1VQPP

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqpP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqpP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqpP02
1YJWP 1Q7YQ 1VQPP 1KD1Q 1NJIQ 2OTJP 1JJ2O 3CCRP 1YIJP 3CC4P 3CCVP 1K9MQ 1K8AQ 1YITP 3I55P 3CXCO 2QEXP 1KC8Q 3CCQP 1M90Q 3CMAP 1VQ5P 3CCEP 3I56P 3CC2P 1VQOP 3CCSP 3CCLP 1VQNP 1VQMP 3G6EP 3G71P 1M1KQ 2OTLP 1VQ8P 1KQSO 3G4SP 1YHQP 1YJNP 1QVGO 1K73Q 1Q81Q 1VQ6P 1Q86Q 1Q82Q 1YJ9P 1S72P 3CCJP 1VQLP 1QVFO 1VQKP 3CCMP 1VQ4P 3CCUP 2QA4P 3CD6P 3CPWO 1VQ7P 3OW2O 1VQ9P 3CC7P 1N8RQ 1W2BO 3CMEP 1YI2P
chains in the Genus database with same CATH superfamily
1NWQA 2J59M 1X8YA 2QEXP 1NOHA 1LNQA 1L0LG 2MVUA 3H1ID 3IAOA 4QKOA 5KAIE 3A0HE 1Z56A 2IDBA 4L73A 4F37A 1BE3E 1FBMA 1SQQE 2KXPB 2N6YA 3VP8A 4RKUJ 1NU1D 2FYUK 3LIEA 1WMKA 1SQXD 1PIXA 1FE6A 3II6A 1PP9D 1IK9A 2QJYB 1EOQA 3AEBC 1SQVJ 1BCCD 1IFJA 1RE4A 3CPWO 2VLQA 3EJBA 1OW6A 3F89A 3M9HA 3V6IA 4LC1A 4OGQD 4B86A 1ZR4A 3L74E 3GKLC 2GM4A 3R4YA 1NTZK 2JB0A 2M5AA 1QVGO 1K73Q 1IK7A 2KORA 2IBZD 2FYNC 1RF0C 1X79B 4ASVA 2KYVA 5KLIC 3P32A 2ZYGA 1URQC 5KLVE 1NGMB 3VN0A 4R4LA 3T97B 5KTBA 2B9BA 4QMAA 4XA4A 2Y0CA 1M7LA 2Q6QA 2LPKA 1CZQA 1VQNP 1DV5A 2Q3EA 1SFCA 2N1TC 2JU1A 3SFEC 2Y9ZA 2NO8A 3H47A 5AVUB 2UWJE 2K94A 4NPFX 2Q9IA 3CD6P 2OQQA 4KT0J 3H1JG 2DGYA 2ITAA 1FZCA 1YYCA 1GPJA 3H1KE 5CJ4A 2IYOA 4XE5B 2JO0A 2KI7B 1N7SD 2A45H 4D6TE 3B8EB 2ZJSE 1FJKA 3A5TA 5HGMA 4GKGA 3RL0B 1PL5A 1GU4A 1RE3A 2GZIA 3V2NA 2Y0EA 1KC8Q 1YI2P 2J58A 2I1KA 2B87B 1HQBA 2HPCB 1CEIA 2EHTA 1J1DB 3P8CE 4HB1A 1BXIA 2K9JB 2HLOA 4IL6H 1UNKA 2AF8A 1VQKP 2JJLA 1HGZA 5KJ7C 3EWKA 2A06E 2WPSA 2HODB 2C0XA 1VKUA 1DD4A 4I7ZB 2M8NA 1GK4A 1PZQA 2MKVA 1H8AA 2Z44A 2AEJA 1ZNVA 2QVAA 1BDDA 5EJDA 2WQYC 5HVCA 2M0BA 1L0NJ 1X3OA 1YTZI 1SQBE 3CMEP 3L71E 4COPA 1KB9D 3CX5D 3KXDA 3AEEC 4U0BA 2JAZA 4ASWA 5APYA 1SS1A 3AE5C 3LW5H 2C9LY 3U1AA 3F5HA 2ZYDA 2LIWA 4CA3A 1SQVD 2HFED 3RBXA 4U3FG 2WPTA 2PY8A 3L74G 2KG8A 3RL0C 1KZUB 2BCCE 1PEMA 5KKZC 1JTHA 2G3AA 1QL1A 5F2NA 5I4TG 2CK3H 1L0LK 2N6ZA 4OVNF 1MUUA 1IJDB 1J1DC 4U3FJ 1T6AA 5AW7B 1R5SA 5KLVG 2IX7C 2R3SA 1AUMA 2O1KA 1USEA 4L75A 3TGUD 1IZNB 1FDIA 1VQ5P 3CCEP 3CXHH 3H1IE 1EIAA 2OTLP 2O01J 4I7ZC 2WMMA 2E76D 1A02F 3CLQA 1S72P 4H0LD 3L70G 2MR7A 3IFMA 4AYCA 1NQ4A 4Y28J 3VYIA 1NU1E 3A7OA 1YJWP 1YIJP 1SQXE 2LL8A 1N7SA 2KWLA 2GZEA 2XV6A 1PP9E 2WVRA 2OYHA 2KOPA 3IR9A 5KP6B 2GZGA 3L70J 3WU2E 1JUNA 1PGOA 4PD4H 1BCCE 2V4HA 3V2RA 3SSUA 3WBHA 1KB9H 2MD9A 1RQUA 1BDCA 4BPHA 3DS2A 2E5TA 2XU6A 3I56P 3VMZA 1R8EA 1RNIA 3RK2D 1YJNP 5AVQB 4I1LA 1FZAA 2IBZE 2KG9A 5APQA 5AW3B 4DZOA 3CX5I 5B66E 4C7NB 3CWBD 1SQPJ 3C1LA 2KR5A 3D70A 2RN0A 2KODA 2LTEA 1G2CB 3A2AA 1MZ8A 5E79E 1OVRA 1HY8A 4H2WC 2KIKA 4MRTC 5AVXB 2LF4A 2BUOA 5AVYB 4PV1B 1M6EX 4U7JA 2ZXEB 1M6NA 3L72D 5KP8B 1VQPP 1LWUB 3N4XA 4W7YA 1PPJD 4MN4C 2N5IA 1FU1A 3AEDC 7CEIA 4H13B 1HJBA 2IFNA 1M1JA 2NRGA 1XTCC 4C46A 2GZFA 2PP6A 2XKMA 5HV8A 3GW6A 2EG5A 2FADA 2HYNA 1AFOA 3M1MA 2WSFJ 1QRJA 4BRYA 1RQVA 2QE7H 2KS1A 3LMOA 3RBZA 1LTSC 1N86A 4HH2A 3GG2A 4UHPB 4PWVB 1FAVA 2KNCB 3PTZA 1NTMD 2D2CB 3H32B 3H0DA 3EFFK 2FYUJ 3DS1A 3VP9A 3M91A 5CCHC 3B5NB 1SQQK 3KZIH 1LTJB 1L4AD 3T97A 4ZMDA 2Z5IA 3CC4P 2R32A 1NTZG 2QJPB 4QNBA 2EFJA 1OW7A 3E1IA 4JBZA 1FDMA 3AE9C 2FVFA 2GYKA 3JCUH 3H1LG 1X22A 2Y9YA 4N78D 1TU3F 1G1JA 3E1RA 1QVFO 3AE6C 2KGEA 1KB9E 3CX5E 1NTZJ 4PV1C 3G3ZA 3MGNA 3AEGC 4BPFA 1PP9G 1LWUC 3WUVA 3MGEA 1QX8A 2KK7A 3CE7A 5K5GB 1LT9A 2E42A 1CI6A 1SQVE 3RK3D 2SPZA 4H13C 3Q3DA 2FFDC 2KOQA 5DCKA 2YIUB 2ZVNB 2W6BA 1KD1Q 1NVOA 5KLVK 1S9KD 5CZDB 3G9RA 2CPSA 3FXEA 1VQ8P 2K9JA 5AW9B 2K0YA 1E5WA 1ZRTD 2AXCA 4L76A 2POHA 2D2CC 1NAFA 2VRSA 4IFMA 3C8VA 3OAKA 3TGUE 2GDXA 1LTJC 2W6JH 3L36A 3PJSK 5CCGA 2CNRA 1W2EA 3B71A 2I8DA 3HUSB 1VPCA 1KILB 2CG5B 3MUDA 1N73A 1RH5B 1S5LH 1JMMA 1BSNA 1AYIA 1J2JB 1QLED 4NPEA 1P84H 3CMAP 1J1EB 1ZOYC 1KFMA 2O01H 1AQTA 1ZXGA 1N7LA 4DJGA 3KHUA 3AE1C 1OMIA 2JBGA 3U43A 3KZIE 2BEQD 1A43A 1HGVA 3V5BA 4XFYA 3DS3A 3V2PA 3GF7A 1MV8A 1M1KQ 2FXMA 1T3UA 2X2BA 5KLIB 1URQB 3JCUE 5AW8B 2FYUD 5CBNA 3HYBA 1AVYA 2FQ0A 1L4AA 4IZ6A 1M8OB 3I5CA 1EZVD 3CWBE 3L75G 2N1TB 3M0DC 3G71P 1JO5A 3HE4B 3NTEA 4PXHB 2K93A 3HUSC 1KILC 5AVWB 4YTPC 4L74A 3L72E 3HE5A 3L75J 1JNMA 2FQ1A 3AEAC 1L0LJ 2NPSD 3CCQP 4YXDC 2BEZF 1YHQP 1HUCA 2ZT9D 3D71A 1J1EC 1X0TA 1AVOA 2PFXA 2C0WA 2ONTA 2E75D 3CCUP 1GXGA 1M74A 2ERHA 1OZHA 2KOOA 1EQ7A 3I55P 3M9BA 1NTKG 3FXDA 1Y8AA 4DT0A 1NTME 1FDOA 2AFEA 1Q81Q 3OA7A 2WPVB 5BU8B 1G1IA 3L37A 4H44B 3EJDA 2GA1A 4C7NA 1KMIZ 1S5LE 2WSFH 2P10A 2P58A 1H0TA 4XFXA 1NU1K 2AXTE 1LP1A 2KP8A 1SQXK 1OX3A 5GTHH 1FR2A 5TJHA 1DNYA 5H2FE 2E43A 4N78E 4WVZA 1VHNA 1GW4A 3V4QA 1VQ9P 3CC7P 2K37A 5APUA 4OWFA 3ZDMA 1AF8A 2ZYAA 1PGQA 1HJ0A 4OH8B 1E0HA 3BCCD 4UB6H 3H1HG 3NY7B 2AVAA 3H6PA 3BATA 2WITA 5AW2B 2J5UA 2O3JA 3RK3E 5EW5E 3H1JJ 1T2KC 2WTYA 3MIWA 5KKZB 1S9KE 1K30A 2VSQA 2KOGA 3H1HJ 2JR8A 1FZGA 2C9NY 1GD2E 3V4WA 2LXCB 1URQD 1BGYD 2A45I 4JYBA 3O6QA 3CXHD 1ZRTE 3TNUA 1MZ9A 2NZ2A 2IZ1A 2YKOA 3CWBG 3L73D 1PEUA 2Z46A 3MZWB 1KN7A 4UB8H 5AW5B 3GJNA 4H44C 1N2DC 1M90Q 2LKIA 5AVRB 1FJPA 4WY4C 1JY3O 3AE4C 1EMVA 1BE3G 3D6ZA 1SQQG 1H89A 2KB7P 3B5IA 4PD4D 1VQ6P 3DS0A 1LTIC 3L35A 2NPSA 1ZMBA 4COCA 1L0LD 3G29A 1BE3J 1SQQJ 1RF1C 1AJYA 3ITKA 1KYOD 1VQLP 2IBZI 1U7JA 3C9IA 4BPGA 5APSA 1AQ5A 2VLNA 1GL2B 2FQ2A 3AE8C 1LTBC 1GZLA 2JYLA 2M8RA 3MHVA 1NTMG 2QSIA 2O01N 2HG5D 3NTNA 5KJ7D 2WPRA 1A02J 4H2YC 3FWLA 1PGJA 2Z45A 4GODA 1YTZT 2FYUE 1JM0A 4H2XC 3L74J 2OYIC 3R2PA 4IL6X 1EZVE 4GT1A 4TLFA 4Y99B 5CBOA 5TISH 2YXQB 2KG6A 3IF4A 2R44A 3DS5A 4UB6E 2I1JA 1DX7A 3HD7B 1Q86Q 2H88C 5KLVJ 1USDA 2B89A 5DJUB 5AVZB 1RO0A 3GHGB 2N9YB 2JU2A 3ABVC 3G26A 4GIFA 3RG6C 3H1KG 2EHSA 3Q2YA 2GZJA 3TF5A 4BXLA 1VQOP 4D6TG 2E74B 3BVHA 2KGDA 1MFTA 1U57A 4N3YB 3G4SP 1ZR2A 3RL0D 1NTKK 3A0BH 2H43A 2QNWA 4NPDA 3AE2C 2KZJA 4IL6E 1LTGC 1VQ4P 5APXA 4JPZB 3H1KJ 5HGOA 2JGPA 3H1JD 4D6TJ 3RG2A 4PJ0H 5L8RJ 3U1CA 2E1MA 1GL2C 2KLVA 1RF0A 5AW1B 1KYOH 1WT6A 4W7ZA 1URQA 1AA0A 4DOJA 2MR8A 2WT7B 2QM8A 5CMZA 3E2DA 1IMQA 2A06G 4IFDK 5B5EH 4PD4I 3FWNA 3MD0A 1F80D 1KB9I 3CCVP 2WSEJ 2PEIA 2JDIH 2GDYA 3G1IA 5CCGD 5BU5A 1EXIA 2H8PD 2IPPA 3RL0g 4WBAA 2M5AB 4Y99C 2Z4EA 1PFIA 2JQ4A 2FXPA 1VF5B 3W67A 1SQBG 3GMAA 3HD7C 3L71G 3HTKB 2M5RA 1N8RQ 1L0ND 1PV3A 1K8AQ 3GHGC 5F2OA 3KQGA 3SWYA 3BCCE 3VRLC 1SFCB 4YPCA 2AFDA 1DEBA 2FFDB 3Q20A 2E74C 1FOSE 1Q82Q 3TYYA 1SQBJ 5BS1A 1JY2O 4IPYA 4XROA 4BWNA 1FZCB 2HR3A 2BCCG 2L91A 3USSA 4IFFA 4XFZA 2PENA 4TT3H 2GUVA 2P7JA 5KJ7A 3H25A 1BGYE 3CXHE 3BRVB 4GOFA 2QIWA 2XXMA 1JCDA 4U3FD 3L73E 2BCCJ 5GTIH 2PEJA 1RE4C 5AW6B 1MFZA 2AEMA 3OJAB 3Q5PA 1VDFA 3H1IG 1ZV8A 3IN6A 1NHLA 4GR6A 1P84D 2L5GB 2N98A 5AVTB 2LR2A 1FS0E 3A0BE 2G8YA 4PD4E 1NU1G 2PEMA 1QL2A 2YMKA 1KFNA 1KTMA 1SQXG 2FVEA 2L4BA 1VF5C 1UIIA 3H1IJ 4HJGH 4HKZH 1L0LE 1NKNA 4PJ0E 2OGUA 3H1LJ 1NTMK 1BCCG 2PEQA 1KYOE 1YJ9P 1OXZA 1NU1J 1SFCC 2BHVA 3L70D 2P1JA 1SQXJ 2ROQA 4K3AA 2K0DX 3H4EA 2B87A 1EC5A 2WZ7A 2HPCA 3S4RA 1PP9J 3A0HH 1FZCC 4KHXA 5CCHD 1BCCJ 4HKGA 2IBZG 1LTAC 4YXWH 3G1GA 1KQLA 2ZFCA 2BASA 1CSBA 2HODA 1Q7YQ 3SFDC 1RE3C 1R5LA 5HGNA 1KLPA 1Z6MA 1SQPD 1JTHB 4U0AA 1T8KA 4NEOA 4PV1D 3U59A 2VLPA 2W6AA 1JJ2O 2ZAEB 3CCSP 2JP3A 4H13D 1DH3A 3PRJA 2FBWC 1GMJA 1M57D 1S2EA 3LIDA 3H1JE 2PGDA 2WSSH 1N7SB 2D2CD 1EXJA 1P84I 2NPSC 1LT1A 2BQ1E 2QRXA 1Q90D 2OYHB 2XZ0D 3CCJP 3B5ND 2R5BA 3NMDA 3UIAA 3KPEA 4M3LA 1SQBK 2RH0A 1D1DA 1EDLA 4OGQC 4AUWA 4C7RA 2KZIA 1IFIA 2LXBA 2H89C 2IFMA 4RESB 2YKQA 4GDOA 1JB0J 3VMXA 1L0NE 2WSEH 2Y0DA 1S5LX 1PPJE 1DEEG 2K92A 1HTLC 1NTZD 2WWWA 5CJ0A 4R4MA 5F2KA 2ZXXA 3DS4A 2FVAA 3H1LD 2CWOA 1SQVG 4PH0A 3PP5A 1JY3P 1JMBA 2YKPA 4RJTA 2PNGA 5EFWB 2LKMA 4DCKA 2L22A 5CCHA 3TDKA 2WT7A 1HWTC 2VLOA 1N7SC 2YO2A 1M1JB 4WB4A 2OYHC 2QA4P 4U3FE 3SWKA 3TGUG 4WWIA 1ZW0A 4BRYB 1ZMEC 2FHSC 4WY4B 4PH1A 5KAFH 1NTKJ 2KS1B 3MTUE 3CC2P 1GXHA 1G2CA 2FACA 1T8ZA 4AQRD 1KQFB 1KILD 5HGLA 1P84E 1D7MA 2FYZA 4CPGA 1A8OA 1XTGB 1S4XA 1FZEA 3HTKA 3TGUJ 2CQ8A 1IFDA 2XT1A 2KW2A 1LWUA 5KP7B 1Q2NA 2RMZA 2KGAA 3HZQA 1RF1B 1PEQA 2Q3IA 2FFDA 1BAJA 4XFJA 5APTA 2E76B 1S3JA 2K1AA 5BVZA 3GLMA 4H0LB 3GZLA 3L70E 3DTJA 2K9YA 2V7QJ 1UJZA 4R0MA 3K5BA 2XV5A 1UIXA 4JYCA 1NJIQ 1GK6A 1EZVI 2KNCA 3H32A 1HBWA 2PEKA 3AE3C 4ZKPA 1L0HA 2OYIB 1LT9B 1CI6B 3PLNA 2QJYC 3B5NA 1LTJA 1OR5A 1JOCA 5AVSB 3TSIA 3O8ZA 2WSCJ 2B88A 1M1JC 2K3RA 1PEOA 2N1TD 1OFCX 2Q7CA 1SQPE 3CI9A 3WU2H 2OTKE 3RK2B 4EDFA 5AW0B 4DG9A 3QH9A 1IMPA 1JY3N 1OW8A 1LTTC 4JQ0D 3BRTB 1KORA 3CWBJ 3WUUA 1OVVA 3L72G 1L0NG 2XNDH 1PPJG 2PEOA 5APWA 2L0QA 2N50A 3L75D 1OWAA 3FX0A 1SP4A 1VQMP 1AV1A 4Z1MH 1T2KD 2N5HA 1IO4A 4A7PA 5CHXA 3L72J 5B66H 2YMYA 3CCMP 1KQGB 2MY5A 1DD3A 1N73B 3TK1A 2KSEA 3WMM0 2E76C 1L2PA 1DIPA 2LOLA 4H0LC 3EFGA 1CW5A 5E79H 1ZLLA 5KAFE 1FZBA 5AVVB 2W27A 2JWAA 1RHZB 3MP7B 5GTHE 3M0DA 4H44D 4HYTB 3OW2O 5JPAA 1LT9C 4WY4D 3JC22 2MJZA 2XDJA 2Q5UA 1BSHA 1JY2P 1NTMJ 3L4FA 3CCLP 3HUSA 2N9BA 1KILA 1NTKD 3WUTA 2LIUA 2YNYA 1EDKA 2K5XA 3RK2C 4N6JA 5APVA 1SQVK 1L4AB 4GR2A 1WRGA 3B4QA 2P9XA 1NTZE 2XZRA 2ZVOB 3HRNA 4I2LC 1Y9BA 2WPQA 1NAYA 1NKZB 3D6YA 2K0XA 1LJ2A 3BASA 2K88A 5CCGC 3H1LE 1E79H 3CXHI 4LLHA 3Q5RA 1EDJA 1IC2A 4EYYQ 1IFNA 3HE5B 3CCRP 2W90A 3MUDC 2KSJA 3RGUA 1N73C 1YQ4C 4EOTA 2K2QA 4EIJA 4UB8E 3G6EP 3H1HD 3AEFC 3V2QA 3P7KA 3CX5H 4K35A 3RK3B 3SWFA 4GOEA 3M06A 3JSVC 1JEKA 3AECC 2N1TA 1EDIA 2O1JA 1SQPG 2CPBA 2QJKB 2GUSA 2W8ZA 1RO2A 1K04A 1KILE 1M56D 1VL2A 2YXRB 2JKVA 3HE4A 2JWDA 4EI2A 1KYOI 4M0IA 3PHLA 5M1BA 4W80A 2FXOA 2QM7A 1GU5A 2M3EA 1W5CE 1IFMA 1K9MQ 2JEEA 1H0TB 1Y47A 1LP1B 1IFPA 1L4AC 1GW3A 4XRQA 4U0EA 1BE3D 1FC2C 1NYHA 1SQQD 2R3CA 3G21A 3L71J 2XZ1C 2KLUA 1GL2D 1JY2N 1PGPA 2W83C 3G28A 3LRYA 2L9FA 2OARA 1JCCA 5TISE 1E6JP 4O9BA 1OVUA 2RKLA 1H88A 2FY8A 2FYUG 5DJTB 2V7QH 1EZVG 4WY4A 3L74D 3P8MC 2L6EA 3RK3C 2FAEA 1L0NK 4KJMA 3VMYA 1QGKB 4I6MC 2LMLA 1IUQA 3S1KA 2A45G 3HD7D 1ACPA 2QJKC 5AW4B 3Q5SA 3O6QB 4ZNCA 2KUBA 2XNXA 3KYQA 3TNUB 5KLVD 2WSCH 2P2UA 1GDTA 2OTJP 2JYGA 2MF4A 3L75E 1RF1A 1HVVA 2E74D 1NO4A 3CL3D 2E5YA 1YBKA 1HH0A 2PRRA 1HF9A 1ZP0C 1X9VA 4WYMA 3EJEA 1FZFA 5B5EE 2PAJA 4LGDE 3CXCO 3H1KD 1L0IA 2NPSB 5KAIH 4RO0A 2Q1KA 4D6TD 1YQ3C 3E7KA 1KQSO 2M8LA 2OYIA 2FKWB 2ZT9B 4IOIH 2CGQA 2P67A 3NFQA 2E75B 1NH4A 3M0AA 1LGHB 1OIPA 4OGQB 4U0FA 2KGCA 2QG4A 1K05A 1NTKE 3Q1MA 3P8CD 1ZN5A 2KOSA 2YO3A 3VOPA 2Z5HA 2IZ0A 3A3YB 1SVFA 1VF5D 2DNWA 1VQ7P 1U7MA 2A06D 2IYPA 1KV4A 3B5NC 4U0DA 4U0CA 3BCCG 1QEXA 1SFCD 2QJPC 1GTWA 3LW5J 3QWOC 2JO1A 3M9QA 2EIAA 1S1CX 1RY3A 2AXTH 1SQBD 1W2BO 1GL2A 3L71D 2OYOA 3N7NA 3BCCJ 3DPHA 4JF7A 5GTIE 3G0VA 2R5DA 5H2FH 3VMAA 3H1HE 2M3BA 2GDWA 2M8PA 1BGYG 1SQPK 3B4SA 2DW3A 3GF3A 1MKMA 1T3JA 2MVVA 3L73G 2ZT9C 2AEFA 3AE7C 1SLQA 3GZMA 5C39A 1YITP 2E75C 2BCCD 2YIUC 5BS2A 3NXSA 3KDPB 1BGYJ 3S9OA 3EQ2A 3FGAD 3P05A 2FYNB 3VTPC 3HD7A 4ZKUA 1FOSF 3W68A 3PH0A 2H7HA 3L73J 3GHGA
chains in the Genus database with same CATH topology
3DS0A 4GR2A 5HGOA 2DGYA 1JJ2O 2PEJA 4XFXA 4U0FA 1PEOA 2P9XA 1A43A 2QEXP 2KODA 1PEMA 1ZMBA 3G28A 2JO0A 3CCSP 3LRYA 4XFYA 2E1MA 3DS3A 4COCA 3G29A 2OARA 3MGEA 1M1KQ 5F2NA 4GR6A 5I4TG 1E6JP 5HGMA 2LF4A 1VQLP 2BUOA 3E2DA 2QA4P 1M6EX 3HYBA 5DCKA 1VQ7P 1AUMA 1VQ9P 3CC7P 1KC8Q 2PEMA 1M6NA 1YI2P 1VQPP 1KD1Q 2PEOA 3CCRP 2L6EA 3CCVP 2PEIA 4U0DA 4PH1A 4U0CA 2JYLA 3G1IA 1VQ5P 3CCEP 3CC2P 1VQMP 3G6EP 1EIAA 3G71P 2OTLP 5HGLA 1IUQA 1VQ8P 1EOQA 2BQ1E 3NTEA 1A8OA 2Z45A 2PEQA 1YJ9P 1S72P 3CCJP 2EIAA 3CCMP 1VQKP 2EG5A 2BHVA 3CPWO 1N8RQ 1W2BO 2XT1A 1YJWP 3M1MA 1QRJA 3H4EA 2OTJP 1YIJP 3DPHA 1K8AQ 3HZQA 1K30A 5F2OA 1D1DA 2JYGA 3CCQP 3G0VA 2M8NA 1PEQA 1RO2A 3VRLC 2XV6A 2M8PA 2Z44A 3DS5A 1YHQP 1QVGO 1K73Q 1VQ6P 1BAJA 3H0DA 1Q86Q 3Q20A 1Q82Q 3DS1A 3G1GA 2ONTA 4M0IA 3WBHA 5BS1A 1RO0A 3CCUP 3DTJA 3OW2O 1M74A 5JPAA 3CMEP 4WYMA 4IPYA 2Z46A 4XROA 4COPA 1Q7YQ 1PEUA 1NJIQ 3CC4P 3G26A 4U0BA 1K9MQ 3RG6C 3DS2A 1YITP 3I55P 5BS2A 5HGNA 3CXCO 1M90Q 4QNBA 2EFJA 4XFZA 3CMAP 2PENA 3I56P 1VQOP 1VQNP 1RNIA 5F2KA 3CCLP 3P05A 3DS4A 4U0AA 1KQSO 2PEKA 2M8LA 3G4SP 1YJNP 4XRQA 1Q81Q 3H47A 2CWOA 4U0EA 4PH0A 3G21A 1QVFO 3CD6P 2PY8A 3B5IA 2XXMA 1VQ4P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW P;  1Q7Y Q;  1VQP P;  1KD1 Q;  1NJI Q;  2OTJ P;  1JJ2 O;  3CCR P;  1YIJ P;  3CC4 P;  3CCV P;  1K9M Q;  1K8A Q;  1YIT P;  3I55 P;  3CXC O;  2QEX P;  1KC8 Q;  3CCQ P;  1M90 Q;  3CMA P;  1VQ5 P;  3CCE P;  3I56 P;  3CC2 P;  1VQO P;  3CCS P;  3CCL P;  1VQN P;  1VQM P;  3G6E P;  3G71 P;  1M1K Q;  2OTL P;  1VQ8 P;  1KQS O;  3G4S P;  1YHQ P;  1YJN P;  1QVG O;  1K73 Q;  1Q81 Q;  1VQ6 P;  1Q86 Q;  1Q82 Q;  1YJ9 P;  1S72 P;  3CCJ P;  1VQL P;  1QVF O;  1VQK P;  3CCM P;  1VQ4 P;  3CCU P;  2QA4 P;  3CD6 P;  3CPW O;  1VQ7 P;  3OW2 O;  1VQ9 P;  3CC7 P;  1N8R Q;  1W2B O;  3CME P;  1YI2 P; 
#chains in the Genus database with same CATH topology
 1NWQ A;  2J59 M;  1X8Y A;  2QEX P;  1NOH A;  1LNQ A;  1L0L G;  2MVU A;  3H1I D;  3IAO A;  4QKO A;  5KAI E;  3A0H E;  1Z56 A;  2IDB A;  4L73 A;  4F37 A;  1BE3 E;  1FBM A;  1SQQ E;  2KXP B;  2N6Y A;  3VP8 A;  4RKU J;  1NU1 D;  2FYU K;  3LIE A;  1WMK A;  1SQX D;  1PIX A;  1FE6 A;  3II6 A;  1PP9 D;  1IK9 A;  2QJY B;  1EOQ A;  3AEB C;  1SQV J;  1BCC D;  1IFJ A;  1RE4 A;  3CPW O;  2VLQ A;  3EJB A;  1OW6 A;  3F89 A;  3M9H A;  3V6I A;  4LC1 A;  4OGQ D;  4B86 A;  1ZR4 A;  3L74 E;  3GKL C;  2GM4 A;  3R4Y A;  1NTZ K;  2JB0 A;  2M5A A;  1QVG O;  1K73 Q;  1IK7 A;  2KOR A;  2IBZ D;  2FYN C;  1RF0 C;  1X79 B;  4ASV A;  2KYV A;  5KLI C;  3P32 A;  2ZYG A;  1URQ C;  5KLV E;  1NGM B;  3VN0 A;  4R4L A;  3T97 B;  5KTB A;  2B9B A;  4QMA A;  4XA4 A;  2Y0C A;  1M7L A;  2Q6Q A;  2LPK A;  1CZQ A;  1VQN P;  1DV5 A;  2Q3E A;  1SFC A;  2N1T C;  2JU1 A;  3SFE C;  2Y9Z A;  2NO8 A;  3H47 A;  5AVU B;  2UWJ E;  2K94 A;  4NPF X;  2Q9I A;  3CD6 P;  2OQQ A;  4KT0 J;  3H1J G;  2DGY A;  2ITA A;  1FZC A;  1YYC A;  1GPJ A;  3H1K E;  5CJ4 A;  2IYO A;  4XE5 B;  2JO0 A;  2KI7 B;  1N7S D;  2A45 H;  4D6T E;  3B8E B;  2ZJS E;  1FJK A;  3A5T A;  5HGM A;  4GKG A;  3RL0 B;  1PL5 A;  1GU4 A;  1RE3 A;  2GZI A;  3V2N A;  2Y0E A;  1KC8 Q;  1YI2 P;  2J58 A;  2I1K A;  2B87 B;  1HQB A;  2HPC B;  1CEI A;  2EHT A;  1J1D B;  3P8C E;  4HB1 A;  1BXI A;  2K9J B;  2HLO A;  4IL6 H;  1UNK A;  2AF8 A;  1VQK P;  2JJL A;  1HGZ A;  5KJ7 C;  3EWK A;  2A06 E;  2WPS A;  2HOD B;  2C0X A;  1VKU A;  1DD4 A;  4I7Z B;  2M8N A;  1GK4 A;  1PZQ A;  2MKV A;  1H8A A;  2Z44 A;  2AEJ A;  1ZNV A;  2QVA A;  1BDD A;  5EJD A;  2WQY C;  5HVC A;  2M0B A;  1L0N J;  1X3O A;  1YTZ I;  1SQB E;  3CME P;  3L71 E;  4COP A;  1KB9 D;  3CX5 D;  3KXD A;  3AEE C;  4U0B A;  2JAZ A;  4ASW A;  5APY A;  1SS1 A;  3AE5 C;  3LW5 H;  2C9L Y;  3U1A A;  3F5H A;  2ZYD A;  2LIW A;  4CA3 A;  1SQV D;  2HFE D;  3RBX A;  4U3F G;  2WPT A;  2PY8 A;  3L74 G;  2KG8 A;  3RL0 C;  1KZU B;  2BCC E;  1PEM A;  5KKZ C;  1JTH A;  2G3A A;  1QL1 A;  5F2N A;  5I4T G;  2CK3 H;  1L0L K;  2N6Z A;  4OVN F;  1MUU A;  1IJD B;  1J1D C;  4U3F J;  1T6A A;  5AW7 B;  1R5S A;  5KLV G;  2IX7 C;  2R3S A;  1AUM A;  2O1K A;  1USE A;  4L75 A;  3TGU D;  1IZN B;  1FDI A;  1VQ5 P;  3CCE P;  3CXH H;  3H1I E;  1EIA A;  2OTL P;  2O01 J;  4I7Z C;  2WMM A;  2E76 D;  1A02 F;  3CLQ A;  1S72 P;  4H0L D;  3L70 G;  2MR7 A;  3IFM A;  4AYC A;  1NQ4 A;  4Y28 J;  3VYI A;  1NU1 E;  3A7O A;  1YJW P;  1YIJ P;  1SQX E;  2LL8 A;  1N7S A;  2KWL A;  2GZE A;  2XV6 A;  1PP9 E;  2WVR A;  2OYH A;  2KOP A;  3IR9 A;  5KP6 B;  2GZG A;  3L70 J;  3WU2 E;  1JUN A;  1PGO A;  4PD4 H;  1BCC E;  2V4H A;  3V2R A;  3SSU A;  3WBH A;  1KB9 H;  2MD9 A;  1RQU A;  1BDC A;  4BPH A;  3DS2 A;  2E5T A;  2XU6 A;  3I56 P;  3VMZ A;  1R8E A;  1RNI A;  3RK2 D;  1YJN P;  5AVQ B;  4I1L A;  1FZA A;  2IBZ E;  2KG9 A;  5APQ A;  5AW3 B;  4DZO A;  3CX5 I;  5B66 E;  4C7N B;  3CWB D;  1SQP J;  3C1L A;  2KR5 A;  3D70 A;  2RN0 A;  2KOD A;  2LTE A;  1G2C B;  3A2A A;  1MZ8 A;  5E79 E;  1OVR A;  1HY8 A;  4H2W C;  2KIK A;  4MRT C;  5AVX B;  2LF4 A;  2BUO A;  5AVY B;  4PV1 B;  1M6E X;  4U7J A;  2ZXE B;  1M6N A;  3L72 D;  5KP8 B;  1VQP P;  1LWU B;  3N4X A;  4W7Y A;  1PPJ D;  4MN4 C;  2N5I A;  1FU1 A;  3AED C;  7CEI A;  4H13 B;  1HJB A;  2IFN A;  1M1J A;  2NRG A;  1XTC C;  4C46 A;  2GZF A;  2PP6 A;  2XKM A;  5HV8 A;  3GW6 A;  2EG5 A;  2FAD A;  2HYN A;  1AFO A;  3M1M A;  2WSF J;  1QRJ A;  4BRY A;  1RQV A;  2QE7 H;  2KS1 A;  3LMO A;  3RBZ A;  1LTS C;  1N86 A;  4HH2 A;  3GG2 A;  4UHP B;  4PWV B;  1FAV A;  2KNC B;  3PTZ A;  1NTM D;  2D2C B;  3H32 B;  3H0D A;  3EFF K;  2FYU J;  3DS1 A;  3VP9 A;  3M91 A;  5CCH C;  3B5N B;  1SQQ K;  3KZI H;  1LTJ B;  1L4A D;  3T97 A;  4ZMD A;  2Z5I A;  3CC4 P;  2R32 A;  1NTZ G;  2QJP B;  4QNB A;  2EFJ A;  1OW7 A;  3E1I A;  4JBZ A;  1FDM A;  3AE9 C;  2FVF A;  2GYK A;  3JCU H;  3H1L G;  1X22 A;  2Y9Y A;  4N78 D;  1TU3 F;  1G1J A;  3E1R A;  1QVF O;  3AE6 C;  2KGE A;  1KB9 E;  3CX5 E;  1NTZ J;  4PV1 C;  3G3Z A;  3MGN A;  3AEG C;  4BPF A;  1PP9 G;  1LWU C;  3WUV A;  3MGE A;  1QX8 A;  2KK7 A;  3CE7 A;  5K5G B;  1LT9 A;  2E42 A;  1CI6 A;  1SQV E;  3RK3 D;  2SPZ A;  4H13 C;  3Q3D A;  2FFD C;  2KOQ A;  5DCK A;  2YIU B;  2ZVN B;  2W6B A;  1KD1 Q;  1NVO A;  5KLV K;  1S9K D;  5CZD B;  3G9R A;  2CPS A;  3FXE A;  1VQ8 P;  2K9J A;  5AW9 B;  2K0Y A;  1E5W A;  1ZRT D;  2AXC A;  4L76 A;  2POH A;  2D2C C;  1NAF A;  2VRS A;  4IFM A;  3C8V A;  3OAK A;  3TGU E;  2GDX A;  1LTJ C;  2W6J H;  3L36 A;  3PJS K;  5CCG A;  2CNR A;  1W2E A;  3B71 A;  2I8D A;  3HUS B;  1VPC A;  1KIL B;  2CG5 B;  3MUD A;  1N73 A;  1RH5 B;  1S5L H;  1JMM A;  1BSN A;  1AYI A;  1J2J B;  1QLE D;  4NPE A;  1P84 H;  3CMA P;  1J1E B;  1ZOY C;  1KFM A;  2O01 H;  1AQT A;  1ZXG A;  1N7L A;  4DJG A;  3KHU A;  3AE1 C;  1OMI A;  2JBG A;  3U43 A;  3KZI E;  2BEQ D;  1A43 A;  1HGV A;  3V5B A;  4XFY A;  3DS3 A;  3V2P A;  3GF7 A;  1MV8 A;  1M1K Q;  2FXM A;  1T3U A;  2X2B A;  5KLI B;  1URQ B;  3JCU E;  5AW8 B;  2FYU D;  5CBN A;  3HYB A;  1AVY A;  2FQ0 A;  1L4A A;  4IZ6 A;  1M8O B;  3I5C A;  1EZV D;  3CWB E;  3L75 G;  2N1T B;  3M0D C;  3G71 P;  1JO5 A;  3HE4 B;  3NTE A;  4PXH B;  2K93 A;  3HUS C;  1KIL C;  5AVW B;  4YTP C;  4L74 A;  3L72 E;  3HE5 A;  3L75 J;  1JNM A;  2FQ1 A;  3AEA C;  1L0L J;  2NPS D;  3CCQ P;  4YXD C;  2BEZ F;  1YHQ P;  1HUC A;  2ZT9 D;  3D71 A;  1J1E C;  1X0T A;  1AVO A;  2PFX A;  2C0W A;  2ONT A;  2E75 D;  3CCU P;  1GXG A;  1M74 A;  2ERH A;  1OZH A;  2KOO A;  1EQ7 A;  3I55 P;  3M9B A;  1NTK G;  3FXD A;  1Y8A A;  4DT0 A;  1NTM E;  1FDO A;  2AFE A;  1Q81 Q;  3OA7 A;  2WPV B;  5BU8 B;  1G1I A;  3L37 A;  4H44 B;  3EJD A;  2GA1 A;  4C7N A;  1KMI Z;  1S5L E;  2WSF H;  2P10 A;  2P58 A;  1H0T A;  4XFX A;  1NU1 K;  2AXT E;  1LP1 A;  2KP8 A;  1SQX K;  1OX3 A;  5GTH H;  1FR2 A;  5TJH A;  1DNY A;  5H2F E;  2E43 A;  4N78 E;  4WVZ A;  1VHN A;  1GW4 A;  3V4Q A;  1VQ9 P;  3CC7 P;  2K37 A;  5APU A;  4OWF A;  3ZDM A;  1AF8 A;  2ZYA A;  1PGQ A;  1HJ0 A;  4OH8 B;  1E0H A;  3BCC D;  4UB6 H;  3H1H G;  3NY7 B;  2AVA A;  3H6P A;  3BAT A;  2WIT A;  5AW2 B;  2J5U A;  2O3J A;  3RK3 E;  5EW5 E;  3H1J J;  1T2K C;  2WTY A;  3MIW A;  5KKZ B;  1S9K E;  1K30 A;  2VSQ A;  2KOG A;  3H1H J;  2JR8 A;  1FZG A;  2C9N Y;  1GD2 E;  3V4W A;  2LXC B;  1URQ D;  1BGY D;  2A45 I;  4JYB A;  3O6Q A;  3CXH D;  1ZRT E;  3TNU A;  1MZ9 A;  2NZ2 A;  2IZ1 A;  2YKO A;  3CWB G;  3L73 D;  1PEU A;  2Z46 A;  3MZW B;  1KN7 A;  4UB8 H;  5AW5 B;  3GJN A;  4H44 C;  1N2D C;  1M90 Q;  2LKI A;  5AVR B;  1FJP A;  4WY4 C;  1JY3 O;  3AE4 C;  1EMV A;  1BE3 G;  3D6Z A;  1SQQ G;  1H89 A;  2KB7 P;  3B5I A;  4PD4 D;  1VQ6 P;  3DS0 A;  1LTI C;  3L35 A;  2NPS A;  1ZMB A;  4COC A;  1L0L D;  3G29 A;  1BE3 J;  1SQQ J;  1RF1 C;  1AJY A;  3ITK A;  1KYO D;  1VQL P;  2IBZ I;  1U7J A;  3C9I A;  4BPG A;  5APS A;  1AQ5 A;  2VLN A;  1GL2 B;  2FQ2 A;  3AE8 C;  1LTB C;  1GZL A;  2JYL A;  2M8R A;  3MHV A;  1NTM G;  2QSI A;  2O01 N;  2HG5 D;  3NTN A;  5KJ7 D;  2WPR A;  1A02 J;  4H2Y C;  3FWL A;  1PGJ A;  2Z45 A;  4GOD A;  1YTZ T;  2FYU E;  1JM0 A;  4H2X C;  3L74 J;  2OYI C;  3R2P A;  4IL6 X;  1EZV E;  4GT1 A;  4TLF A;  4Y99 B;  5CBO A;  5TIS H;  2YXQ B;  2KG6 A;  3IF4 A;  2R44 A;  3DS5 A;  4UB6 E;  2I1J A;  1DX7 A;  3HD7 B;  1Q86 Q;  2H88 C;  5KLV J;  1USD A;  2B89 A;  5DJU B;  5AVZ B;  1RO0 A;  3GHG B;  2N9Y B;  2JU2 A;  3ABV C;  3G26 A;  4GIF A;  3RG6 C;  3H1K G;  2EHS A;  3Q2Y A;  2GZJ A;  3TF5 A;  4BXL A;  1VQO P;  4D6T G;  2E74 B;  3BVH A;  2KGD A;  1MFT A;  1U57 A;  4N3Y B;  3G4S P;  1ZR2 A;  3RL0 D;  1NTK K;  3A0B H;  2H43 A;  2QNW A;  4NPD A;  3AE2 C;  2KZJ A;  4IL6 E;  1LTG C;  1VQ4 P;  5APX A;  4JPZ B;  3H1K J;  5HGO A;  2JGP A;  3H1J D;  4D6T J;  3RG2 A;  4PJ0 H;  5L8R J;  3U1C A;  2E1M A;  1GL2 C;  2KLV A;  1RF0 A;  5AW1 B;  1KYO H;  1WT6 A;  4W7Z A;  1URQ A;  1AA0 A;  4DOJ A;  2MR8 A;  2WT7 B;  2QM8 A;  5CMZ A;  3E2D A;  1IMQ A;  2A06 G;  4IFD K;  5B5E H;  4PD4 I;  3FWN A;  3MD0 A;  1F80 D;  1KB9 I;  3CCV P;  2WSE J;  2PEI A;  2JDI H;  2GDY A;  3G1I A;  5CCG D;  5BU5 A;  1EXI A;  2H8P D;  2IPP A;  3RL0 g;  4WBA A;  2M5A B;  4Y99 C;  2Z4E A;  1PFI A;  2JQ4 A;  2FXP A;  1VF5 B;  3W67 A;  1SQB G;  3GMA A;  3HD7 C;  3L71 G;  3HTK B;  2M5R A;  1N8R Q;  1L0N D;  1PV3 A;  1K8A Q;  3GHG C;  5F2O A;  3KQG A;  3SWY A;  3BCC E;  3VRL C;  1SFC B;  4YPC A;  2AFD A;  1DEB A;  2FFD B;  3Q20 A;  2E74 C;  1FOS E;  1Q82 Q;  3TYY A;  1SQB J;  5BS1 A;  1JY2 O;  4IPY A;  4XRO A;  4BWN A;  1FZC B;  2HR3 A;  2BCC G;  2L91 A;  3USS A;  4IFF A;  4XFZ A;  2PEN A;  4TT3 H;  2GUV A;  2P7J A;  5KJ7 A;  3H25 A;  1BGY E;  3CXH E;  3BRV B;  4GOF A;  2QIW A;  2XXM A;  1JCD A;  4U3F D;  3L73 E;  2BCC J;  5GTI H;  2PEJ A;  1RE4 C;  5AW6 B;  1MFZ A;  2AEM A;  3OJA B;  3Q5P A;  1VDF A;  3H1I G;  1ZV8 A;  3IN6 A;  1NHL A;  4GR6 A;  1P84 D;  2L5G B;  2N98 A;  5AVT B;  2LR2 A;  1FS0 E;  3A0B E;  2G8Y A;  4PD4 E;  1NU1 G;  2PEM A;  1QL2 A;  2YMK A;  1KFN A;  1KTM A;  1SQX G;  2FVE A;  2L4B A;  1VF5 C;  1UII A;  3H1I J;  4HJG H;  4HKZ H;  1L0L E;  1NKN A;  4PJ0 E;  2OGU A;  3H1L J;  1NTM K;  1BCC G;  2PEQ A;  1KYO E;  1YJ9 P;  1OXZ A;  1NU1 J;  1SFC C;  2BHV A;  3L70 D;  2P1J A;  1SQX J;  2ROQ A;  4K3A A;  2K0D X;  3H4E A;  2B87 A;  1EC5 A;  2WZ7 A;  2HPC A;  3S4R A;  1PP9 J;  3A0H H;  1FZC C;  4KHX A;  5CCH D;  1BCC J;  4HKG A;  2IBZ G;  1LTA C;  4YXW H;  3G1G A;  1KQL A;  2ZFC A;  2BAS A;  1CSB A;  2HOD A;  1Q7Y Q;  3SFD C;  1RE3 C;  1R5L A;  5HGN A;  1KLP A;  1Z6M A;  1SQP D;  1JTH B;  4U0A A;  1T8K A;  4NEO A;  4PV1 D;  3U59 A;  2VLP A;  2W6A A;  1JJ2 O;  2ZAE B;  3CCS P;  2JP3 A;  4H13 D;  1DH3 A;  3PRJ A;  2FBW C;  1GMJ A;  1M57 D;  1S2E A;  3LID A;  3H1J E;  2PGD A;  2WSS H;  1N7S B;  2D2C D;  1EXJ A;  1P84 I;  2NPS C;  1LT1 A;  2BQ1 E;  2QRX A;  1Q90 D;  2OYH B;  2XZ0 D;  3CCJ P;  3B5N D;  2R5B A;  3NMD A;  3UIA A;  3KPE A;  4M3L A;  1SQB K;  2RH0 A;  1D1D A;  1EDL A;  4OGQ C;  4AUW A;  4C7R A;  2KZI A;  1IFI A;  2LXB A;  2H89 C;  2IFM A;  4RES B;  2YKQ A;  4GDO A;  1JB0 J;  3VMX A;  1L0N E;  2WSE H;  2Y0D A;  1S5L X;  1PPJ E;  1DEE G;  2K92 A;  1HTL C;  1NTZ D;  2WWW A;  5CJ0 A;  4R4M A;  5F2K A;  2ZXX A;  3DS4 A;  2FVA A;  3H1L D;  2CWO A;  1SQV G;  4PH0 A;  3PP5 A;  1JY3 P;  1JMB A;  2YKP A;  4RJT A;  2PNG A;  5EFW B;  2LKM A;  4DCK A;  2L22 A;  5CCH A;  3TDK A;  2WT7 A;  1HWT C;  2VLO A;  1N7S C;  2YO2 A;  1M1J B;  4WB4 A;  2OYH C;  2QA4 P;  4U3F E;  3SWK A;  3TGU G;  4WWI A;  1ZW0 A;  4BRY B;  1ZME C;  2FHS C;  4WY4 B;  4PH1 A;  5KAF H;  1NTK J;  2KS1 B;  3MTU E;  3CC2 P;  1GXH A;  1G2C A;  2FAC A;  1T8Z A;  4AQR D;  1KQF B;  1KIL D;  5HGL A;  1P84 E;  1D7M A;  2FYZ A;  4CPG A;  1A8O A;  1XTG B;  1S4X A;  1FZE A;  3HTK A;  3TGU J;  2CQ8 A;  1IFD A;  2XT1 A;  2KW2 A;  1LWU A;  5KP7 B;  1Q2N A;  2RMZ A;  2KGA A;  3HZQ A;  1RF1 B;  1PEQ A;  2Q3I A;  2FFD A;  1BAJ A;  4XFJ A;  5APT A;  2E76 B;  1S3J A;  2K1A A;  5BVZ A;  3GLM A;  4H0L B;  3GZL A;  3L70 E;  3DTJ A;  2K9Y A;  2V7Q J;  1UJZ A;  4R0M A;  3K5B A;  2XV5 A;  1UIX A;  4JYC A;  1NJI Q;  1GK6 A;  1EZV I;  2KNC A;  3H32 A;  1HBW A;  2PEK A;  3AE3 C;  4ZKP A;  1L0H A;  2OYI B;  1LT9 B;  1CI6 B;  3PLN A;  2QJY C;  3B5N A;  1LTJ A;  1OR5 A;  1JOC A;  5AVS B;  3TSI A;  3O8Z A;  2WSC J;  2B88 A;  1M1J C;  2K3R A;  1PEO A;  2N1T D;  1OFC X;  2Q7C A;  1SQP E;  3CI9 A;  3WU2 H;  2OTK E;  3RK2 B;  4EDF A;  5AW0 B;  4DG9 A;  3QH9 A;  1IMP A;  1JY3 N;  1OW8 A;  1LTT C;  4JQ0 D;  3BRT B;  1KOR A;  3CWB J;  3WUU A;  1OVV A;  3L72 G;  1L0N G;  2XND H;  1PPJ G;  2PEO A;  5APW A;  2L0Q A;  2N50 A;  3L75 D;  1OWA A;  3FX0 A;  1SP4 A;  1VQM P;  1AV1 A;  4Z1M H;  1T2K D;  2N5H A;  1IO4 A;  4A7P A;  5CHX A;  3L72 J;  5B66 H;  2YMY A;  3CCM P;  1KQG B;  2MY5 A;  1DD3 A;  1N73 B;  3TK1 A;  2KSE A;  3WMM 0;  2E76 C;  1L2P A;  1DIP A;  2LOL A;  4H0L C;  3EFG A;  1CW5 A;  5E79 H;  1ZLL A;  5KAF E;  1FZB A;  5AVV B;  2W27 A;  2JWA A;  1RHZ B;  3MP7 B;  5GTH E;  3M0D A;  4H44 D;  4HYT B;  3OW2 O;  5JPA A;  1LT9 C;  4WY4 D;  3JC2 2;  2MJZ A;  2XDJ A;  2Q5U A;  1BSH A;  1JY2 P;  1NTM J;  3L4F A;  3CCL P;  3HUS A;  2N9B A;  1KIL A;  1NTK D;  3WUT A;  2LIU A;  2YNY A;  1EDK A;  2K5X A;  3RK2 C;  4N6J A;  5APV A;  1SQV K;  1L4A B;  4GR2 A;  1WRG A;  3B4Q A;  2P9X A;  1NTZ E;  2XZR A;  2ZVO B;  3HRN A;  4I2L C;  1Y9B A;  2WPQ A;  1NAY A;  1NKZ B;  3D6Y A;  2K0X A;  1LJ2 A;  3BAS A;  2K88 A;  5CCG C;  3H1L E;  1E79 H;  3CXH I;  4LLH A;  3Q5R A;  1EDJ A;  1IC2 A;  4EYY Q;  1IFN A;  3HE5 B;  3CCR P;  2W90 A;  3MUD C;  2KSJ A;  3RGU A;  1N73 C;  1YQ4 C;  4EOT A;  2K2Q A;  4EIJ A;  4UB8 E;  3G6E P;  3H1H D;  3AEF C;  3V2Q A;  3P7K A;  3CX5 H;  4K35 A;  3RK3 B;  3SWF A;  4GOE A;  3M06 A;  3JSV C;  1JEK A;  3AEC C;  2N1T A;  1EDI A;  2O1J A;  1SQP G;  2CPB A;  2QJK B;  2GUS A;  2W8Z A;  1RO2 A;  1K04 A;  1KIL E;  1M56 D;  1VL2 A;  2YXR B;  2JKV A;  3HE4 A;  2JWD A;  4EI2 A;  1KYO I;  4M0I A;  3PHL A;  5M1B A;  4W80 A;  2FXO A;  2QM7 A;  1GU5 A;  2M3E A;  1W5C E;  1IFM A;  1K9M Q;  2JEE A;  1H0T B;  1Y47 A;  1LP1 B;  1IFP A;  1L4A C;  1GW3 A;  4XRQ A;  4U0E A;  1BE3 D;  1FC2 C;  1NYH A;  1SQQ D;  2R3C A;  3G21 A;  3L71 J;  2XZ1 C;  2KLU A;  1GL2 D;  1JY2 N;  1PGP A;  2W83 C;  3G28 A;  3LRY A;  2L9F A;  2OAR A;  1JCC A;  5TIS E;  1E6J P;  4O9B A;  1OVU A;  2RKL A;  1H88 A;  2FY8 A;  2FYU G;  5DJT B;  2V7Q H;  1EZV G;  4WY4 A;  3L74 D;  3P8M C;  2L6E A;  3RK3 C;  2FAE A;  1L0N K;  4KJM A;  3VMY A;  1QGK B;  4I6M C;  2LML A;  1IUQ A;  3S1K A;  2A45 G;  3HD7 D;  1ACP A;  2QJK C;  5AW4 B;  3Q5S A;  3O6Q B;  4ZNC A;  2KUB A;  2XNX A;  3KYQ A;  3TNU B;  5KLV D;  2WSC H;  2P2U A;  1GDT A;  2OTJ P;  2JYG A;  2MF4 A;  3L75 E;  1RF1 A;  1HVV A;  2E74 D;  1NO4 A;  3CL3 D;  2E5Y A;  1YBK A;  1HH0 A;  2PRR A;  1HF9 A;  1ZP0 C;  1X9V A;  4WYM A;  3EJE A;  1FZF A;  5B5E E;  2PAJ A;  4LGD E;  3CXC O;  3H1K D;  1L0I A;  2NPS B;  5KAI H;  4RO0 A;  2Q1K A;  4D6T D;  1YQ3 C;  3E7K A;  1KQS O;  2M8L A;  2OYI A;  2FKW B;  2ZT9 B;  4IOI H;  2CGQ A;  2P67 A;  3NFQ A;  2E75 B;  1NH4 A;  3M0A A;  1LGH B;  1OIP A;  4OGQ B;  4U0F A;  2KGC A;  2QG4 A;  1K05 A;  1NTK E;  3Q1M A;  3P8C D;  1ZN5 A;  2KOS A;  2YO3 A;  3VOP A;  2Z5H A;  2IZ0 A;  3A3Y B;  1SVF A;  1VF5 D;  2DNW A;  1VQ7 P;  1U7M A;  2A06 D;  2IYP A;  1KV4 A;  3B5N C;  4U0D A;  4U0C A;  3BCC G;  1QEX A;  1SFC D;  2QJP C;  1GTW A;  3LW5 J;  3QWO C;  2JO1 A;  3M9Q A;  2EIA A;  1S1C X;  1RY3 A;  2AXT H;  1SQB D;  1W2B O;  1GL2 A;  3L71 D;  2OYO A;  3N7N A;  3BCC J;  3DPH A;  4JF7 A;  5GTI E;  3G0V A;  2R5D A;  5H2F H;  3VMA A;  3H1H E;  2M3B A;  2GDW A;  2M8P A;  1BGY G;  1SQP K;  3B4S A;  2DW3 A;  3GF3 A;  1MKM A;  1T3J A;  2MVV A;  3L73 G;  2ZT9 C;  2AEF A;  3AE7 C;  1SLQ A;  3GZM A;  5C39 A;  1YIT P;  2E75 C;  2BCC D;  2YIU C;  5BS2 A;  3NXS A;  3KDP B;  1BGY J;  3S9O A;  3EQ2 A;  3FGA D;  3P05 A;  2FYN B;  3VTP C;  3HD7 A;  4ZKU A;  1FOS F;  3W68 A;  3PH0 A;  2H7H A;  3L73 J;  3GHG A; 
#chains in the Genus database with same CATH homology
 3DS0 A;  4GR2 A;  5HGO A;  2DGY A;  1JJ2 O;  2PEJ A;  4XFX A;  4U0F A;  1PEO A;  2P9X A;  1A43 A;  2QEX P;  2KOD A;  1PEM A;  1ZMB A;  3G28 A;  2JO0 A;  3CCS P;  3LRY A;  4XFY A;  2E1M A;  3DS3 A;  4COC A;  3G29 A;  2OAR A;  3MGE A;  1M1K Q;  5F2N A;  4GR6 A;  5I4T G;  1E6J P;  5HGM A;  2LF4 A;  1VQL P;  2BUO A;  3E2D A;  2QA4 P;  1M6E X;  3HYB A;  5DCK A;  1VQ7 P;  1AUM A;  1VQ9 P;  3CC7 P;  1KC8 Q;  2PEM A;  1M6N A;  1YI2 P;  1VQP P;  1KD1 Q;  2PEO A;  3CCR P;  2L6E A;  3CCV P;  2PEI A;  4U0D A;  4PH1 A;  4U0C A;  2JYL A;  3G1I A;  1VQ5 P;  3CCE P;  3CC2 P;  1VQM P;  3G6E P;  1EIA A;  3G71 P;  2OTL P;  5HGL A;  1IUQ A;  1VQ8 P;  1EOQ A;  2BQ1 E;  3NTE A;  1A8O A;  2Z45 A;  2PEQ A;  1YJ9 P;  1S72 P;  3CCJ P;  2EIA A;  3CCM P;  1VQK P;  2EG5 A;  2BHV A;  3CPW O;  1N8R Q;  1W2B O;  2XT1 A;  1YJW P;  3M1M A;  1QRJ A;  3H4E A;  2OTJ P;  1YIJ P;  3DPH A;  1K8A Q;  3HZQ A;  1K30 A;  5F2O A;  1D1D A;  2JYG A;  3CCQ P;  3G0V A;  2M8N A;  1PEQ A;  1RO2 A;  3VRL C;  2XV6 A;  2M8P A;  2Z44 A;  3DS5 A;  1YHQ P;  1QVG O;  1K73 Q;  1VQ6 P;  1BAJ A;  3H0D A;  1Q86 Q;  3Q20 A;  1Q82 Q;  3DS1 A;  3G1G A;  2ONT A;  4M0I A;  3WBH A;  5BS1 A;  1RO0 A;  3CCU P;  3DTJ A;  3OW2 O;  1M74 A;  5JPA A;  3CME P;  4WYM A;  4IPY A;  2Z46 A;  4XRO A;  4COP A;  1Q7Y Q;  1PEU A;  1NJI Q;  3CC4 P;  3G26 A;  4U0B A;  1K9M Q;  3RG6 C;  3DS2 A;  1YIT P;  3I55 P;  5BS2 A;  5HGN A;  3CXC O;  1M90 Q;  4QNB A;  2EFJ A;  4XFZ A;  3CMA P;  2PEN A;  3I56 P;  1VQO P;  1VQN P;  1RNI A;  5F2K A;  3CCL P;  3P05 A;  3DS4 A;  4U0A A;  1KQS O;  2PEK A;  2M8L A;  3G4S P;  1YJN P;  4XRQ A;  1Q81 Q;  3H47 A;  2CWO A;  4U0E A;  4PH0 A;  3G21 A;  1QVF O;  3CD6 P;  2PY8 A;  3B5I A;  2XXM A;  1VQ4 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...