;  4RO0 A;  1ZP0 C;  3H1I E;  2W83 C;  1A02 F;  1Q82 Q;  2K37 A;  4IFD K;  1AYI A;  5HGL A;  5HGM A;  1EMV A;  3OJA B;  3M06 A;  3CXH I;  5KLI B;  5F2N A;  4RJT A;  3EJE A;  3G9R A;  5HV8 A;  4IFM A;  1DNY A;  3VP8 A;  4AQR D;  2K5X A;  4U0A A;  4PV1 D;  2M5A B;  1Z6M A;  2LTE A;  4U0D A;  4ASV A;  4U3F D;  2A45 H;  2C0X A;  2P1J A;  1JTH B;  1R5L A;  3U43 A;  1N73 A;  2OAR A;  3WMM 0;  4L73 A;  2ZVO B;  2E1M A;  1J2J B;  1KB9 I;  4PD4 I;  2K92 A;  1ZV8 A;  2LPK A;  4D6T G;  1L0N D;  2MVU A;  2AFD A;  5F2K A;  1IK7 A;  4HYT B;  3TYY A;  1UNK A;  1SQP G;  1LTS C;  3PP5 A;  4U0B A;  4U0E A;  1JB0 J;  2YO3 A;  3P7K A;  1FZB A;  1GD2 E;  1Y47 A;  1GU4 A;  1SQV E;  2HPC A;  2HFE D;  2OYI B;  2YXR B;  4HH2 A;  1H8A A;  1SQX K;  2WSC J;  1VQL P;  2RN0 A;  2LML A;  3LMO A;  2YIU C;  1PP9 J;  2I8D A;  4OGQ D;  5KLV E;  1EZV D;  3HYB A;  2QIW A;  1L0L D;  2XZ0 D;  3D6Z A;  4ZMD A;  3Q5P A;  1BGY G;  1FU1 A;  2ZYA A;  3M0D C;  5AVT B;  1RF1 B;  3M0A A;  5CCH D;  1IC2 A;  1G1J A;  2FYU E;  1SQQ G;  2FFD C;  2KGD A;  4OWF A;  1NTZ K;  1EDJ A;  1BDD A;  1X9V A;  2GUV A;  2RH0 A;  2JAZ A;  5CHX A;  3RL0 B;  2CNR A;  2BCC D;  1ACP A;  2FAC A;  3HE4 B;  5KTB A;  2XXM A;  1YJ9 P;  3CWB G;  1PEO A;  1LT9 A;  3Q2Y A;  3JCU H;  3H1L D;  3TGU G;  2KR5 A;  1USE A;  3CCU P;  2PY8 A;  7CEI A;  2SPZ A;  2OYI C;  4KT0 J;  1NU1 G;  2NRG A;  3UIA A;  5K5G B;  2WT7 A;  2Z5I A;  1ZLL A;  3L70 D;  3EFG A;  1IFN A;  1PEM A;  1FZC A;  1NTK J;  4H13 B;  3S4R A;  4XFJ A;  4Z1M H;  1M8O B;  3RK3 C;  2E74 C;  2ZFC A;  1RF1 C;  3H1J D;  2V4H A;  1BXI A;  2ZYD A;  4I7Z B;  1WRG A;  3MHV A;  3H1H D;  3V2N A;  1RF0 A;  5AVY B;  4H44 C;  1PV3 A;  2M3E A;  3VN0 A;  2OTJ P;  3RL0 g;  1X0T A;  4N78 D;  1JMB A;  3HRN A;  3HD7 D;  2ZXE B;  2BUO A;  3RBZ A;  4COC A;  2WPV B;  2FVF A;  2KGA A;  1JOC A;  1SQB G;  3IR9 A;  3W67 A;  1NU1 D;  4IZ6 A;  2O01 J;  1H0T B;  3CMA P;  1VQ5 P;  4HJG H;  3L71 J;  4KHX A;  3CME P;  2K9Y A;  1LTA C;  4U3F E;  2O01 N;  4H13 C;  2K2Q A;  1OIP A;  4C46 A;  1R8E A;  1LTG C;  2KYV A;  1KOR A;  2JR8 A;  3CE7 A;  3HZQ A;  2V7Q H;  1EDL A;  3L73 D;  1GK4 A;  2RMZ A;  5HGO A;  2QSI A;  3GZL A;  3VYI A;  1FS0 E;  1JY3 P;  1CI6 B;  3IFM A;  1T6A A;  4R0M A;  4RKU J;  1NTM G;  4I7Z C;  1KLP A;  3H32 A;  1FZG A;  4PWV B;  2JWA A;  4Y28 J;  2H43 A;  3B5I A;  4N3Y B;  3H6P A;  2QJP B;  3G1G A;  1JCD A;  3GW6 A;  3PLN A;  2Z45 A;  1YJW P;  3CCJ P;  2QM8 A;  1NGM B;  4CPG A;  1N2D C;  1IFP A;  2L22 A;  1MZ9 A;  2OTK E;  1RQU A;  3G3Z A;  3L72 G;  1HQB A;  3MIW A;  1N73 B;  4WVZ A;  1EZV E;  1L0L E;  1ZXG A;  3CC4 P;  3CL3 D;  2QM7 A;  3H1I J;  1PFI A;  1FZE A;  3A0H H;  5CBN A;  2EHT A;  1GTW A;  3RK3 D;  3TDK A;  3BCC G;  2E74 D;  2HR3 A;  2GZE A;  1YIJ P;  1UIX A;  1NTM D;  3V2P A;  2KLV A;  1JY3 O;  3CC2 P;  1HH0 A;  1YIT P;  2JKV A;  2W27 A;  4U7J A;  4DT0 A;  3M0D A;  1RO0 A;  2KXP B;  1JTH A;  1L0N K;  2HPC B;  2W6A A;  4H44 D;  1PP9 E;  3EFF K;  1OVV A;  2Q5U A;  4EYY Q;  2YXQ B;  1DIP A;  2FKW B;  1IFM A;  3MP7 B;  2QJP C;  2IX7 C;  1VQ4 P;  2MR7 A;  1S72 P;  1GU5 A;  1U57 A;  2JWD A;  3WBH A;  1M7L A;  3AE4 C;  4EI2 A;  1K73 Q;  3L72 D;  4YTP C;  1SQX D; 
#chains in the Genus database with same CATH homology
 3CCU P;  2OAR A;  2PEQ A;  1M6E X;  2KOD A;  2PY8 A;  1Q7Y Q;  1QVG O;  2E1M A;  1VQ7 P;  4M0I A;  2QEX P;  3NTE A;  3G71 P;  1N8R Q;  5HGN A;  2Z46 A;  1AUM A;  3LRY A;  1VQP P;  4U0C A;  1EOQ A;  2DGY A;  4U0F A;  2XV6 A;  1VQ9 P;  2JO0 A;  2L6E A;  3B5I A;  4PH1 A;  1RO2 A;  5F2K A;  5DCK A;  1Q86 Q;  3DS4 A;  1VQN P;  3CCR P;  2EFJ A;  3VRL C;  1PEM A;  2M8L A;  3DS1 A;  3G1G A;  4XRO A;  5JPA A;  1Q81 Q;  2M8P A;  3I56 P;  3OW2 O;  3H0D A;  3CCL P;  2Z45 A;  1YJW P;  3G4S P;  2BQ1 E;  3CCJ P;  3CXC O;  4U0B A;  5F2O A;  1KD1 Q;  3E2D A;  4U0E A;  4GR6 A;  5BS2 A;  1K9M Q;  3CD6 P;  2PEI A;  4IPY A;  2LF4 A;  4XFX A;  2QA4 P;  4WYM A;  1YHQ P;  2EG5 A;  2Z44 A;  3G26 A;  3G1I A;  2JYL A;  3CCS P;  1VQ8 P;  2OTL P;  4XFY A;  1VQL P;  1K8A Q;  1NJI Q;  1QRJ A;  3CC4 P;  1IUQ A;  3DPH A;  1KQS O;  3HYB A;  1M74 A;  4QNB A;  3DTJ A;  1A8O A;  3RG6 C;  1KC8 Q;  2OTJ P;  1VQ6 P;  3M1M A;  2PEK A;  3CCE P;  2PEN A;  2PEM A;  3CCV P;  1Q82 Q;  5I4T G;  3G29 A;  1QVF O;  3G21 A;  1K30 A;  3G28 A;  2BUO A;  1YIJ P;  4COC A;  5HGL A;  5HGM A;  1M90 Q;  3H4E A;  3DS3 A;  1E6J P;  3G6E P;  1A43 A;  3MGE A;  5F2N A;  3CC2 P;  1YIT P;  1PEQ A;  4PH0 A;  1D1D A;  4XRQ A;  2EIA A;  3CMA P;  2PEO A;  1VQ5 P;  3CCQ P;  1RO0 A;  3DS0 A;  2PEJ A;  4XFZ A;  3CPW O;  2BHV A;  1M6N A;  1M1K Q;  2M8N A;  2XT1 A;  3CME P;  1BAJ A;  4U0A A;  1VQK P;  2CWO A;  3I55 P;  3CC7 P;  2ONT A;  2P9X A;  3Q20 A;  1VQO P;  5BS1 A;  1VQ4 P;  2XXM A;  3DS2 A;  1S72 P;  1YJ9 P;  1EIA A;  2JYG A;  4U0D A;  1YI2 P;  1PEO A;  1VQM P;  1PEU A;  3G0V A;  3HZQ A;  3P05 A;  4GR2 A;  3WBH A;  3DS5 A;  3H47 A;  3CCM P;  1K73 Q;  1RNI A;  1W2B O;  5HGO A;  1JJ2 O;  1ZMB A;  4COP A;  1YJN P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...