2LIUA

Nmr structure of holo-acpi domain from cura module from lyngbya majuscula
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
b'SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CurA
publication title Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase
total genus 23
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2liuA01
2LPKA 1L0HA 2KOQA 2KW2A 2K94A 3GZMA 4CA3A 2FVEA 2AFEA 2KGDA 2MR7A 2K0YA 2FQ1A 2GDWA 2X2BA 1X3OA 3GZLA 4H2XC 3RG2A 2LOLA 2MD9A 2MR8A 2GDXA 2XZ1C 3EJEA 2EHSA 4IZ6A 2ROQA 2K93A 2N6ZA 2KG6A 2LIUA 5KP8B 1DV5A 2FVFA 4PWVB 4NEOA 2LL8A 1HQBA 2FQ0A 2PNGA 4R0MA 2KOPA 2FAEA 2K92A 2KR5A 1HY8A 4PXHB 4BPGA 2LMLA 3NY7B 4HKGA 5KP6B 2JQ4A 2KGAA 1VKUA 2M5RA 5EJDA 2KOSA 2FACA 2MVUA 2JU2A 4H2YC 5HV8A 2K0XA 2FVAA 1AF8A 2KGCA 2K2QA 2CNRA 1NQ4A 3EJDA 1T8KA 2LKIA 2LTEA 2L22A 2KOOA 2KGEA 2MY5A 5HVCA 2KG9A 4DG9A 2L0QA 3EJBA 4BPHA 2AFDA 2DNWA 3CE7A 4BPFA 2L4BA 2AF8A 1OR5A 2MVVA 2XZ0D 2KORA 3LMOA 4H2WC 2AVAA 2N50A 2KWLA 2JGPA 1L0IA 2N5IA 2CG5B 2GDYA 2N98A 2N6YA 2FADA 2N5HA 2CQ8A 2MF4A 4MRTC 2LIWA 1KLPA 2KG8A 5CZDB 2FHSC 1ACPA 2EHTA 2FQ2A 2VSQA 2L9FA 1DNYA 2CGQA 2JU1A 5KP7B 2QNWA 1F80D
chains in the Genus database with same CATH superfamily
2OTLP 3DS2A 2KW2A 4CA3A 1FR2A 3GJNA 2VLPA 1QVGO 2Z46A 4WYMA 2GDWA 3GZLA 1VQ7P 2XXMA 4XRQA 3CCUP 3DPHA 2MD9A 4IZ6A 2PEMA 2ROQA 4QNBA 1A43A 4UHPB 3G21A 4PWVB 3CCVP 2JYLA 1Q82Q 2K92A 2LF4A 4BPGA 3VRLC 3LRYA 5KP6B 2Z45A 1W2BO 4U0DA 2JBGA 5HV8A 4XFZA 2GZEA 3HZQA 1NQ4A 2GZIA 1IUQA 2LKIA 1A8OA 2LTEA 3CCJP 1GXGA 1YJWP 2PENA 2KGEA 2MY5A 3OW2O 2NO8A 4DG9A 2AFDA 2DNWA 4XFXA 4BPFA 1EOQA 1K30A 1IMPA 2QEXP 1OR5A 5BS2A 1ZMBA 2PY8A 3CCEP 4H2WC 2KWLA 3CC2P 3H4EA 1Q81Q 5I4TG 1KLPA 3G29A 3G1IA 2JO0A 4COCA 1VQ9P 3B5IA 2EIAA 3CMAP 2VSQA 1DNYA 2PEKA 1L0HA 1YITP 4M0IA 1VQ6P 1VQPP 1K8AQ 1M6EX 2KGDA 2K0YA 1M74A 1X3OA 3RG2A 2PEOA 2M8PA 5HGOA 4U0AA 1JJ2O 2PEQA 2VLOA 4PH0A 2JYGA 2K93A 2XV6A 2N6ZA 3G1GA 3CPWO 2BHVA 1ZNVA 2P9XA 2PNGA 4R0MA 2FAEA 4PXHB 2E1MA 1NJIQ 2LMLA 1VQLP 1YI2P 4HKGA 4U0FA 1MZ8A 2FACA 2MVUA 1Z6MA 2FVAA 2K2QA 1T8KA 4XFYA 3DTJA 3DS5A 2L22A 1BXIA 3CC7P 2L0QA 3EJBA 3B4QA 5HGLA 2VLQA 5F2NA 3CXCO 1UJZA 7CEIA 2AF8A 1M1KQ 2CWOA 1VQ4P 2MVVA 2Z44A 1CEIA 2KORA 1YIJP 1EMVA 3NTEA 2N5IA 2CG5B 2L6EA 3M1MA 2N98A 2EFJA 2MF4A 1VQ5P 2DGYA 4MRTC 1VHNA 2FHSC 3H0DA 1S72P 2FQ2A 4U0EA 2CGQA 1AYIA 2JU1A 1D1DA 4H2YC 1QRJA 1F80D 2LPKA 1QVFO 2KOQA 1M90Q 3GZMA 2K94A 2M8LA 1M6NA 2FVEA 3DS0A 3RG6C 2K5XA 1YJNP 1VQ8P 2EG5A 4H2XC 3CCMP 5HGNA 2MR8A 2GDXA 3EJEA 1E0HA 3MGEA 2KG6A 2QA4P 5KP8B 1DV5A 2FVFA 2LL8A 1HQBA 3CC4P 3DS4A 3P05A 3G6EP 4PH1A 2KOPA 2KR5A 1HY8A 4GR6A 3NY7B 2JQ4A 1VKUA 2ONTA 2M5RA 3GKLC 3I56P 2KOSA 3WBHA 5EW5E 3CCQP 1EIAA 1AF8A 1Q86Q 1YHQP 4GR2A 3HYBA 3EJDA 2KODA 1VQOP 3Q20A 1UNKA 1AUMA 3DS1A 4F37A 3CE7A 2L4BA 3U43A 3G71P 2XZ0D 1K73Q 3LMOA 5F2OA 1N8RQ 1L0IA 2PEIA 3I55P 1GXHA 1KD1Q 1Q7YQ 2KG8A 1E6JP 5CZDB 4COPA 2ERHA 2EHTA 5F2KA 3G0VA 5KP7B 2QNWA 1VQMP 1K9MQ 2GZGA 2JB0A 5BS1A 2AFEA 2GYKA 3CCLP 2MR7A 2PEJA 2FQ1A 2JAZA 2X2BA 5JPAA 1RNIA 2OTJP 1BAJA 2LOLA 3CMEP 2XZ1C 2WPTA 2EHSA 1KC8Q 2LIUA 3H47A 5HGMA 3G28A 4NEOA 4U0BA 5DCKA 2BUOA 1RO0A 2FQ0A 1VQNP 3DS3A 2K0DX 2KGAA 5EJDA 2GZJA 2JU2A 2K0XA 2KGCA 2CNRA 2M8NA 2GZFA 4U0CA 4IPYA 2KOOA 2XT1A 3G4SP 5HVCA 2KG9A 3G26A 4QKOA 4BPHA 1RO2A 3CCRP 1VQKP 1YJ9P 2AVAA 2N50A 2JGPA 1KQSO 3CD6P 2GDYA 4XROA 2VLNA 1GPJA 2N6YA 2FADA 2N5HA 2CQ8A 3CCSP 2LIWA 2OARA 1ACPA 2L9FA 1IMQA 3E2DA
chains in the Genus database with same CATH topology
2LPKA 1L0HA 2KOQA 2KW2A 2K94A 3GZMA 4CA3A 2FVEA 2AFEA 2KGDA 2MR7A 2K0YA 2FQ1A 2GDWA 2X2BA 1X3OA 3GZLA 4H2XC 3RG2A 2LOLA 2MD9A 2MR8A 2GDXA 2XZ1C 3EJEA 2EHSA 4IZ6A 2ROQA 2K93A 2N6ZA 2KG6A 2LIUA 5KP8B 1DV5A 2FVFA 4PWVB 4NEOA 2LL8A 1HQBA 2FQ0A 2PNGA 4R0MA 2KOPA 2FAEA 2K92A 2KR5A 1HY8A 4PXHB 4BPGA 2LMLA 3NY7B 4HKGA 5KP6B 2JQ4A 2KGAA 1VKUA 2M5RA 5EJDA 2KOSA 2FACA 2MVUA 2JU2A 4H2YC 5HV8A 2K0XA 2FVAA 1AF8A 2KGCA 2K2QA 2CNRA 1NQ4A 3EJDA 1T8KA 2LKIA 2LTEA 2L22A 2KOOA 2KGEA 2MY5A 5HVCA 2KG9A 4DG9A 2L0QA 3EJBA 4BPHA 2AFDA 2DNWA 3CE7A 4BPFA 2L4BA 2AF8A 1OR5A 2MVVA 2XZ0D 2KORA 3LMOA 4H2WC 2AVAA 2N50A 2KWLA 2JGPA 1L0IA 2N5IA 2CG5B 2GDYA 2N98A 2N6YA 2FADA 2N5HA 2CQ8A 2MF4A 4MRTC 2LIWA 1KLPA 2KG8A 5CZDB 2FHSC 1ACPA 2EHTA 2FQ2A 2VSQA 2L9FA 1DNYA 2CGQA 2JU1A 5KP7B 2QNWA 1F80D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPK A;  1L0H A;  2KOQ A;  2KW2 A;  2K94 A;  3GZM A;  4CA3 A;  2FVE A;  2AFE A;  2KGD A;  2MR7 A;  2K0Y A;  2FQ1 A;  2GDW A;  2X2B A;  1X3O A;  3GZL A;  4H2X C;  3RG2 A;  2LOL A;  2MD9 A;  2MR8 A;  2GDX A;  2XZ1 C;  3EJE A;  2EHS A;  4IZ6 A;  2ROQ A;  2K93 A;  2N6Z A;  2KG6 A;  2LIU A;  5KP8 B;  1DV5 A;  2FVF A;  4PWV B;  4NEO A;  2LL8 A;  1HQB A;  2FQ0 A;  2PNG A;  4R0M A;  2KOP A;  2FAE A;  2K92 A;  2KR5 A;  1HY8 A;  4PXH B;  4BPG A;  2LML A;  3NY7 B;  4HKG A;  5KP6 B;  2JQ4 A;  2KGA A;  1VKU A;  2M5R A;  5EJD A;  2KOS A;  2FAC A;  2MVU A;  2JU2 A;  4H2Y C;  5HV8 A;  2K0X A;  2FVA A;  1AF8 A;  2KGC A;  2K2Q A;  2CNR A;  1NQ4 A;  3EJD A;  1T8K A;  2LKI A;  2LTE A;  2L22 A;  2KOO A;  2KGE A;  2MY5 A;  5HVC A;  2KG9 A;  4DG9 A;  2L0Q A;  3EJB A;  4BPH A;  2AFD A;  2DNW A;  3CE7 A;  4BPF A;  2L4B A;  2AF8 A;  1OR5 A;  2MVV A;  2XZ0 D;  2KOR A;  3LMO A;  4H2W C;  2AVA A;  2N50 A;  2KWL A;  2JGP A;  1L0I A;  2N5I A;  2CG5 B;  2GDY A;  2N98 A;  2N6Y A;  2FAD A;  2N5H A;  2CQ8 A;  2MF4 A;  4MRT C;  2LIW A;  1KLP A;  2KG8 A;  5CZD B;  2FHS C;  1ACP A;  2EHT A;  2FQ2 A;  2VSQ A;  2L9F A;  1DNY A;  2CGQ A;  2JU1 A;  5KP7 B;  2QNW A;  1F80 D; 
#chains in the Genus database with same CATH topology
 2OTL P;  3DS2 A;  2KW2 A;  4CA3 A;  1FR2 A;  3GJN A;  2VLP A;  1QVG O;  2Z46 A;  4WYM A;  2GDW A;  3GZL A;  1VQ7 P;  2XXM A;  4XRQ A;  3CCU P;  3DPH A;  2MD9 A;  4IZ6 A;  2PEM A;  2ROQ A;  4QNB A;  1A43 A;  4UHP B;  3G21 A;  4PWV B;  3CCV P;  2JYL A;  1Q82 Q;  2K92 A;  2LF4 A;  4BPG A;  3VRL C;  3LRY A;  5KP6 B;  2Z45 A;  1W2B O;  4U0D A;  2JBG A;  5HV8 A;  4XFZ A;  2GZE A;  3HZQ A;  1NQ4 A;  2GZI A;  1IUQ A;  2LKI A;  1A8O A;  2LTE A;  3CCJ P;  1GXG A;  1YJW P;  2PEN A;  2KGE A;  2MY5 A;  3OW2 O;  2NO8 A;  4DG9 A;  2AFD A;  2DNW A;  4XFX A;  4BPF A;  1EOQ A;  1K30 A;  1IMP A;  2QEX P;  1OR5 A;  5BS2 A;  1ZMB A;  2PY8 A;  3CCE P;  4H2W C;  2KWL A;  3CC2 P;  3H4E A;  1Q81 Q;  5I4T G;  1KLP A;  3G29 A;  3G1I A;  2JO0 A;  4COC A;  1VQ9 P;  3B5I A;  2EIA A;  3CMA P;  2VSQ A;  1DNY A;  2PEK A;  1L0H A;  1YIT P;  4M0I A;  1VQ6 P;  1VQP P;  1K8A Q;  1M6E X;  2KGD A;  2K0Y A;  1M74 A;  1X3O A;  3RG2 A;  2PEO A;  2M8P A;  5HGO A;  4U0A A;  1JJ2 O;  2PEQ A;  2VLO A;  4PH0 A;  2JYG A;  2K93 A;  2XV6 A;  2N6Z A;  3G1G A;  3CPW O;  2BHV A;  1ZNV A;  2P9X A;  2PNG A;  4R0M A;  2FAE A;  4PXH B;  2E1M A;  1NJI Q;  2LML A;  1VQL P;  1YI2 P;  4HKG A;  4U0F A;  1MZ8 A;  2FAC A;  2MVU A;  1Z6M A;  2FVA A;  2K2Q A;  1T8K A;  4XFY A;  3DTJ A;  3DS5 A;  2L22 A;  1BXI A;  3CC7 P;  2L0Q A;  3EJB A;  3B4Q A;  5HGL A;  2VLQ A;  5F2N A;  3CXC O;  1UJZ A;  7CEI A;  2AF8 A;  1M1K Q;  2CWO A;  1VQ4 P;  2MVV A;  2Z44 A;  1CEI A;  2KOR A;  1YIJ P;  1EMV A;  3NTE A;  2N5I A;  2CG5 B;  2L6E A;  3M1M A;  2N98 A;  2EFJ A;  2MF4 A;  1VQ5 P;  2DGY A;  4MRT C;  1VHN A;  2FHS C;  3H0D A;  1S72 P;  2FQ2 A;  4U0E A;  2CGQ A;  1AYI A;  2JU1 A;  1D1D A;  4H2Y C;  1QRJ A;  1F80 D;  2LPK A;  1QVF O;  2KOQ A;  1M90 Q;  3GZM A;  2K94 A;  2M8L A;  1M6N A;  2FVE A;  3DS0 A;  3RG6 C;  2K5X A;  1YJN P;  1VQ8 P;  2EG5 A;  4H2X C;  3CCM P;  5HGN A;  2MR8 A;  2GDX A;  3EJE A;  1E0H A;  3MGE A;  2KG6 A;  2QA4 P;  5KP8 B;  1DV5 A;  2FVF A;  2LL8 A;  1HQB A;  3CC4 P;  3DS4 A;  3P05 A;  3G6E P;  4PH1 A;  2KOP A;  2KR5 A;  1HY8 A;  4GR6 A;  3NY7 B;  2JQ4 A;  1VKU A;  2ONT A;  2M5R A;  3GKL C;  3I56 P;  2KOS A;  3WBH A;  5EW5 E;  3CCQ P;  1EIA A;  1AF8 A;  1Q86 Q;  1YHQ P;  4GR2 A;  3HYB A;  3EJD A;  2KOD A;  1VQO P;  3Q20 A;  1UNK A;  1AUM A;  3DS1 A;  4F37 A;  3CE7 A;  2L4B A;  3U43 A;  3G71 P;  2XZ0 D;  1K73 Q;  3LMO A;  5F2O A;  1N8R Q;  1L0I A;  2PEI A;  3I55 P;  1GXH A;  1KD1 Q;  1Q7Y Q;  2KG8 A;  1E6J P;  5CZD B;  4COP A;  2ERH A;  2EHT A;  5F2K A;  3G0V A;  5KP7 B;  2QNW A;  1VQM P;  1K9M Q;  2GZG A;  2JB0 A;  5BS1 A;  2AFE A;  2GYK A;  3CCL P;  2MR7 A;  2PEJ A;  2FQ1 A;  2JAZ A;  2X2B A;  5JPA A;  1RNI A;  2OTJ P;  1BAJ A;  2LOL A;  3CME P;  2XZ1 C;  2WPT A;  2EHS A;  1KC8 Q;  2LIU A;  3H47 A;  5HGM A;  3G28 A;  4NEO A;  4U0B A;  5DCK A;  2BUO A;  1RO0 A;  2FQ0 A;  1VQN P;  3DS3 A;  2K0D X;  2KGA A;  5EJD A;  2GZJ A;  2JU2 A;  2K0X A;  2KGC A;  2CNR A;  2M8N A;  2GZF A;  4U0C A;  4IPY A;  2KOO A;  2XT1 A;  3G4S P;  5HVC A;  2KG9 A;  3G26 A;  4QKO A;  4BPH A;  1RO2 A;  3CCR P;  1VQK P;  1YJ9 P;  2AVA A;  2N50 A;  2JGP A;  1KQS O;  3CD6 P;  2GDY A;  4XRO A;  2VLN A;  1GPJ A;  2N6Y A;  2FAD A;  2N5H A;  2CQ8 A;  3CCS P;  2LIW A;  2OAR A;  1ACP A;  2L9F A;  1IMQ A;  3E2D A; 
#chains in the Genus database with same CATH homology
 2LPK A;  1L0H A;  2KOQ A;  2KW2 A;  2K94 A;  3GZM A;  4CA3 A;  2FVE A;  2AFE A;  2KGD A;  2MR7 A;  2K0Y A;  2FQ1 A;  2GDW A;  2X2B A;  1X3O A;  3GZL A;  4H2X C;  3RG2 A;  2LOL A;  2MD9 A;  2MR8 A;  2GDX A;  2XZ1 C;  3EJE A;  2EHS A;  4IZ6 A;  2ROQ A;  2K93 A;  2N6Z A;  2KG6 A;  2LIU A;  5KP8 B;  1DV5 A;  2FVF A;  4PWV B;  4NEO A;  2LL8 A;  1HQB A;  2FQ0 A;  2PNG A;  4R0M A;  2KOP A;  2FAE A;  2K92 A;  2KR5 A;  1HY8 A;  4PXH B;  4BPG A;  2LML A;  3NY7 B;  4HKG A;  5KP6 B;  2JQ4 A;  2KGA A;  1VKU A;  2M5R A;  5EJD A;  2KOS A;  2FAC A;  2MVU A;  2JU2 A;  4H2Y C;  5HV8 A;  2K0X A;  2FVA A;  1AF8 A;  2KGC A;  2K2Q A;  2CNR A;  1NQ4 A;  3EJD A;  1T8K A;  2LKI A;  2LTE A;  2L22 A;  2KOO A;  2KGE A;  2MY5 A;  5HVC A;  2KG9 A;  4DG9 A;  2L0Q A;  3EJB A;  4BPH A;  2AFD A;  2DNW A;  3CE7 A;  4BPF A;  2L4B A;  2AF8 A;  1OR5 A;  2MVV A;  2XZ0 D;  2KOR A;  3LMO A;  4H2W C;  2AVA A;  2N50 A;  2KWL A;  2JGP A;  1L0I A;  2N5I A;  2CG5 B;  2GDY A;  2N98 A;  2N6Y A;  2FAD A;  2N5H A;  2CQ8 A;  2MF4 A;  4MRT C;  2LIW A;  1KLP A;  2KG8 A;  5CZD B;  2FHS C;  1ACP A;  2EHT A;  2FQ2 A;  2VSQ A;  2L9F A;  1DNY A;  2CGQ A;  2JU1 A;  5KP7 B;  2QNW A;  1F80 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...