2LIUA

Nmr structure of holo-acpi domain from cura module from lyngbya majuscula
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase
molecule keywords CurA
total genus 23
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2liuA01
2GDXA 2KWLA 2AFEA 2LPKA 1L0HA 2LOLA 2AVAA 2FHSC 2KG8A 5CZDB 2CNRA 2KGAA 2LTEA 2N6ZA 2L9FA 2MVVA 2X2BA 2KGCA 2KG6A 1KLPA 2CQ8A 4MRTC 4H2YC 5KP7B 2N5IA 2KORA 2DNWA 2LL8A 2MR8A 2FAEA 2PNGA 2GDWA 3NY7B 2VSQA 2K0XA 2MD9A 2K92A 1L0IA 1AF8A 2ROQA 2KW2A 2LKIA 3EJEA 2L0QA 2KOPA 2N50A 4BPFA 1OR5A 4PWVB 2KGDA 2MVUA 2L4BA 4DG9A 1ACPA 2FQ0A 2FVEA 2XZ1C 2FADA 2GDYA 2AFDA 3CE7A 2FVAA 4IZ6A 2N5HA 1DNYA 2KOQA 5EJDA 4H2XC 4BPGA 2FQ2A 1F80D 2QNWA 3GZMA 1X3OA 2K2QA 2N6YA 2N98A 2AF8A 2FQ1A 2JU2A 2MR7A 3RG2A 2JGPA 1VKUA 2JU1A 4R0MA 2XZ0D 3LMOA 2EHSA 2K0YA 2KOOA 2FACA 2MF4A 1HQBA 2K93A 5HVCA 5KP6B 2CGQA 4NEOA 5KP8B 2LIUA 3GZLA 2CG5B 2KG9A 2FVFA 4BPHA 3EJDA 1DV5A 2KOSA 4HKGA 2MY5A 4H2WC 2KGEA 1T8KA 2EHTA 1NQ4A 5HV8A 2KR5A 4PXHB 2LIWA 4CA3A 2K94A 2L22A 2M5RA 1HY8A 3EJBA 2LMLA 2JQ4A
chains in the Genus database with same CATH superfamily
2JAZA 2KWLA 2AFEA 1L0HA 1YIJP 5F2NA 1ZMBA 2KGAA 2CWOA 4XRQA 2X2BA 4F37A 2LF4A 1RO0A 4MRTC 4H2YC 3G0VA 2DNWA 1M1KQ 7CEIA 3DS2A 2FAEA 2GZJA 3MGEA 2WPTA 1GXHA 2K0XA 2PENA 2K92A 2LKIA 3EJEA 2VLQA 4COCA 3DS5A 4BPFA 4PWVB 2E1MA 2M8NA 2MVUA 4DG9A 1M90Q 2XZ1C 3CE7A 1EOQA 2N5HA 1VQLP 4BPGA 2ONTA 1K9MQ 2JYLA 1X3OA 2K2QA 3RG2A 3GJNA 2GZIA 1VQNP 1JJ2O 1W2BO 1A43A 2EHSA 3G21A 3CCRP 3CC4P 2MF4A 3DS3A 5HVCA 1A8OA 1K73Q 1KQSO 2M8LA 2XV6A 2PEQA 3CCQP 2GZEA 1VQKP 2FVFA 2OTJP 2EG5A 2Z45A 2KOSA 1ZNVA 3CCUP 1VQ8P 4CA3A 4M0IA 1GPJA 1Q7YQ 3EJBA 4QKOA 2KODA 5JPAA 2K5XA 2LMLA 2LOLA 2AVAA 2FHSC 1Z6MA 5CZDB 2LTEA 2N6ZA 2QEXP 3U43A 1QVGO 2KG6A 3M1MA 1KLPA 2CQ8A 2KORA 1VQ4P 2PNGA 1BAJA 1Q86Q 3VRLC 3CCEP 2L0QA 2KOPA 1OR5A 2XT1A 2KGDA 2L4BA 3CCSP 1ACPA 3CPWO 3OW2O 1E6JP 2AFDA 2FVAA 4U0AA 1RO2A 2JBGA 1F80D 3B5IA 1M6EX 2FQ1A 3G71P 5EW5E 2JGPA 4R0MA 3WBHA 3LMOA 3CXCO 1VQ7P 1YJWP 2K0YA 2KOOA 2PY8A 2FACA 1IMQA 3NTEA 5KP6B 2CGQA 3CC2P 5I4TG 1EIAA 3GZLA 2P9XA 3CCLP 3B4QA 2NO8A 2KG9A 4BPHA 3EJDA 4GR2A 1QRJA 1VQPP 3G6EP 2EIAA 2MY5A 4H2WC 3CCJP 2PEOA 4WYMA 1M6NA 5HV8A 3LRYA 1YITP 3DS1A 2K0DX 2M5RA 1HY8A 4PH1A 3H0DA 2PEIA 1EMVA 1MZ8A 2PEJA 2GDXA 2JO0A 2LPKA 2Z46A 2KG8A 2CNRA 5HGNA 2OTLP 5BS2A 2PEKA 1NJIQ 1QVFO 2L9FA 2BUOA 2MVVA 4UHPB 3CMAP 2Z44A 3CMEP 3G26A 1VQ6P 5KP7B 1KC8Q 1S72P 3G4SP 2GDWA 1FR2A 3NY7B 2VSQA 1KD1Q 1VQ5P 1YI2P 2JYGA 1AF8A 1CEIA 2KW2A 2GZGA 4IPYA 1DNYA 2ERHA 4U0BA 4H2XC 2FQ2A 4COPA 1K30A 2N6YA 3G1IA 2OARA 2AF8A 2JU2A 2MR7A 3DS0A 1VKUA 3I55P 2M8PA 5HGMA 3H4EA 1AYIA 2VLNA 5KP8B 4XFZA 1RNIA 2CG5B 1IUQA 1AUMA 3G28A 1DV5A 4HKGA 3I56P 5DCKA 1YJ9P 2KGEA 4XROA 4PH0A 1VQ9P 2PEMA 3P05A 2LIWA 2K94A 3DTJA 2VLPA 3CC7P 1E0HA 2L22A 5BS1A 2VLOA 5HGOA 2QA4P 5F2KA 1M74A 2JQ4A 4XFYA 2XXMA 1UNKA 3Q20A 3CCMP 2BHVA 2KGCA 4GR6A 1BXIA 4U0DA 5F2OA 3G29A 3RG6C 2N5IA 2LL8A 3CD6P 2MR8A 2MD9A 4XFXA 4U0CA 1L0IA 5HGLA 2ROQA 2L6EA 3HYBA 2N50A 3HZQA 1VQOP 2FQ0A 2FVEA 2FADA 3H47A 2GDYA 4IZ6A 4QNBA 2KOQA 5EJDA 1K8AQ 3DPHA 1UJZA 2QNWA 3GZMA 1YHQP 3E2DA 4U0EA 2N98A 4U0FA 3GKLC 2JU1A 3G1GA 2XZ0D 2GZFA 1GXGA 1IMPA 1HQBA 2K93A 4NEOA 2JB0A 2EFJA 2LIUA 1VQMP 3DS4A 1D1DA 2GYKA 1VHNA 1T8KA 3CCVP 1YJNP 2EHTA 1NQ4A 1Q82Q 1Q81Q 2KR5A 4PXHB 1N8RQ 2DGYA
chains in the Genus database with same CATH topology
2GDXA 2KWLA 2AFEA 2LPKA 1L0HA 2LOLA 2AVAA 2FHSC 2KG8A 5CZDB 2CNRA 2KGAA 2LTEA 2N6ZA 2L9FA 2MVVA 2X2BA 2KGCA 2KG6A 1KLPA 2CQ8A 4MRTC 4H2YC 5KP7B 2N5IA 2KORA 2DNWA 2LL8A 2MR8A 2FAEA 2PNGA 2GDWA 3NY7B 2VSQA 2K0XA 2MD9A 2K92A 1L0IA 1AF8A 2ROQA 2KW2A 2LKIA 3EJEA 2L0QA 2KOPA 2N50A 4BPFA 1OR5A 4PWVB 2KGDA 2MVUA 2L4BA 4DG9A 1ACPA 2FQ0A 2FVEA 2XZ1C 2FADA 2GDYA 2AFDA 3CE7A 2FVAA 4IZ6A 2N5HA 1DNYA 2KOQA 5EJDA 4H2XC 4BPGA 2FQ2A 1F80D 2QNWA 3GZMA 1X3OA 2K2QA 2N6YA 2N98A 2AF8A 2FQ1A 2JU2A 2MR7A 3RG2A 2JGPA 1VKUA 2JU1A 4R0MA 2XZ0D 3LMOA 2EHSA 2K0YA 2KOOA 2FACA 2MF4A 1HQBA 2K93A 5HVCA 5KP6B 2CGQA 4NEOA 5KP8B 2LIUA 3GZLA 2CG5B 2KG9A 2FVFA 4BPHA 3EJDA 1DV5A 2KOSA 4HKGA 2MY5A 4H2WC 2KGEA 1T8KA 2EHTA 1NQ4A 5HV8A 2KR5A 4PXHB 2LIWA 4CA3A 2K94A 2L22A 2M5RA 1HY8A 3EJBA 2LMLA 2JQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDX A;  2KWL A;  2AFE A;  2LPK A;  1L0H A;  2LOL A;  2AVA A;  2FHS C;  2KG8 A;  5CZD B;  2CNR A;  2KGA A;  2LTE A;  2N6Z A;  2L9F A;  2MVV A;  2X2B A;  2KGC A;  2KG6 A;  1KLP A;  2CQ8 A;  4MRT C;  4H2Y C;  5KP7 B;  2N5I A;  2KOR A;  2DNW A;  2LL8 A;  2MR8 A;  2FAE A;  2PNG A;  2GDW A;  3NY7 B;  2VSQ A;  2K0X A;  2MD9 A;  2K92 A;  1L0I A;  1AF8 A;  2ROQ A;  2KW2 A;  2LKI A;  3EJE A;  2L0Q A;  2KOP A;  2N50 A;  4BPF A;  1OR5 A;  4PWV B;  2KGD A;  2MVU A;  2L4B A;  4DG9 A;  1ACP A;  2FQ0 A;  2FVE A;  2XZ1 C;  2FAD A;  2GDY A;  2AFD A;  3CE7 A;  2FVA A;  4IZ6 A;  2N5H A;  1DNY A;  2KOQ A;  5EJD A;  4H2X C;  4BPG A;  2FQ2 A;  1F80 D;  2QNW A;  3GZM A;  1X3O A;  2K2Q A;  2N6Y A;  2N98 A;  2AF8 A;  2FQ1 A;  2JU2 A;  2MR7 A;  3RG2 A;  2JGP A;  1VKU A;  2JU1 A;  4R0M A;  2XZ0 D;  3LMO A;  2EHS A;  2K0Y A;  2KOO A;  2FAC A;  2MF4 A;  1HQB A;  2K93 A;  5HVC A;  5KP6 B;  2CGQ A;  4NEO A;  5KP8 B;  2LIU A;  3GZL A;  2CG5 B;  2KG9 A;  2FVF A;  4BPH A;  3EJD A;  1DV5 A;  2KOS A;  4HKG A;  2MY5 A;  4H2W C;  2KGE A;  1T8K A;  2EHT A;  1NQ4 A;  5HV8 A;  2KR5 A;  4PXH B;  2LIW A;  4CA3 A;  2K94 A;  2L22 A;  2M5R A;  1HY8 A;  3EJB A;  2LML A;  2JQ4 A; 
#chains in the Genus database with same CATH topology
 2JAZ A;  2KWL A;  2AFE A;  1L0H A;  1YIJ P;  5F2N A;  1ZMB A;  2KGA A;  2CWO A;  4XRQ A;  2X2B A;  4F37 A;  2LF4 A;  1RO0 A;  4MRT C;  4H2Y C;  3G0V A;  2DNW A;  1M1K Q;  7CEI A;  3DS2 A;  2FAE A;  2GZJ A;  3MGE A;  2WPT A;  1GXH A;  2K0X A;  2PEN A;  2K92 A;  2LKI A;  3EJE A;  2VLQ A;  4COC A;  3DS5 A;  4BPF A;  4PWV B;  2E1M A;  2M8N A;  2MVU A;  4DG9 A;  1M90 Q;  2XZ1 C;  3CE7 A;  1EOQ A;  2N5H A;  1VQL P;  4BPG A;  2ONT A;  1K9M Q;  2JYL A;  1X3O A;  2K2Q A;  3RG2 A;  3GJN A;  2GZI A;  1VQN P;  1JJ2 O;  1W2B O;  1A43 A;  2EHS A;  3G21 A;  3CCR P;  3CC4 P;  2MF4 A;  3DS3 A;  5HVC A;  1A8O A;  1K73 Q;  1KQS O;  2M8L A;  2XV6 A;  2PEQ A;  3CCQ P;  2GZE A;  1VQK P;  2FVF A;  2OTJ P;  2EG5 A;  2Z45 A;  2KOS A;  1ZNV A;  3CCU P;  1VQ8 P;  4CA3 A;  4M0I A;  1GPJ A;  1Q7Y Q;  3EJB A;  4QKO A;  2KOD A;  5JPA A;  2K5X A;  2LML A;  2LOL A;  2AVA A;  2FHS C;  1Z6M A;  5CZD B;  2LTE A;  2N6Z A;  2QEX P;  3U43 A;  1QVG O;  2KG6 A;  3M1M A;  1KLP A;  2CQ8 A;  2KOR A;  1VQ4 P;  2PNG A;  1BAJ A;  1Q86 Q;  3VRL C;  3CCE P;  2L0Q A;  2KOP A;  1OR5 A;  2XT1 A;  2KGD A;  2L4B A;  3CCS P;  1ACP A;  3CPW O;  3OW2 O;  1E6J P;  2AFD A;  2FVA A;  4U0A A;  1RO2 A;  2JBG A;  1F80 D;  3B5I A;  1M6E X;  2FQ1 A;  3G71 P;  5EW5 E;  2JGP A;  4R0M A;  3WBH A;  3LMO A;  3CXC O;  1VQ7 P;  1YJW P;  2K0Y A;  2KOO A;  2PY8 A;  2FAC A;  1IMQ A;  3NTE A;  5KP6 B;  2CGQ A;  3CC2 P;  5I4T G;  1EIA A;  3GZL A;  2P9X A;  3CCL P;  3B4Q A;  2NO8 A;  2KG9 A;  4BPH A;  3EJD A;  4GR2 A;  1QRJ A;  1VQP P;  3G6E P;  2EIA A;  2MY5 A;  4H2W C;  3CCJ P;  2PEO A;  4WYM A;  1M6N A;  5HV8 A;  3LRY A;  1YIT P;  3DS1 A;  2K0D X;  2M5R A;  1HY8 A;  4PH1 A;  3H0D A;  2PEI A;  1EMV A;  1MZ8 A;  2PEJ A;  2GDX A;  2JO0 A;  2LPK A;  2Z46 A;  2KG8 A;  2CNR A;  5HGN A;  2OTL P;  5BS2 A;  2PEK A;  1NJI Q;  1QVF O;  2L9F A;  2BUO A;  2MVV A;  4UHP B;  3CMA P;  2Z44 A;  3CME P;  3G26 A;  1VQ6 P;  5KP7 B;  1KC8 Q;  1S72 P;  3G4S P;  2GDW A;  1FR2 A;  3NY7 B;  2VSQ A;  1KD1 Q;  1VQ5 P;  1YI2 P;  2JYG A;  1AF8 A;  1CEI A;  2KW2 A;  2GZG A;  4IPY A;  1DNY A;  2ERH A;  4U0B A;  4H2X C;  2FQ2 A;  4COP A;  1K30 A;  2N6Y A;  3G1I A;  2OAR A;  2AF8 A;  2JU2 A;  2MR7 A;  3DS0 A;  1VKU A;  3I55 P;  2M8P A;  5HGM A;  3H4E A;  1AYI A;  2VLN A;  5KP8 B;  4XFZ A;  1RNI A;  2CG5 B;  1IUQ A;  1AUM A;  3G28 A;  1DV5 A;  4HKG A;  3I56 P;  5DCK A;  1YJ9 P;  2KGE A;  4XRO A;  4PH0 A;  1VQ9 P;  2PEM A;  3P05 A;  2LIW A;  2K94 A;  3DTJ A;  2VLP A;  3CC7 P;  1E0H A;  2L22 A;  5BS1 A;  2VLO A;  5HGO A;  2QA4 P;  5F2K A;  1M74 A;  2JQ4 A;  4XFY A;  2XXM A;  1UNK A;  3Q20 A;  3CCM P;  2BHV A;  2KGC A;  4GR6 A;  1BXI A;  4U0D A;  5F2O A;  3G29 A;  3RG6 C;  2N5I A;  2LL8 A;  3CD6 P;  2MR8 A;  2MD9 A;  4XFX A;  4U0C A;  1L0I A;  5HGL A;  2ROQ A;  2L6E A;  3HYB A;  2N50 A;  3HZQ A;  1VQO P;  2FQ0 A;  2FVE A;  2FAD A;  3H47 A;  2GDY A;  4IZ6 A;  4QNB A;  2KOQ A;  5EJD A;  1K8A Q;  3DPH A;  1UJZ A;  2QNW A;  3GZM A;  1YHQ P;  3E2D A;  4U0E A;  2N98 A;  4U0F A;  3GKL C;  2JU1 A;  3G1G A;  2XZ0 D;  2GZF A;  1GXG A;  1IMP A;  1HQB A;  2K93 A;  4NEO A;  2JB0 A;  2EFJ A;  2LIU A;  1VQM P;  3DS4 A;  1D1D A;  2GYK A;  1VHN A;  1T8K A;  3CCV P;  1YJN P;  2EHT A;  1NQ4 A;  1Q82 Q;  1Q81 Q;  2KR5 A;  4PXH B;  1N8R Q;  2DGY A; 
#chains in the Genus database with same CATH homology
 2GDX A;  2KWL A;  2AFE A;  2LPK A;  1L0H A;  2LOL A;  2AVA A;  2FHS C;  2KG8 A;  5CZD B;  2CNR A;  2KGA A;  2LTE A;  2N6Z A;  2L9F A;  2MVV A;  2X2B A;  2KGC A;  2KG6 A;  1KLP A;  2CQ8 A;  4MRT C;  4H2Y C;  5KP7 B;  2N5I A;  2KOR A;  2DNW A;  2LL8 A;  2MR8 A;  2FAE A;  2PNG A;  2GDW A;  3NY7 B;  2VSQ A;  2K0X A;  2MD9 A;  2K92 A;  1L0I A;  1AF8 A;  2ROQ A;  2KW2 A;  2LKI A;  3EJE A;  2L0Q A;  2KOP A;  2N50 A;  4BPF A;  1OR5 A;  4PWV B;  2KGD A;  2MVU A;  2L4B A;  4DG9 A;  1ACP A;  2FQ0 A;  2FVE A;  2XZ1 C;  2FAD A;  2GDY A;  2AFD A;  3CE7 A;  2FVA A;  4IZ6 A;  2N5H A;  1DNY A;  2KOQ A;  5EJD A;  4H2X C;  4BPG A;  2FQ2 A;  1F80 D;  2QNW A;  3GZM A;  1X3O A;  2K2Q A;  2N6Y A;  2N98 A;  2AF8 A;  2FQ1 A;  2JU2 A;  2MR7 A;  3RG2 A;  2JGP A;  1VKU A;  2JU1 A;  4R0M A;  2XZ0 D;  3LMO A;  2EHS A;  2K0Y A;  2KOO A;  2FAC A;  2MF4 A;  1HQB A;  2K93 A;  5HVC A;  5KP6 B;  2CGQ A;  4NEO A;  5KP8 B;  2LIU A;  3GZL A;  2CG5 B;  2KG9 A;  2FVF A;  4BPH A;  3EJD A;  1DV5 A;  2KOS A;  4HKG A;  2MY5 A;  4H2W C;  2KGE A;  1T8K A;  2EHT A;  1NQ4 A;  5HV8 A;  2KR5 A;  4PXH B;  2LIW A;  4CA3 A;  2K94 A;  2L22 A;  2M5R A;  1HY8 A;  3EJB A;  2LML A;  2JQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...