1VQPP

The structure of the transition state analogue "rap" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 49
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqpP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqpP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqpP02
1K8AQ 1VQNP 3CC4P 1VQMP 3OW2O 3CD6P 1YITP 3G6EP 1VQ4P 3I55P 1S72P 1KD1Q 1NJIQ 1VQKP 1QVFO 1Q81Q 2OTLP 1N8RQ 3I56P 1VQ9P 1VQLP 3CC7P 2OTJP 3CXCO 3CCQP 1VQOP 3G4SP 3CMEP 1Q7YQ 3CCUP 1YI2P 3CCVP 1K9MQ 3CCRP 1W2BO 2QA4P 3CCMP 1YHQP 3CPWO 1JJ2O 1Q86Q 3CMAP 2QEXP 1YJ9P 3CCEP 1KQSO 1YJWP 3CC2P 1YJNP 1VQPP 1VQ5P 1KC8Q 3CCSP 1VQ7P 1YIJP 1QVGO 1K73Q 1VQ6P 3CCJP 1M90Q 1VQ8P 3CCLP 1M1KQ 1Q82Q 3G71P
chains in the Genus database with same CATH superfamily
3U59A 4U7JA 1CI6B 2WZ7A 2E76C 4EOTA 1OVRA 4KJMA 4GIFA 5AW8B 4U0EA 1FE6A 5CCHA 2QJKC 3V6IA 1S4XA 2KP8A 1EDLA 3H1JJ 5CCGC 5CCGA 2VLNA 1PEUA 2UWJE 4HKZH 2WPVB 2KI7B 4UB6E 3M91A 4KHXA 5GTHE 3CWBE 4U0DA 3HD7C 1ZXGA 3HD7A 1T2KD 4HB1A 2IPPA 2FQ2A 1SQBE 3H1JD 1U7MA 2N6YA 1N7SD 3L71G 3TYYA 1HTLC 5AVWB 5B5EE 1NTMJ 3IF4A 2PAJA 1KV4A 1UIIA 3GZMA 3M0DC 4L73A 2Z5HA 3AEEC 2V7QH 1VDFA 4PJ0H 1X8YA 3AECC 1F80D 4H2XC 3B5NC 2K88A 3B5NA 3RL0C 2O01H 3U1CA 2LKMA 1PP9G 3AEBC 3BATA 4PV1D 1SQPE 1T2KC 3RK3C 1NWQA 2FHSC 2FXPA 3E1IA 1N7SC 4BWNA 1N7SA 2WSFJ 1VF5C 1M57D 1LTJB 3FXEA 3CX5I 1K04A 2OARA 3O8ZA 3GW6A 3BRTB 3G1GA 2C0XA 2M8RA 1KQSO 1JEKA 2CK3H 3CWBG 4I2LC 3L70E 4ASWA 2YIUC 1ZN5A 4IL6E 3KZIH 3VMAA 1SQBG 1Y9BA 1JMMA 1HWTC 1PZQA 4PV1C 1S1CX 2E74C 3TNUA 2GDXA 1KMIZ 3H1ID 3ZDMA 4ASVA 2C9LY 2YXRB 5APXA 3DS2A 2BCCE 1SQPK 2WTYA 2KZIA 2XU6A 3I56P 7CEIA 1GXHA 2P10A 1SQPG 1IFJA 2OYHC 3K5BA 5KJ7D 1LTAC 2Z45A 1EC5A 1FBMA 1L0LJ 2LL8A 1PGQA 1KQLA 2WWWA 3M1MA 4H44D 3WUVA 2MR7A 1HQBA 1PGPA 1YTZI 3CCVP 1KB9D 2Q3EA 3L70G 3H25A 3RG2A 3PTZA 3CCLP 2VRSA 2P67A 2IYPA 5B66H 2GZEA 2JAZA 2ONTA 1FOSE 3RK3E 2FVAA 3H1JE 2BCCG 2HODA 2Q7CA 2I1KA 4H0LB 4H44C 2W8ZA 1S9KD 1NO4A 4ZNCA 2BUOA 1N2DC 1NAFA 5KKZC 1S5LE 1N73A 4QMAA 4LGDE 3CC7P 5AW4B 3C9IA 4JYBA 4XRQA 4WYMA 1GL2C 2FYUJ 2YO2A 1DIPA 5CJ4A 1NTME 3Q3DA 4Z1MH 2BEQD 2GM4A 2HG5D 1E6JP 1IO4A 5HGOA 3HTKA 1W2EA 2ZFCA 4OGQD 3GLMA 2OGUA 1ZLLA 3A0HE 2BQ1E 1Q90D 2IBZD 3CMAP 1WMKA 2E43A 2H7HA 2WPTA 1FDOA 2RH0A 4WY4D 5HV8A 5BVZA 2OTJP 4JF7A 3V4QA 1QRJA 3C8VA 1JTHB 2H8PD 1NTMK 2ZVOB 2FYNC 4OGQC 1NU1G 2XV5A 3FGAD 2J5UA 2ZXEB 4IFFA 5AVUB 1NTMG 4GOFA 3EJDA 5BS1A 2K0YA 3D70A 3DS3A 2IZ1A 2QJYB 2P2UA 4IL6X 2OYIC 3G9RA 1RF1A 2AXTE 1BCCJ 4WY4A 1P84E 3MUDC 4ZMDA 5AVVB 2POHA 2JU1A 2OTKE 1IUQA 1BCCD 1QGKB 2HFED 1AA0A 1Q7YQ 1AF8A 3RGUA 5AVXB 1UNKA 1L0LE 1NH4A 2R3CA 2ROQA 1M1KQ 2P1JA 1KYOH 2JKVA 2E75D 2N6ZA 2LF4A 5AW2B 5KAFH 1KTMA 4R4MA 3MGEA 2H89C 5DCKA 5KLIC 5KLVE 4IZ6A 2QJPC 1BSHA 1S9KE 3L74J 3GF7A 2B87B 1GXGA 2JEEA 1ZNVA 1K05A 3EQ2A 2H88C 1LTBC 1BAJA 2PP6A 2KS1B 2E75C 5JPAA 3VMXA 3L74D 1FAVA 4GDOA 2AXCA 3P7KA 2N1TB 2K0XA 1ZW0A 3M06A 1VQ5P 1L0LK 3HUSB 1RY3A 2FYUE 1VKUA 3B5IA 1CI6A 2K9YA 4C7NB 1L0LG 2HYNA 1RQVA 3FWNA 4XFZA 3DS5A 1YJWP 3B8EB 1AV1A 3B4SA 1LT9B 5APTA 1VQ4P 5KLVG 2E42A 3DPHA 5AW7B 3PP5A 1KLPA 1JJ2O 2GA1A 1QEXA 1ZRTD 1IK7A 2JP3A 1YIJP 1USDA 4RJTA 2W6BA 2D2CC 3LW5H 2FYUK 5HVCA 1LTSC 2O01J 3KYQA 2FFDB 1KYOI 1KILD 1TU3F 3D6ZA 4LLHA 3A5TA 2FYUG 1GDTA 3UIAA 1DD3A 3H1LJ 2GZJA 3EFGA 1XTCC 2VLQA 5APVA 1JOCA 2Y0EA 2VSQA 1LTJC 2QIWA 1LTJA 1IFNA 5GTIH 1QLED 3W68A 1YJ9P 4CPGA 1HBWA 1L0HA 1S3JA 3A2AA 1USEA 3CXHH 4GR6A 4PD4H 1KZUB 1H89A 2OTLP 2QG4A 2DW3A 1NAYA 2E5TA 4UB8E 2ZYDA 1J2JB 1BSNA 2R5DA 1PFIA 1PPJE 4WB4A 2FY8A 4IFDK 3HZQA 2ZYGA 3T97B 2Q6QA 2FVFA 1VQNP 3USSA 1SQXE 5APYA 2FQ1A 1MZ9A 1RE4C 2IZ0A 2GDWA 1RE4A 3L74E 2P7JA 5F2OA 1YHQP 2BASA 2KOQA 1BDDA 3KXDA 2QE7H 4U0CA 4XROA 1IFMA 1QX8A 5TISE 1Y47A 5AW3B 3Q5PA 5DJUB 4R4LA 4H0LD 2KOOA 1IK9A 2KORA 2YO3A 2Z44A 4PH1A 2NPSB 1GD2E 1R5LA 2K1AA 3GZLA 4U3FJ 5CCHC 3I5CA 2VLOA 3CCEP 2PEKA 2J58A 1A02F 2WITA 2Y0DA 4DOJA 2A06D 2JO1A 1GK6A 3H1KE 3CD6P 3LRYA 2GYKA 1SQXK 1IMPA 4U3FD 2HPCB 1PPJG 1OXZA 1VQOP 4NEOA 3OJAB 3E1RA 3V2PA 1M74A 4COPA 3AE5C 1ZRTE 4UB6H 2K9JB 1SQXG 5AVRB 4L76A 5GTHH 3H0DA 3AEFC 4H0LC 4CA3A 1G2CB 1EZVE 3MP7B 1VQMP 1GW4A 4I7ZB 1VQKP 3CXHI 5B5EH 4PD4I 2O3JA 4RESB 4RO0A 1CEIA 2I8DA 2GZIA 2HR3A 4BXLA 2KGAA 1Q2NA 3WUUA 2L5GB 2XT1A 2FYZA 4EDFA 2BEZF 1EMVA 2KK7A 1URQB 4DCKA 3NY7B 2PEIA 3ITKA 1JM0A 1PGJA 3H1LE 2KG8A 3H1KG 2WSCH 1KN7A 1D7MA 2ZT9D 2KB7P 1KILB 1QVGO 1XTGB 3H1IJ 1PEOA 3E7KA 2KOPA 1GU4A 4K35A 1A8OA 1PEQA 1SQQJ 2EIAA 3PLNA 1JO5A 4BRYB 1FZEA 2DGYA 1JY2P 3JSVC 3QH9A 4IL6H 3FXDA 1JTHA 1EZVG 3L72J 3MD0A 1OX3A 3VN0A 1SQQD 5BU5A 2CGQA 1OWAA 1KD1Q 3RBXA 2E5YA 2V4HA 3II6A 3L72D 2FKWB 3AE2C 2O01N 1AJYA 3A0BE 3GF3A 1M1JB 1N86A 3M0AA 3O6QB 5AW5B 3CC2P 1FZBA 2RMZA 1JNMA 4Y99C 2WSEH 3H1LG 2JO0A 3VP8A 2JYGA 2M3BA 3AE6C 2LIUA 3H32B 1SFCB 1R8EA 1PL5A 1VPCA 1ZP0C 1HJBA 3KDPB 5AVQB 5APSA 1UJZA 3DS0A 2DNWA 2XZ0D 5KJ7C 3AEDC 5KJ7A 4U3FE 2N1TD 2K3RA 2YNYA 3AEGC 3RBZA 1FC2C 1LTTC 3WMM0 3WUTA 1E79H 3L75D 2AEMA 1LTGC 3MHVA 1NYHA 3G28A 2K2QA 1RE3A 2YKPA 2FAEA 1EXIA 5EJDA 2B88A 2J59M 5I4TG 3VMZA 4OVNF 1N73C 2B87A 4W7ZA 5KAIE 1OZHA 2YKQA 2RN0A 4DZOA 2KS1A 1OFCX 1S5LH 2XKMA 4L74A 3D6YA 1J1DB 1T6AA 2X2BA 2XZ1C 2FXMA 1JCCA 2FADA 2G3AA 3HUSC 4EI2A 3HUSA 1BGYJ 3JCUE 1SP4A 1ZR2A 3RL0B 1W5CE 3HRNA 4C7NA 4H13D 1W2BO 2LXCB 4U0BA 3RK3B 1LTIC 1IFDA 2K94A 3L36A 2GUVA 1BGYD 3A0HH 1VF5B 3NXSA 2JBGA 1X9VA 3HE4B 1RQUA 1CSBA 2PEJA 3H1JG 1YITP 2KGDA 1MV8A 1LT9C 4BPGA 1IFIA 1LT9A 2MJZA 2WSFH 1X22A 1AQTA 3OAKA 1J1EC 4GKGA 3G3ZA 1YI2P 3V5BA 2AFEA 3H1IE 5CMZA 5AW9B 3WU2E 4AYCA 3LIDA 2KNCB 3W67A 3NMDA 2YIUB 1SQQE 2Q1KA 1Z6MA 2ZJSE 2R32A 2KWLA 2ZT9B 3TNUB 2B89A 2OQQA 2E74B 3L72E 1A43A 1BE3D 1HJ0A 2FFDC 3M9HA 2FFDA 1IJDB 4DT0A 2WVRA 3N7NA 1RF1C 4WY4C 3LMOA 3G26A 3EJBA 1OVVA 1JUNA 3BVHA 1PV3A 1H8AA 2ZXXA 1AVOA 2KSEA 3L4FA 3SSUA 1H0TB 2AXTH 1KQFB 4JBZA 3B4QA 2VLPA 2OYHB 1P84H 1PGOA 1IMQA 1BDCA 1KB9E 3L73D 1MZ8A 5AW0B 3M9QA 4HH2A 3CCSP 4I1LA 1SQQK 1NTZD 2R44A 3PHLA 3EJEA 3DS4A 4PXHB 3H1IG 1SS1A 2FXOA 1Q81Q 2IFMA 3CXHD 3CMEP 4PD4D 1SQQG 4N3YB 2FVEA 3GG2A 4EIJA 2QSIA 2CNRA 1VQ7P 3PH0A 3BCCJ 3CCJP 2EG5A 3GHGB 2NPSD 2CWOA 3T97A 1ZMEC 2E1MA 4L75A 1FS0E 4Y28J 1FR2A 2M3EA 2LKIA 3BCCD 3CX5D 1PEMA 4YPCA 1E0HA 2EHTA 5KKZB 1HGZA 1LP1B 3L71D 3SFEC 4QNBA 1CW5A 1HGVA 3I55P 2YMYA 1LGHB 1PP9J 1GL2B 3D71A 2O1JA 5L8RJ 1GK4A 2ERHA 2NPSC 2IBZE 2NPSA 5AVTB 4UHPB 2O1KA 3P8CD 1BGYE 1PP9D 2N5HA 2LPKA 1EDJA 1RO2A 2M5AB 2HLOA 1DV5A 2NRGA 2HPCA 5F2NA 3CCMP 5E79E 3H47A 1NHLA 1URQD 2KIKA 1SQBJ 1P84I 2K9JA 4H13B 3B71A 1VQ8P 1LWUB 2GZGA 5APWA 2WSSH 3CL3D 1G2CA 2V7QJ 1N7LA 3Q5RA 4GR2A 1FOSF 1MFTA 3CWBD 4WBAA 1EQ7A 1SQBD 1FJPA 1AFOA 3DS1A 1FZCB 5H2FE 4A7PA 1AUMA 1EDKA 3U43A 2CPBA 1NTKJ 4M0IA 2LIWA 2Y0CA 2ZAEB 1LJ2A 1KFMA 5KP8B 5AW1B 1FZGA 2L4BA 4U0AA 3TK1A 2IBZG 4W7YA 4H2YC 1BCCE 4RKUJ 2WSCJ 3AE9C 3CCUP 2A45G 2OYIB 5HGMA 3MIWA 2W6AA 4GODA 1NTKD 1GW3A 3TDKA 1SQVJ 2XNDH 2L91A 1KILC 1KILA 4TT3H 1L2PA 1JY3P 1GPJA 1YQ3C 2LXBA 2KGEA 2CPSA 4HJGH 3CXHE 3VRLC 3AE4C 2JDIH 1JY3O 4BRYA 2KR5A 1SQVD 2CG5B 1CZQA 1GZLA 3L70D 4WWIA 1YBKA 3RK2B 4XFXA 1VL2A 5KP6B 1SFCD 4BPFA 5TJHA 3N4XA 3GMAA 3BCCE 3CX5E 2M0BA 3FX0A 3BRVB 4C46A 2WT7B 1WRGA 1M1JC 1M1JA 2PY8A 4XFYA 2KUBA 2PGDA 1L4AB 3O6QA 3WBHA 1OMIA 1GTWA 2YKOA 2BCCD 3PJSK 1Q82Q 2BHVA 1BCCG 1GU5A 2AEJA 2IX7C 3IFMA 1OIPA 4XFJA 3E2DA 5TISH 2Q9IA 1S2EA 1SFCC 3H32A 1SFCA 2XV6A 2JWAA 3HD7D 5CBOA 1JY2N 4NPEA 1OW7A 1M90Q 3U1AA 2KG6A 4PWVB 1Y8AA 3FWLA 4AQRD 2JGPA 1L0IA 1MUUA 1QL2A 1VQLP 1DEBA 3SWYA 1X3OA 2IYOA 3QWOC 2W6JH 1VQ6P 3B5ND 3RL0D 3G71P 1MFZA 3Q2YA 1K8AQ 3CC4P 1DH3A 2Z46A 3BCCG 1FZFA 3L74G 3G29A 2MY5A 3RK3D 1KILE 1M6NA 1NU1J 3S1KA 3TSIA 1VF5D 1KORA 2M8NA 1VHNA 4EYYQ 1E5WA 4PJ0E 2D2CB 3H6PA 1J1DC 3M0DA 1FJKA 1L0NJ 2K93A 1NU1D 1OW6A 2W27A 1M8OB 1EIAA 1NTKE 1NTMD 3TF5A 2EFJA 3AE3C 1L0ND 4C7RA 2EHSA 2E74D 2RKLA 4YTPC 2R3SA 3HE4A 2Z4EA 1AQ5A 3A7OA 1HF9A 2JJLA 3IN6A 1SQVE 3KZIE 2P58A 1SQBK 3EFFK 2GUSA 2JWDA 2XZRA 2L6EA 5KP7B 2QRXA 1MKMA 2WQYC 1H88A 1LT1A 3HE5B 2KNCA 3V2NA 1JY2O 3NTEA 3V4WA 4NPDA 2ZT9C 2Y9YA 3F89A 3M9BA 1K9MQ 1NTKK 1JMBA 2QJYC 3TGUJ 2L9FA 2WPQA 2P9XA 3A0BH 2LMLA 5EW5E 1ZV8A 1NTKG 1A02J 3SWKA 2YMKA 1N8RQ 1BXIA 1H0TA 3NFQA 1HVVA 2OYHA 1RO0A 2KOSA 1SQVK 3TGUD 1T3JA 1DD4A 4JYCA 3L75J 2A06E 1EZVI 1P84D 1DNYA 2Q3IA 3P8MC 2K37A 2E76B 4U0FA 1SQVG 5APQA 3DTJA 1KYOD 2QJKB 3A3YB 2W83C 3AE8C 5B66E 2KODA 1L0LD 2FQ0A 1RE3C 3BASA 1RH5B 1GL2D 5KLVJ 4N78D 5CHXA 1T3UA 1RHZB 2M5RA 1ZOYC 3GHGC 1QVFO 4JPZB 3VYIA 3GHGA 2MVUA 3HD7B 3GKLC 4AUWA 4HKGA 2KYVA 5KLVD 1QL1A 3JC22 2YXQB 1LNQA 3L37A 1YJNP 2ZVNB 2SPZA 3RL0g 2N1TC 2G8YA 2N1TA 2PFXA 4MN4C 5KAIH 3P05A 3NTNA 1NU1E 3OW2O 1LP1A 2K0DX 2KOGA 2KSJA 2AEFA 4QKOA 3B5NB 1NOHA 5CBNA 1GL2A 1T8KA 2C0WA 2WPSA 2OYOA 2MKVA 4MRTC 2A06G 3F5HA 3R2PA 2M8PA 5AW6B 3PRJA 1L0NE 2KGCA 3JCUH 4U3FG 1FDMA 1N7SB 1NGMB 3P32A 4B86A 2FACA 2FYUD 1AYIA 3VMYA 5BU8B 3G1IA 5C39A 2M5AA 1JCDA 2I1JA 3EWKA 3CCRP 4D6TJ 2XNXA 2N98A 5CZDB 1BE3J 5DJTB 3R4YA 4COCA 4DG9A 2KLVA 1WT6A 3LW5J 4H13C 2JQ4A 1DEEG 4N6JA 4YXWH 1RNIA 1LWUC 3VOPA 2KZJA 1LWUA 4PV1B 3WU2H 1NU1K 4D6TD 3HYBA 1X0TA 2H43A 1VQ9P 4XA4A 3G0VA 2K92A 1FZCC 1FZCA 3CLQA 1L0NK 2GZFA 3H1HJ 3GJNA 2K5XA 4O9BA 3MTUE 3L73J 2CQ8A 3Q5SA 4NPFX 3VTPC 2B9BA 1L0NG 2N9BA 1NTZJ 3CXCO 1G1IA 1YQ4C 1ZR4A 3CE7A 3TGUE 2W90A 3H1HD 4F37A 2OYIA 3RK2D 1IZNB 4Y99B 3IR9A 3AE1C 2MF4A 2XDJA 3MUDA 1FU1A 2MD9A 1KB9H 3C1LA 2N50A 4PH0A 4LC1A 1S72P 2R5BA 1ACPA 3S4RA 4I6MC 1L4AD 3G4SP 1KYOE 1M7LA 1G1JA 3L75E 2Y9ZA 1EDIA 4DJGA 1YYCA 2QNWA 2PRRA 3MZWB 5KAFE 4IPYA 4N78E 2NO8A 3S9OA 2QM7A 1M6EX 3SFDC 3L72G 5AVYB 1D1DA 1NKZB 3RK2C 1NJIQ 2PEOA 2JR8A 2AFDA 3L71J 2Q5UA 1EXJA 1SQXJ 2HODB 2ZYAA 5APUA 2LR2A 2QA4P 3L35A 4JQ0D 4H44B 1PPJD 2IFNA 2WT7A 1YTZT 1KC8Q 3OA7A 1L4AC 1L4AA 1IFPA 4K3AA 1X79B 1IC2A 3G21A 2WPRA 1N73B 1SQXD 4M3LA 3TGUG 1M56D 1K30A 1U7JA 4YXDC 5HGLA 4XE5B 1JY3N 5AVSB 1PIXA 1Q86Q 2Z5IA 4KT0J 1K73Q 3HTKB 3IAOA 4OH8B 3V2RA 3LIEA 3L75G 2NZ2A 3G6EP 2PEMA 1DX7A 1AVYA 2C9NY 5CJ0A 3H1KJ 3KPEA 5AVZB 2A45H 2L0QA 3CCQP 3CI9A 2D2CD 3CWBJ 4W80A 5KLVK 2JB0A 1S5LX 3Q1MA 2PNGA 1HH0A 2KW2A 1NQ4A 3MGNA 1SLQA 2WMMA 3H1KD 2MVVA 1UIXA 5EFWB 5E79H 4D6TE 2QM8A 1J1EB 1ZMBA 1GMJA 4I7ZC 1BE3E 1KB9I 4TLFA 2FBWC 4R0MA 1Z56A 1RF0C 1RF0A 2KG9A 2FYNB 3ABVC 2QEXP 4WVZA 4OGQB 2LTEA 1U57A 1KFNA 1OW8A 1EZVD 1SQPJ 5H2FH 4GT1A 1R5SA 1URQC 1URQA 3AEAC 5M1BA 4OWFA 3H1HE 1BGYG 1RF1B 3RG6C 3L73E 4WY4B 1EOQA 3Q20A 5KTBA 4HYTB 2M8LA 3KHUA 1SQPD 2L22A 1T8ZA 2AVAA 1NTZE 5GTIE 1OVUA 1NVOA 1NKNA 5K5GB 3H4EA 4ZKUA 3L70J 2N5IA 2XXMA 2AF8A 2PENA 4H2WC 4PD4E 3H1LD 2KXPB 3AE7C 4ZKPA 5HGNA 1FZAA 4D6TG 1JB0J 4IFMA 1HUCA 4UB8H 1BE3G 3HE5A 2ITAA 2JU2A 2BCCJ 4IOIH 1HY8A 2PEQA 5KLIB 3KQGA 2IBZI 2N9YB 3CPWO 2QJPB 2JYLA 2E76D 1OR5A 2A45I 2QVAA 1FDIA 4BPHA 2WSEJ 2KLUA 3L71E 2GDYA 3CX5H 5CCHD 1NTZK 3H1HG 4GOEA 3L73G 2LOLA 3V2QA 5CCGD 5F2KA 2E75B 2MR8A 1NTZG 2IDBA 1KQGB 5BS2A 1VQPP 3P8CE 3SWFA 1PP9E 3VP9A 1SVFA
chains in the Genus database with same CATH topology
1K8AQ 1VQNP 1D1DA 3CC4P 4QNBA 2Z46A 3DS0A 1VQ4P 3I55P 1NJIQ 2PEOA 3DPHA 3G29A 1N8RQ 3G1IA 3CC7P 1A43A 2PEIA 1IUQA 3VRLC 4XRQA 4WYMA 1M6NA 1Q7YQ 3CCRP 1RO0A 5F2OA 2QA4P 4U0EA 1YHQP 3RG6C 1JJ2O 2M8NA 3G28A 1EOQA 3Q20A 1E6JP 1KC8Q 3G26A 4COCA 2M8LA 3DS2A 1YIJP 1QVGO 1M1KQ 4U0CA 1PEUA 4XROA 1PEOA 3G21A 5HGOA 1RNIA 4U0FA 4XFXA 5I4TG 1RO2A 1K30A 3H4EA 1A8OA 1PEQA 3HYBA 2EIAA 5HGLA 3DTJA 4U0DA 3I56P 1VQ9P 2LF4A 2DGYA 2XXMA 3MGEA 1EIAA 2BQ1E 5F2NA 2Z44A 2PENA 3G0VA 4PH1A 5DCKA 3CCMP 1Q86Q 3CMAP 3H47A 3CCEP 2EFJA 2KODA 2PEKA 2PY8A 4XFYA 5HGNA 3WBHA 2Z45A 3CCSP 1K73Q 1VQ8P 1Q82Q 2BHVA 3CD6P 3LRYA 3DS4A 2PEMA 3G6EP 1KD1Q 1QVFO 4GR2A 2PEQA 3M1MA 1Q81Q 2OTJP 1QRJA 3CXCO 3E2DA 3CCQP 1VQOP 3CMEP 3CCVP 1BAJA 1W2BO 5JPAA 3DS1A 1M74A 4U0BA 4COPA 3CPWO 1YJ9P 2JYLA 2L6EA 3CC2P 2XV6A 1YJNP 1VQ5P 1AUMA 3H0DA 1VQ7P 4M0IA 3CCJP 1M90Q 3CCLP 3P05A 4GR6A 2EG5A 2PEJA 1VQMP 3OW2O 3NTEA 3B5IA 2CWOA 4U0AA 4PH0A 1YITP 2JO0A 1ZMBA 1S72P 2JYGA 1VQKP 2E1MA 2ONTA 2OTLP 5BS1A 1VQLP 5F2KA 3G4SP 3DS3A 3CCUP 1YI2P 1K9MQ 5HGMA 2OARA 4XFZA 2M8PA 3G1GA 2QEXP 3DS5A 1PEMA 1KQSO 1YJWP 5BS2A 1VQPP 3HZQA 4IPYA 1VQ6P 1M6EX 2BUOA 3G71P 2P9XA 2XT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A Q;  1VQN P;  3CC4 P;  1VQM P;  3OW2 O;  3CD6 P;  1YIT P;  3G6E P;  1VQ4 P;  3I55 P;  1S72 P;  1KD1 Q;  1NJI Q;  1VQK P;  1QVF O;  1Q81 Q;  2OTL P;  1N8R Q;  3I56 P;  1VQ9 P;  1VQL P;  3CC7 P;  2OTJ P;  3CXC O;  3CCQ P;  1VQO P;  3G4S P;  3CME P;  1Q7Y Q;  3CCU P;  1YI2 P;  3CCV P;  1K9M Q;  3CCR P;  1W2B O;  2QA4 P;  3CCM P;  1YHQ P;  3CPW O;  1JJ2 O;  1Q86 Q;  3CMA P;  2QEX P;  1YJ9 P;  3CCE P;  1KQS O;  1YJW P;  3CC2 P;  1YJN P;  1VQP P;  1VQ5 P;  1KC8 Q;  3CCS P;  1VQ7 P;  1YIJ P;  1QVG O;  1K73 Q;  1VQ6 P;  3CCJ P;  1M90 Q;  1VQ8 P;  3CCL P;  1M1K Q;  1Q82 Q;  3G71 P; 
#chains in the Genus database with same CATH topology
 3U59 A;  4U7J A;  1CI6 B;  2WZ7 A;  2E76 C;  4EOT A;  1OVR A;  4KJM A;  4GIF A;  5AW8 B;  4U0E A;  1FE6 A;  5CCH A;  2QJK C;  3V6I A;  1S4X A;  2KP8 A;  1EDL A;  3H1J J;  5CCG C;  5CCG A;  2VLN A;  1PEU A;  2UWJ E;  4HKZ H;  2WPV B;  2KI7 B;  4UB6 E;  3M91 A;  4KHX A;  5GTH E;  3CWB E;  4U0D A;  3HD7 C;  1ZXG A;  3HD7 A;  1T2K D;  4HB1 A;  2IPP A;  2FQ2 A;  1SQB E;  3H1J D;  1U7M A;  2N6Y A;  1N7S D;  3L71 G;  3TYY A;  1HTL C;  5AVW B;  5B5E E;  1NTM J;  3IF4 A;  2PAJ A;  1KV4 A;  1UII A;  3GZM A;  3M0D C;  4L73 A;  2Z5H A;  3AEE C;  2V7Q H;  1VDF A;  4PJ0 H;  1X8Y A;  3AEC C;  1F80 D;  4H2X C;  3B5N C;  2K88 A;  3B5N A;  3RL0 C;  2O01 H;  3U1C A;  2LKM A;  1PP9 G;  3AEB C;  3BAT A;  4PV1 D;  1SQP E;  1T2K C;  3RK3 C;  1NWQ A;  2FHS C;  2FXP A;  3E1I A;  1N7S C;  4BWN A;  1N7S A;  2WSF J;  1VF5 C;  1M57 D;  1LTJ B;  3FXE A;  3CX5 I;  1K04 A;  2OAR A;  3O8Z A;  3GW6 A;  3BRT B;  3G1G A;  2C0X A;  2M8R A;  1KQS O;  1JEK A;  2CK3 H;  3CWB G;  4I2L C;  3L70 E;  4ASW A;  2YIU C;  1ZN5 A;  4IL6 E;  3KZI H;  3VMA A;  1SQB G;  1Y9B A;  1JMM A;  1HWT C;  1PZQ A;  4PV1 C;  1S1C X;  2E74 C;  3TNU A;  2GDX A;  1KMI Z;  3H1I D;  3ZDM A;  4ASV A;  2C9L Y;  2YXR B;  5APX A;  3DS2 A;  2BCC E;  1SQP K;  2WTY A;  2KZI A;  2XU6 A;  3I56 P;  7CEI A;  1GXH A;  2P10 A;  1SQP G;  1IFJ A;  2OYH C;  3K5B A;  5KJ7 D;  1LTA C;  2Z45 A;  1EC5 A;  1FBM A;  1L0L J;  2LL8 A;  1PGQ A;  1KQL A;  2WWW A;  3M1M A;  4H44 D;  3WUV A;  2MR7 A;  1HQB A;  1PGP A;  1YTZ I;  3CCV P;  1KB9 D;  2Q3E A;  3L70 G;  3H25 A;  3RG2 A;  3PTZ A;  3CCL P;  2VRS A;  2P67 A;  2IYP A;  5B66 H;  2GZE A;  2JAZ A;  2ONT A;  1FOS E;  3RK3 E;  2FVA A;  3H1J E;  2BCC G;  2HOD A;  2Q7C A;  2I1K A;  4H0L B;  4H44 C;  2W8Z A;  1S9K D;  1NO4 A;  4ZNC A;  2BUO A;  1N2D C;  1NAF A;  5KKZ C;  1S5L E;  1N73 A;  4QMA A;  4LGD E;  3CC7 P;  5AW4 B;  3C9I A;  4JYB A;  4XRQ A;  4WYM A;  1GL2 C;  2FYU J;  2YO2 A;  1DIP A;  5CJ4 A;  1NTM E;  3Q3D A;  4Z1M H;  2BEQ D;  2GM4 A;  2HG5 D;  1E6J P;  1IO4 A;  5HGO A;  3HTK A;  1W2E A;  2ZFC A;  4OGQ D;  3GLM A;  2OGU A;  1ZLL A;  3A0H E;  2BQ1 E;  1Q90 D;  2IBZ D;  3CMA P;  1WMK A;  2E43 A;  2H7H A;  2WPT A;  1FDO A;  2RH0 A;  4WY4 D;  5HV8 A;  5BVZ A;  2OTJ P;  4JF7 A;  3V4Q A;  1QRJ A;  3C8V A;  1JTH B;  2H8P D;  1NTM K;  2ZVO B;  2FYN C;  4OGQ C;  1NU1 G;  2XV5 A;  3FGA D;  2J5U A;  2ZXE B;  4IFF A;  5AVU B;  1NTM G;  4GOF A;  3EJD A;  5BS1 A;  2K0Y A;  3D70 A;  3DS3 A;  2IZ1 A;  2QJY B;  2P2U A;  4IL6 X;  2OYI C;  3G9R A;  1RF1 A;  2AXT E;  1BCC J;  4WY4 A;  1P84 E;  3MUD C;  4ZMD A;  5AVV B;  2POH A;  2JU1 A;  2OTK E;  1IUQ A;  1BCC D;  1QGK B;  2HFE D;  1AA0 A;  1Q7Y Q;  1AF8 A;  3RGU A;  5AVX B;  1UNK A;  1L0L E;  1NH4 A;  2R3C A;  2ROQ A;  1M1K Q;  2P1J A;  1KYO H;  2JKV A;  2E75 D;  2N6Z A;  2LF4 A;  5AW2 B;  5KAF H;  1KTM A;  4R4M A;  3MGE A;  2H89 C;  5DCK A;  5KLI C;  5KLV E;  4IZ6 A;  2QJP C;  1BSH A;  1S9K E;  3L74 J;  3GF7 A;  2B87 B;  1GXG A;  2JEE A;  1ZNV A;  1K05 A;  3EQ2 A;  2H88 C;  1LTB C;  1BAJ A;  2PP6 A;  2KS1 B;  2E75 C;  5JPA A;  3VMX A;  3L74 D;  1FAV A;  4GDO A;  2AXC A;  3P7K A;  2N1T B;  2K0X A;  1ZW0 A;  3M06 A;  1VQ5 P;  1L0L K;  3HUS B;  1RY3 A;  2FYU E;  1VKU A;  3B5I A;  1CI6 A;  2K9Y A;  4C7N B;  1L0L G;  2HYN A;  1RQV A;  3FWN A;  4XFZ A;  3DS5 A;  1YJW P;  3B8E B;  1AV1 A;  3B4S A;  1LT9 B;  5APT A;  1VQ4 P;  5KLV G;  2E42 A;  3DPH A;  5AW7 B;  3PP5 A;  1KLP A;  1JJ2 O;  2GA1 A;  1QEX A;  1ZRT D;  1IK7 A;  2JP3 A;  1YIJ P;  1USD A;  4RJT A;  2W6B A;  2D2C C;  3LW5 H;  2FYU K;  5HVC A;  1LTS C;  2O01 J;  3KYQ A;  2FFD B;  1KYO I;  1KIL D;  1TU3 F;  3D6Z A;  4LLH A;  3A5T A;  2FYU G;  1GDT A;  3UIA A;  1DD3 A;  3H1L J;  2GZJ A;  3EFG A;  1XTC C;  2VLQ A;  5APV A;  1JOC A;  2Y0E A;  2VSQ A;  1LTJ C;  2QIW A;  1LTJ A;  1IFN A;  5GTI H;  1QLE D;  3W68 A;  1YJ9 P;  4CPG A;  1HBW A;  1L0H A;  1S3J A;  3A2A A;  1USE A;  3CXH H;  4GR6 A;  4PD4 H;  1KZU B;  1H89 A;  2OTL P;  2QG4 A;  2DW3 A;  1NAY A;  2E5T A;  4UB8 E;  2ZYD A;  1J2J B;  1BSN A;  2R5D A;  1PFI A;  1PPJ E;  4WB4 A;  2FY8 A;  4IFD K;  3HZQ A;  2ZYG A;  3T97 B;  2Q6Q A;  2FVF A;  1VQN P;  3USS A;  1SQX E;  5APY A;  2FQ1 A;  1MZ9 A;  1RE4 C;  2IZ0 A;  2GDW A;  1RE4 A;  3L74 E;  2P7J A;  5F2O A;  1YHQ P;  2BAS A;  2KOQ A;  1BDD A;  3KXD A;  2QE7 H;  4U0C A;  4XRO A;  1IFM A;  1QX8 A;  5TIS E;  1Y47 A;  5AW3 B;  3Q5P A;  5DJU B;  4R4L A;  4H0L D;  2KOO A;  1IK9 A;  2KOR A;  2YO3 A;  2Z44 A;  4PH1 A;  2NPS B;  1GD2 E;  1R5L A;  2K1A A;  3GZL A;  4U3F J;  5CCH C;  3I5C A;  2VLO A;  3CCE P;  2PEK A;  2J58 A;  1A02 F;  2WIT A;  2Y0D A;  4DOJ A;  2A06 D;  2JO1 A;  1GK6 A;  3H1K E;  3CD6 P;  3LRY A;  2GYK A;  1SQX K;  1IMP A;  4U3F D;  2HPC B;  1PPJ G;  1OXZ A;  1VQO P;  4NEO A;  3OJA B;  3E1R A;  3V2P A;  1M74 A;  4COP A;  3AE5 C;  1ZRT E;  4UB6 H;  2K9J B;  1SQX G;  5AVR B;  4L76 A;  5GTH H;  3H0D A;  3AEF C;  4H0L C;  4CA3 A;  1G2C B;  1EZV E;  3MP7 B;  1VQM P;  1GW4 A;  4I7Z B;  1VQK P;  3CXH I;  5B5E H;  4PD4 I;  2O3J A;  4RES B;  4RO0 A;  1CEI A;  2I8D A;  2GZI A;  2HR3 A;  4BXL A;  2KGA A;  1Q2N A;  3WUU A;  2L5G B;  2XT1 A;  2FYZ A;  4EDF A;  2BEZ F;  1EMV A;  2KK7 A;  1URQ B;  4DCK A;  3NY7 B;  2PEI A;  3ITK A;  1JM0 A;  1PGJ A;  3H1L E;  2KG8 A;  3H1K G;  2WSC H;  1KN7 A;  1D7M A;  2ZT9 D;  2KB7 P;  1KIL B;  1QVG O;  1XTG B;  3H1I J;  1PEO A;  3E7K A;  2KOP A;  1GU4 A;  4K35 A;  1A8O A;  1PEQ A;  1SQQ J;  2EIA A;  3PLN A;  1JO5 A;  4BRY B;  1FZE A;  2DGY A;  1JY2 P;  3JSV C;  3QH9 A;  4IL6 H;  3FXD A;  1JTH A;  1EZV G;  3L72 J;  3MD0 A;  1OX3 A;  3VN0 A;  1SQQ D;  5BU5 A;  2CGQ A;  1OWA A;  1KD1 Q;  3RBX A;  2E5Y A;  2V4H A;  3II6 A;  3L72 D;  2FKW B;  3AE2 C;  2O01 N;  1AJY A;  3A0B E;  3GF3 A;  1M1J B;  1N86 A;  3M0A A;  3O6Q B;  5AW5 B;  3CC2 P;  1FZB A;  2RMZ A;  1JNM A;  4Y99 C;  2WSE H;  3H1L G;  2JO0 A;  3VP8 A;  2JYG A;  2M3B A;  3AE6 C;  2LIU A;  3H32 B;  1SFC B;  1R8E A;  1PL5 A;  1VPC A;  1ZP0 C;  1HJB A;  3KDP B;  5AVQ B;  5APS A;  1UJZ A;  3DS0 A;  2DNW A;  2XZ0 D;  5KJ7 C;  3AED C;  5KJ7 A;  4U3F E;  2N1T D;  2K3R A;  2YNY A;  3AEG C;  3RBZ A;  1FC2 C;  1LTT C;  3WMM 0;  3WUT A;  1E79 H;  3L75 D;  2AEM A;  1LTG C;  3MHV A;  1NYH A;  3G28 A;  2K2Q A;  1RE3 A;  2YKP A;  2FAE A;  1EXI A;  5EJD A;  2B88 A;  2J59 M;  5I4T G;  3VMZ A;  4OVN F;  1N73 C;  2B87 A;  4W7Z A;  5KAI E;  1OZH A;  2YKQ A;  2RN0 A;  4DZO A;  2KS1 A;  1OFC X;  1S5L H;  2XKM A;  4L74 A;  3D6Y A;  1J1D B;  1T6A A;  2X2B A;  2XZ1 C;  2FXM A;  1JCC A;  2FAD A;  2G3A A;  3HUS C;  4EI2 A;  3HUS A;  1BGY J;  3JCU E;  1SP4 A;  1ZR2 A;  3RL0 B;  1W5C E;  3HRN A;  4C7N A;  4H13 D;  1W2B O;  2LXC B;  4U0B A;  3RK3 B;  1LTI C;  1IFD A;  2K94 A;  3L36 A;  2GUV A;  1BGY D;  3A0H H;  1VF5 B;  3NXS A;  2JBG A;  1X9V A;  3HE4 B;  1RQU A;  1CSB A;  2PEJ A;  3H1J G;  1YIT P;  2KGD A;  1MV8 A;  1LT9 C;  4BPG A;  1IFI A;  1LT9 A;  2MJZ A;  2WSF H;  1X22 A;  1AQT A;  3OAK A;  1J1E C;  4GKG A;  3G3Z A;  1YI2 P;  3V5B A;  2AFE A;  3H1I E;  5CMZ A;  5AW9 B;  3WU2 E;  4AYC A;  3LID A;  2KNC B;  3W67 A;  3NMD A;  2YIU B;  1SQQ E;  2Q1K A;  1Z6M A;  2ZJS E;  2R32 A;  2KWL A;  2ZT9 B;  3TNU B;  2B89 A;  2OQQ A;  2E74 B;  3L72 E;  1A43 A;  1BE3 D;  1HJ0 A;  2FFD C;  3M9H A;  2FFD A;  1IJD B;  4DT0 A;  2WVR A;  3N7N A;  1RF1 C;  4WY4 C;  3LMO A;  3G26 A;  3EJB A;  1OVV A;  1JUN A;  3BVH A;  1PV3 A;  1H8A A;  2ZXX A;  1AVO A;  2KSE A;  3L4F A;  3SSU A;  1H0T B;  2AXT H;  1KQF B;  4JBZ A;  3B4Q A;  2VLP A;  2OYH B;  1P84 H;  1PGO A;  1IMQ A;  1BDC A;  1KB9 E;  3L73 D;  1MZ8 A;  5AW0 B;  3M9Q A;  4HH2 A;  3CCS P;  4I1L A;  1SQQ K;  1NTZ D;  2R44 A;  3PHL A;  3EJE A;  3DS4 A;  4PXH B;  3H1I G;  1SS1 A;  2FXO A;  1Q81 Q;  2IFM A;  3CXH D;  3CME P;  4PD4 D;  1SQQ G;  4N3Y B;  2FVE A;  3GG2 A;  4EIJ A;  2QSI A;  2CNR A;  1VQ7 P;  3PH0 A;  3BCC J;  3CCJ P;  2EG5 A;  3GHG B;  2NPS D;  2CWO A;  3T97 A;  1ZME C;  2E1M A;  4L75 A;  1FS0 E;  4Y28 J;  1FR2 A;  2M3E A;  2LKI A;  3BCC D;  3CX5 D;  1PEM A;  4YPC A;  1E0H A;  2EHT A;  5KKZ B;  1HGZ A;  1LP1 B;  3L71 D;  3SFE C;  4QNB A;  1CW5 A;  1HGV A;  3I55 P;  2YMY A;  1LGH B;  1PP9 J;  1GL2 B;  3D71 A;  2O1J A;  5L8R J;  1GK4 A;  2ERH A;  2NPS C;  2IBZ E;  2NPS A;  5AVT B;  4UHP B;  2O1K A;  3P8C D;  1BGY E;  1PP9 D;  2N5H A;  2LPK A;  1EDJ A;  1RO2 A;  2M5A B;  2HLO A;  1DV5 A;  2NRG A;  2HPC A;  5F2N A;  3CCM P;  5E79 E;  3H47 A;  1NHL A;  1URQ D;  2KIK A;  1SQB J;  1P84 I;  2K9J A;  4H13 B;  3B71 A;  1VQ8 P;  1LWU B;  2GZG A;  5APW A;  2WSS H;  3CL3 D;  1G2C A;  2V7Q J;  1N7L A;  3Q5R A;  4GR2 A;  1FOS F;  1MFT A;  3CWB D;  4WBA A;  1EQ7 A;  1SQB D;  1FJP A;  1AFO A;  3DS1 A;  1FZC B;  5H2F E;  4A7P A;  1AUM A;  1EDK A;  3U43 A;  2CPB A;  1NTK J;  4M0I A;  2LIW A;  2Y0C A;  2ZAE B;  1LJ2 A;  1KFM A;  5KP8 B;  5AW1 B;  1FZG A;  2L4B A;  4U0A A;  3TK1 A;  2IBZ G;  4W7Y A;  4H2Y C;  1BCC E;  4RKU J;  2WSC J;  3AE9 C;  3CCU P;  2A45 G;  2OYI B;  5HGM A;  3MIW A;  2W6A A;  4GOD A;  1NTK D;  1GW3 A;  3TDK A;  1SQV J;  2XND H;  2L91 A;  1KIL C;  1KIL A;  4TT3 H;  1L2P A;  1JY3 P;  1GPJ A;  1YQ3 C;  2LXB A;  2KGE A;  2CPS A;  4HJG H;  3CXH E;  3VRL C;  3AE4 C;  2JDI H;  1JY3 O;  4BRY A;  2KR5 A;  1SQV D;  2CG5 B;  1CZQ A;  1GZL A;  3L70 D;  4WWI A;  1YBK A;  3RK2 B;  4XFX A;  1VL2 A;  5KP6 B;  1SFC D;  4BPF A;  5TJH A;  3N4X A;  3GMA A;  3BCC E;  3CX5 E;  2M0B A;  3FX0 A;  3BRV B;  4C46 A;  2WT7 B;  1WRG A;  1M1J C;  1M1J A;  2PY8 A;  4XFY A;  2KUB A;  2PGD A;  1L4A B;  3O6Q A;  3WBH A;  1OMI A;  1GTW A;  2YKO A;  2BCC D;  3PJS K;  1Q82 Q;  2BHV A;  1BCC G;  1GU5 A;  2AEJ A;  2IX7 C;  3IFM A;  1OIP A;  4XFJ A;  3E2D A;  5TIS H;  2Q9I A;  1S2E A;  1SFC C;  3H32 A;  1SFC A;  2XV6 A;  2JWA A;  3HD7 D;  5CBO A;  1JY2 N;  4NPE A;  1OW7 A;  1M90 Q;  3U1A A;  2KG6 A;  4PWV B;  1Y8A A;  3FWL A;  4AQR D;  2JGP A;  1L0I A;  1MUU A;  1QL2 A;  1VQL P;  1DEB A;  3SWY A;  1X3O A;  2IYO A;  3QWO C;  2W6J H;  1VQ6 P;  3B5N D;  3RL0 D;  3G71 P;  1MFZ A;  3Q2Y A;  1K8A Q;  3CC4 P;  1DH3 A;  2Z46 A;  3BCC G;  1FZF A;  3L74 G;  3G29 A;  2MY5 A;  3RK3 D;  1KIL E;  1M6N A;  1NU1 J;  3S1K A;  3TSI A;  1VF5 D;  1KOR A;  2M8N A;  1VHN A;  4EYY Q;  1E5W A;  4PJ0 E;  2D2C B;  3H6P A;  1J1D C;  3M0D A;  1FJK A;  1L0N J;  2K93 A;  1NU1 D;  1OW6 A;  2W27 A;  1M8O B;  1EIA A;  1NTK E;  1NTM D;  3TF5 A;  2EFJ A;  3AE3 C;  1L0N D;  4C7R A;  2EHS A;  2E74 D;  2RKL A;  4YTP C;  2R3S A;  3HE4 A;  2Z4E A;  1AQ5 A;  3A7O A;  1HF9 A;  2JJL A;  3IN6 A;  1SQV E;  3KZI E;  2P58 A;  1SQB K;  3EFF K;  2GUS A;  2JWD A;  2XZR A;  2L6E A;  5KP7 B;  2QRX A;  1MKM A;  2WQY C;  1H88 A;  1LT1 A;  3HE5 B;  2KNC A;  3V2N A;  1JY2 O;  3NTE A;  3V4W A;  4NPD A;  2ZT9 C;  2Y9Y A;  3F89 A;  3M9B A;  1K9M Q;  1NTK K;  1JMB A;  2QJY C;  3TGU J;  2L9F A;  2WPQ A;  2P9X A;  3A0B H;  2LML A;  5EW5 E;  1ZV8 A;  1NTK G;  1A02 J;  3SWK A;  2YMK A;  1N8R Q;  1BXI A;  1H0T A;  3NFQ A;  1HVV A;  2OYH A;  1RO0 A;  2KOS A;  1SQV K;  3TGU D;  1T3J A;  1DD4 A;  4JYC A;  3L75 J;  2A06 E;  1EZV I;  1P84 D;  1DNY A;  2Q3I A;  3P8M C;  2K37 A;  2E76 B;  4U0F A;  1SQV G;  5APQ A;  3DTJ A;  1KYO D;  2QJK B;  3A3Y B;  2W83 C;  3AE8 C;  5B66 E;  2KOD A;  1L0L D;  2FQ0 A;  1RE3 C;  3BAS A;  1RH5 B;  1GL2 D;  5KLV J;  4N78 D;  5CHX A;  1T3U A;  1RHZ B;  2M5R A;  1ZOY C;  3GHG C;  1QVF O;  4JPZ B;  3VYI A;  3GHG A;  2MVU A;  3HD7 B;  3GKL C;  4AUW A;  4HKG A;  2KYV A;  5KLV D;  1QL1 A;  3JC2 2;  2YXQ B;  1LNQ A;  3L37 A;  1YJN P;  2ZVN B;  2SPZ A;  3RL0 g;  2N1T C;  2G8Y A;  2N1T A;  2PFX A;  4MN4 C;  5KAI H;  3P05 A;  3NTN A;  1NU1 E;  3OW2 O;  1LP1 A;  2K0D X;  2KOG A;  2KSJ A;  2AEF A;  4QKO A;  3B5N B;  1NOH A;  5CBN A;  1GL2 A;  1T8K A;  2C0W A;  2WPS A;  2OYO A;  2MKV A;  4MRT C;  2A06 G;  3F5H A;  3R2P A;  2M8P A;  5AW6 B;  3PRJ A;  1L0N E;  2KGC A;  3JCU H;  4U3F G;  1FDM A;  1N7S B;  1NGM B;  3P32 A;  4B86 A;  2FAC A;  2FYU D;  1AYI A;  3VMY A;  5BU8 B;  3G1I A;  5C39 A;  2M5A A;  1JCD A;  2I1J A;  3EWK A;  3CCR P;  4D6T J;  2XNX A;  2N98 A;  5CZD B;  1BE3 J;  5DJT B;  3R4Y A;  4COC A;  4DG9 A;  2KLV A;  1WT6 A;  3LW5 J;  4H13 C;  2JQ4 A;  1DEE G;  4N6J A;  4YXW H;  1RNI A;  1LWU C;  3VOP A;  2KZJ A;  1LWU A;  4PV1 B;  3WU2 H;  1NU1 K;  4D6T D;  3HYB A;  1X0T A;  2H43 A;  1VQ9 P;  4XA4 A;  3G0V A;  2K92 A;  1FZC C;  1FZC A;  3CLQ A;  1L0N K;  2GZF A;  3H1H J;  3GJN A;  2K5X A;  4O9B A;  3MTU E;  3L73 J;  2CQ8 A;  3Q5S A;  4NPF X;  3VTP C;  2B9B A;  1L0N G;  2N9B A;  1NTZ J;  3CXC O;  1G1I A;  1YQ4 C;  1ZR4 A;  3CE7 A;  3TGU E;  2W90 A;  3H1H D;  4F37 A;  2OYI A;  3RK2 D;  1IZN B;  4Y99 B;  3IR9 A;  3AE1 C;  2MF4 A;  2XDJ A;  3MUD A;  1FU1 A;  2MD9 A;  1KB9 H;  3C1L A;  2N50 A;  4PH0 A;  4LC1 A;  1S72 P;  2R5B A;  1ACP A;  3S4R A;  4I6M C;  1L4A D;  3G4S P;  1KYO E;  1M7L A;  1G1J A;  3L75 E;  2Y9Z A;  1EDI A;  4DJG A;  1YYC A;  2QNW A;  2PRR A;  3MZW B;  5KAF E;  4IPY A;  4N78 E;  2NO8 A;  3S9O A;  2QM7 A;  1M6E X;  3SFD C;  3L72 G;  5AVY B;  1D1D A;  1NKZ B;  3RK2 C;  1NJI Q;  2PEO A;  2JR8 A;  2AFD A;  3L71 J;  2Q5U A;  1EXJ A;  1SQX J;  2HOD B;  2ZYA A;  5APU A;  2LR2 A;  2QA4 P;  3L35 A;  4JQ0 D;  4H44 B;  1PPJ D;  2IFN A;  2WT7 A;  1YTZ T;  1KC8 Q;  3OA7 A;  1L4A C;  1L4A A;  1IFP A;  4K3A A;  1X79 B;  1IC2 A;  3G21 A;  2WPR A;  1N73 B;  1SQX D;  4M3L A;  3TGU G;  1M56 D;  1K30 A;  1U7J A;  4YXD C;  5HGL A;  4XE5 B;  1JY3 N;  5AVS B;  1PIX A;  1Q86 Q;  2Z5I A;  4KT0 J;  1K73 Q;  3HTK B;  3IAO A;  4OH8 B;  3V2R A;  3LIE A;  3L75 G;  2NZ2 A;  3G6E P;  2PEM A;  1DX7 A;  1AVY A;  2C9N Y;  5CJ0 A;  3H1K J;  3KPE A;  5AVZ B;  2A45 H;  2L0Q A;  3CCQ P;  3CI9 A;  2D2C D;  3CWB J;  4W80 A;  5KLV K;  2JB0 A;  1S5L X;  3Q1M A;  2PNG A;  1HH0 A;  2KW2 A;  1NQ4 A;  3MGN A;  1SLQ A;  2WMM A;  3H1K D;  2MVV A;  1UIX A;  5EFW B;  5E79 H;  4D6T E;  2QM8 A;  1J1E B;  1ZMB A;  1GMJ A;  4I7Z C;  1BE3 E;  1KB9 I;  4TLF A;  2FBW C;  4R0M A;  1Z56 A;  1RF0 C;  1RF0 A;  2KG9 A;  2FYN B;  3ABV C;  2QEX P;  4WVZ A;  4OGQ B;  2LTE A;  1U57 A;  1KFN A;  1OW8 A;  1EZV D;  1SQP J;  5H2F H;  4GT1 A;  1R5S A;  1URQ C;  1URQ A;  3AEA C;  5M1B A;  4OWF A;  3H1H E;  1BGY G;  1RF1 B;  3RG6 C;  3L73 E;  4WY4 B;  1EOQ A;  3Q20 A;  5KTB A;  4HYT B;  2M8L A;  3KHU A;  1SQP D;  2L22 A;  1T8Z A;  2AVA A;  1NTZ E;  5GTI E;  1OVU A;  1NVO A;  1NKN A;  5K5G B;  3H4E A;  4ZKU A;  3L70 J;  2N5I A;  2XXM A;  2AF8 A;  2PEN A;  4H2W C;  4PD4 E;  3H1L D;  2KXP B;  3AE7 C;  4ZKP A;  5HGN A;  1FZA A;  4D6T G;  1JB0 J;  4IFM A;  1HUC A;  4UB8 H;  1BE3 G;  3HE5 A;  2ITA A;  2JU2 A;  2BCC J;  4IOI H;  1HY8 A;  2PEQ A;  5KLI B;  3KQG A;  2IBZ I;  2N9Y B;  3CPW O;  2QJP B;  2JYL A;  2E76 D;  1OR5 A;  2A45 I;  2QVA A;  1FDI A;  4BPH A;  2WSE J;  2KLU A;  3L71 E;  2GDY A;  3CX5 H;  5CCH D;  1NTZ K;  3H1H G;  4GOE A;  3L73 G;  2LOL A;  3V2Q A;  5CCG D;  5F2K A;  2E75 B;  2MR8 A;  1NTZ G;  2IDB A;  1KQG B;  5BS2 A;  1VQP P;  3P8C E;  3SWF A;  1PP9 E;  3VP9 A;  1SVF A; 
#chains in the Genus database with same CATH homology
 1K8A Q;  1VQN P;  1D1D A;  3CC4 P;  4QNB A;  2Z46 A;  3DS0 A;  1VQ4 P;  3I55 P;  1NJI Q;  2PEO A;  3DPH A;  3G29 A;  1N8R Q;  3G1I A;  3CC7 P;  1A43 A;  2PEI A;  1IUQ A;  3VRL C;  4XRQ A;  4WYM A;  1M6N A;  1Q7Y Q;  3CCR P;  1RO0 A;  5F2O A;  2QA4 P;  4U0E A;  1YHQ P;  3RG6 C;  1JJ2 O;  2M8N A;  3G28 A;  1EOQ A;  3Q20 A;  1E6J P;  1KC8 Q;  3G26 A;  4COC A;  2M8L A;  3DS2 A;  1YIJ P;  1QVG O;  1M1K Q;  4U0C A;  1PEU A;  4XRO A;  1PEO A;  3G21 A;  5HGO A;  1RNI A;  4U0F A;  4XFX A;  5I4T G;  1RO2 A;  1K30 A;  3H4E A;  1A8O A;  1PEQ A;  3HYB A;  2EIA A;  5HGL A;  3DTJ A;  4U0D A;  3I56 P;  1VQ9 P;  2LF4 A;  2DGY A;  2XXM A;  3MGE A;  1EIA A;  2BQ1 E;  5F2N A;  2Z44 A;  2PEN A;  3G0V A;  4PH1 A;  5DCK A;  3CCM P;  1Q86 Q;  3CMA P;  3H47 A;  3CCE P;  2EFJ A;  2KOD A;  2PEK A;  2PY8 A;  4XFY A;  5HGN A;  3WBH A;  2Z45 A;  3CCS P;  1K73 Q;  1VQ8 P;  1Q82 Q;  2BHV A;  3CD6 P;  3LRY A;  3DS4 A;  2PEM A;  3G6E P;  1KD1 Q;  1QVF O;  4GR2 A;  2PEQ A;  3M1M A;  1Q81 Q;  2OTJ P;  1QRJ A;  3CXC O;  3E2D A;  3CCQ P;  1VQO P;  3CME P;  3CCV P;  1BAJ A;  1W2B O;  5JPA A;  3DS1 A;  1M74 A;  4U0B A;  4COP A;  3CPW O;  1YJ9 P;  2JYL A;  2L6E A;  3CC2 P;  2XV6 A;  1YJN P;  1VQ5 P;  1AUM A;  3H0D A;  1VQ7 P;  4M0I A;  3CCJ P;  1M90 Q;  3CCL P;  3P05 A;  4GR6 A;  2EG5 A;  2PEJ A;  1VQM P;  3OW2 O;  3NTE A;  3B5I A;  2CWO A;  4U0A A;  4PH0 A;  1YIT P;  2JO0 A;  1ZMB A;  1S72 P;  2JYG A;  1VQK P;  2E1M A;  2ONT A;  2OTL P;  5BS1 A;  1VQL P;  5F2K A;  3G4S P;  3DS3 A;  3CCU P;  1YI2 P;  1K9M Q;  5HGM A;  2OAR A;  4XFZ A;  2M8P A;  3G1G A;  2QEX P;  3DS5 A;  1PEM A;  1KQS O;  1YJW P;  5BS2 A;  1VQP P;  3HZQ A;  4IPY A;  1VQ6 P;  1M6E X;  2BUO A;  3G71 P;  2P9X A;  2XT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...