2LIUA

Nmr structure of holo-acpi domain from cura module from lyngbya majuscula
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords CurA
publication title Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.
pubmed doi rcsb
source organism Lyngbya majuscula
total genus 23
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2liuA01
2CGQA 2DNWA 5KP7B 4NEOA 2MR7A 4BPFA 2KR5A 4BPGA 5KP8B 2QNWA 1L0HA 2EHSA 2MVVA 1KLPA 2FQ2A 2N6YA 2AFDA 4BPHA 1DV5A 1VKUA 2PNGA 2FQ1A 2JQ4A 1AF8A 2XZ0D 3CE7A 2N5IA 2CNRA 2K93A 2KGCA 4PWVB 2K92A 2ROQA 1NQ4A 2AVAA 1DNYA 2EHTA 1F80D 2K2QA 2L9FA 2VSQA 4MRTC 2JU1A 2KOOA 1ACPA 2KGAA 2JGPA 2LIWA 2KOPA 3EJDA 2FACA 2GDXA 1T8KA 2LTEA 5HV8A 2FADA 2K0YA 2GDWA 1HQBA 3EJBA 2AF8A 5HVCA 2LIUA 2N5HA 2KOQA 2N98A 2MR8A 2FQ0A 2N50A 5EJDA 2LOLA 3GZMA 2CQ8A 2KGDA 4DG9A 3NY7B 2KORA 2FVAA 2K94A 4H2XC 2KOSA 2FAEA 2AFEA 2FVEA 2K0XA 2KG9A 2KGEA 2N6ZA 4H2WC 2MY5A 1HY8A 3EJEA 2FHSC 2LPKA 5CZDB 2KG8A 2LL8A 3LMOA 3RG2A 4PXHB 2XZ1C 2L0QA 2MD9A 4HKGA 2KWLA 2CG5B 2MVUA 2L22A 2LMLA 2GDYA 1OR5A 4CA3A 4IZ6A 2KW2A 1L0IA 2FVFA 2KG6A 2MF4A 3GZLA 2LKIA 5KP6B 2X2BA 4H2YC 2L4BA 1X3OA 4R0MA 2M5RA 2JU2A
chains in the Genus database with same CATH superfamily
3H0DA 2GZEA 2DNWA 1ZMBA 2MR7A 4BPFA 2M8NA 1L0HA 2EHSA 3HYBA 5DCKA 1KLPA 2N6YA 1K8AQ 3H47A 4BPHA 5BS2A 1KD1Q 1DV5A 3P05A 3H4EA 3E2DA 1QRJA 1AF8A 2XZ0D 3CE7A 1KQSO 3CXCO 2K93A 2JYGA 4IPYA 2ROQA 5F2KA 3I55P 3CC4P 3CMAP 2L9FA 2JBGA 1M6NA 1EIAA 3EJDA 3CCMP 2PY8A 1UJZA 3NTEA 2GDWA 2AF8A 5HVCA 2N50A 1D1DA 2K94A 1AUMA 1IMPA 2FAEA 2OTLP 2FVEA 2KG9A 2QA4P 3CCUP 4U0FA 1HY8A 1A43A 2JB0A 2JAZA 5BS1A 2FHSC 1VQOP 4COCA 1S72P 1VHNA 2ONTA 4HKGA 1MZ8A 2EG5A 5HGMA 3CCJP 2NO8A 1IMQA 5HGOA 1YJNP 5HGNA 3G1GA 2KW2A 2MF4A 3GZLA 2X2BA 2VLQA 2BUOA 1X3OA 2PEIA 2JU2A 1VQ4P 4XFZA 1VQLP 4XFXA 4BPGA 2WPTA 1KC8Q 5KP8B 2QNWA 2MVVA 2GYKA 3DPHA 1GXHA 1VKUA 1N8RQ 3CD6P 3CPWO 1NQ4A 2EHTA 2GZFA 1ACPA 2KGAA 2LIWA 4QKOA 4M0IA 1E0HA 4WYMA 1ZNVA 2LTEA 5I4TG 1K9MQ 2FADA 2K0YA 3EJBA 2LIUA 2ERHA 2MR8A 2FQ0A 7CEIA 5EJDA 2FVAA 2E1MA 3B4QA 2KOSA 3RG6C 2EFJA 3VRLC 1FR2A 1UNKA 2LPKA 3G29A 3CC2P 1RO2A 3G71P 2L22A 1GPJA 3DTJA 4CA3A 1Q7YQ 4PH0A 1VQMP 3CCLP 4XROA 2PEQA 1L0IA 1Q82Q 4XFYA 1VQ9P 4H2YC 2L4BA 4R0MA 1RNIA 2P9XA 3CC7P 3WBHA 5KP7B 4NEOA 1VQ7P 1W2BO 3DS0A 2FQ2A 1M90Q 1VQ8P 1M1KQ 2PNGA 2OTJP 3DS5A 2JQ4A 2N5IA 3G28A 2CNRA 2BHVA 4PWVB 2VSQA 4MRTC 4F37A 2JU1A 1M74A 1AYIA 3CCEP 2JGPA 2KOPA 3G26A 2CWOA 2PEOA 1YIJP 2FACA 2GDXA 1BAJA 5HV8A 4GR6A 1YJ9P 2VLPA 1HQBA 2Z45A 3G21A 3CCSP 2KOQA 1VQPP 2XXMA 2N98A 4QNBA 2XV6A 3OW2O 2LF4A 3GZMA 2XT1A 2CQ8A 2KGDA 3NY7B 2M8PA 2Z44A 3DS2A 2PEJA 4XRQA 2PEMA 1K73Q 2K0DX 4U0BA 5JPAA 3G6EP 2K5XA 1E6JP 2MY5A 2M8LA 3U43A 5F2NA 3G4SP 1YJWP 3Q20A 3DS1A 5CZDB 1A8OA 3RG2A 4PXHB 2XZ1C 2L0QA 2MD9A 2KWLA 2CG5B 2MVUA 1NJIQ 1K30A 1M6EX 3DS3A 2GDYA 4U0AA 3I56P 4IZ6A 2KG6A 2GZJA 2LKIA 4U0CA 5F2OA 2Z46A 3CMEP 2VLNA 2M5RA 2CGQA 1Q86Q 2GZIA 3DS4A 2KR5A 2AFDA 2OARA 2JO0A 4PH1A 2GZGA 2PEKA 2KODA 2FQ1A 3CCQP 2KGCA 2K92A 2AVAA 1DNYA 1YHQP 1F80D 2K2QA 1JJ2O 1GXGA 2JYLA 2KOOA 5EW5E 1T8KA 3HZQA 2DGYA 5HGLA 2N5HA 1VQ6P 2LOLA 1Q81Q 3LRYA 4DG9A 2KORA 1VQNP 3CCVP 1CEIA 4H2XC 2AFEA 2K0XA 4U0DA 2L6EA 4UHPB 2KGEA 2N6ZA 4H2WC 4COPA 2VLOA 1BXIA 3EJEA 3GKLC 1EMVA 1VQ5P 2KG8A 2LL8A 3LMOA 3B5IA 1QVGO 2PENA 1YI2P 1QVFO 3MGEA 3M1MA 1RO0A 3GJNA 2LMLA 1VQKP 1IUQA 1Z6MA 4GR2A 1YITP 1OR5A 2QEXP 3CCRP 1EOQA 2FVFA 5KP6B 2EIAA 4U0EA 3G0VA 3G1IA
chains in the Genus database with same CATH topology
2CGQA 2DNWA 5KP7B 4NEOA 2MR7A 4BPFA 2KR5A 4BPGA 5KP8B 2QNWA 1L0HA 2EHSA 2MVVA 1KLPA 2FQ2A 2N6YA 2AFDA 4BPHA 1DV5A 1VKUA 2PNGA 2FQ1A 2JQ4A 1AF8A 2XZ0D 3CE7A 2N5IA 2CNRA 2K93A 2KGCA 4PWVB 2K92A 2ROQA 1NQ4A 2AVAA 1DNYA 2EHTA 1F80D 2K2QA 2L9FA 2VSQA 4MRTC 2JU1A 2KOOA 1ACPA 2KGAA 2JGPA 2LIWA 2KOPA 3EJDA 2FACA 2GDXA 1T8KA 2LTEA 5HV8A 2FADA 2K0YA 2GDWA 1HQBA 3EJBA 2AF8A 5HVCA 2LIUA 2N5HA 2KOQA 2N98A 2MR8A 2FQ0A 2N50A 5EJDA 2LOLA 3GZMA 2CQ8A 2KGDA 4DG9A 3NY7B 2KORA 2FVAA 2K94A 4H2XC 2KOSA 2FAEA 2AFEA 2FVEA 2K0XA 2KG9A 2KGEA 2N6ZA 4H2WC 2MY5A 1HY8A 3EJEA 2FHSC 2LPKA 5CZDB 2KG8A 2LL8A 3LMOA 3RG2A 4PXHB 2XZ1C 2L0QA 2MD9A 4HKGA 2KWLA 2CG5B 2MVUA 2L22A 2LMLA 2GDYA 1OR5A 4CA3A 4IZ6A 2KW2A 1L0IA 2FVFA 2KG6A 2MF4A 3GZLA 2LKIA 5KP6B 2X2BA 4H2YC 2L4BA 1X3OA 4R0MA 2M5RA 2JU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CGQ A;  2DNW A;  5KP7 B;  4NEO A;  2MR7 A;  4BPF A;  2KR5 A;  4BPG A;  5KP8 B;  2QNW A;  1L0H A;  2EHS A;  2MVV A;  1KLP A;  2FQ2 A;  2N6Y A;  2AFD A;  4BPH A;  1DV5 A;  1VKU A;  2PNG A;  2FQ1 A;  2JQ4 A;  1AF8 A;  2XZ0 D;  3CE7 A;  2N5I A;  2CNR A;  2K93 A;  2KGC A;  4PWV B;  2K92 A;  2ROQ A;  1NQ4 A;  2AVA A;  1DNY A;  2EHT A;  1F80 D;  2K2Q A;  2L9F A;  2VSQ A;  4MRT C;  2JU1 A;  2KOO A;  1ACP A;  2KGA A;  2JGP A;  2LIW A;  2KOP A;  3EJD A;  2FAC A;  2GDX A;  1T8K A;  2LTE A;  5HV8 A;  2FAD A;  2K0Y A;  2GDW A;  1HQB A;  3EJB A;  2AF8 A;  5HVC A;  2LIU A;  2N5H A;  2KOQ A;  2N98 A;  2MR8 A;  2FQ0 A;  2N50 A;  5EJD A;  2LOL A;  3GZM A;  2CQ8 A;  2KGD A;  4DG9 A;  3NY7 B;  2KOR A;  2FVA A;  2K94 A;  4H2X C;  2KOS A;  2FAE A;  2AFE A;  2FVE A;  2K0X A;  2KG9 A;  2KGE A;  2N6Z A;  4H2W C;  2MY5 A;  1HY8 A;  3EJE A;  2FHS C;  2LPK A;  5CZD B;  2KG8 A;  2LL8 A;  3LMO A;  3RG2 A;  4PXH B;  2XZ1 C;  2L0Q A;  2MD9 A;  4HKG A;  2KWL A;  2CG5 B;  2MVU A;  2L22 A;  2LML A;  2GDY A;  1OR5 A;  4CA3 A;  4IZ6 A;  2KW2 A;  1L0I A;  2FVF A;  2KG6 A;  2MF4 A;  3GZL A;  2LKI A;  5KP6 B;  2X2B A;  4H2Y C;  2L4B A;  1X3O A;  4R0M A;  2M5R A;  2JU2 A; 
#chains in the Genus database with same CATH topology
 3H0D A;  2GZE A;  2DNW A;  1ZMB A;  2MR7 A;  4BPF A;  2M8N A;  1L0H A;  2EHS A;  3HYB A;  5DCK A;  1KLP A;  2N6Y A;  1K8A Q;  3H47 A;  4BPH A;  5BS2 A;  1KD1 Q;  1DV5 A;  3P05 A;  3H4E A;  3E2D A;  1QRJ A;  1AF8 A;  2XZ0 D;  3CE7 A;  1KQS O;  3CXC O;  2K93 A;  2JYG A;  4IPY A;  2ROQ A;  5F2K A;  3I55 P;  3CC4 P;  3CMA P;  2L9F A;  2JBG A;  1M6N A;  1EIA A;  3EJD A;  3CCM P;  2PY8 A;  1UJZ A;  3NTE A;  2GDW A;  2AF8 A;  5HVC A;  2N50 A;  1D1D A;  2K94 A;  1AUM A;  1IMP A;  2FAE A;  2OTL P;  2FVE A;  2KG9 A;  2QA4 P;  3CCU P;  4U0F A;  1HY8 A;  1A43 A;  2JB0 A;  2JAZ A;  5BS1 A;  2FHS C;  1VQO P;  4COC A;  1S72 P;  1VHN A;  2ONT A;  4HKG A;  1MZ8 A;  2EG5 A;  5HGM A;  3CCJ P;  2NO8 A;  1IMQ A;  5HGO A;  1YJN P;  5HGN A;  3G1G A;  2KW2 A;  2MF4 A;  3GZL A;  2X2B A;  2VLQ A;  2BUO A;  1X3O A;  2PEI A;  2JU2 A;  1VQ4 P;  4XFZ A;  1VQL P;  4XFX A;  4BPG A;  2WPT A;  1KC8 Q;  5KP8 B;  2QNW A;  2MVV A;  2GYK A;  3DPH A;  1GXH A;  1VKU A;  1N8R Q;  3CD6 P;  3CPW O;  1NQ4 A;  2EHT A;  2GZF A;  1ACP A;  2KGA A;  2LIW A;  4QKO A;  4M0I A;  1E0H A;  4WYM A;  1ZNV A;  2LTE A;  5I4T G;  1K9M Q;  2FAD A;  2K0Y A;  3EJB A;  2LIU A;  2ERH A;  2MR8 A;  2FQ0 A;  7CEI A;  5EJD A;  2FVA A;  2E1M A;  3B4Q A;  2KOS A;  3RG6 C;  2EFJ A;  3VRL C;  1FR2 A;  1UNK A;  2LPK A;  3G29 A;  3CC2 P;  1RO2 A;  3G71 P;  2L22 A;  1GPJ A;  3DTJ A;  4CA3 A;  1Q7Y Q;  4PH0 A;  1VQM P;  3CCL P;  4XRO A;  2PEQ A;  1L0I A;  1Q82 Q;  4XFY A;  1VQ9 P;  4H2Y C;  2L4B A;  4R0M A;  1RNI A;  2P9X A;  3CC7 P;  3WBH A;  5KP7 B;  4NEO A;  1VQ7 P;  1W2B O;  3DS0 A;  2FQ2 A;  1M90 Q;  1VQ8 P;  1M1K Q;  2PNG A;  2OTJ P;  3DS5 A;  2JQ4 A;  2N5I A;  3G28 A;  2CNR A;  2BHV A;  4PWV B;  2VSQ A;  4MRT C;  4F37 A;  2JU1 A;  1M74 A;  1AYI A;  3CCE P;  2JGP A;  2KOP A;  3G26 A;  2CWO A;  2PEO A;  1YIJ P;  2FAC A;  2GDX A;  1BAJ A;  5HV8 A;  4GR6 A;  1YJ9 P;  2VLP A;  1HQB A;  2Z45 A;  3G21 A;  3CCS P;  2KOQ A;  1VQP P;  2XXM A;  2N98 A;  4QNB A;  2XV6 A;  3OW2 O;  2LF4 A;  3GZM A;  2XT1 A;  2CQ8 A;  2KGD A;  3NY7 B;  2M8P A;  2Z44 A;  3DS2 A;  2PEJ A;  4XRQ A;  2PEM A;  1K73 Q;  2K0D X;  4U0B A;  5JPA A;  3G6E P;  2K5X A;  1E6J P;  2MY5 A;  2M8L A;  3U43 A;  5F2N A;  3G4S P;  1YJW P;  3Q20 A;  3DS1 A;  5CZD B;  1A8O A;  3RG2 A;  4PXH B;  2XZ1 C;  2L0Q A;  2MD9 A;  2KWL A;  2CG5 B;  2MVU A;  1NJI Q;  1K30 A;  1M6E X;  3DS3 A;  2GDY A;  4U0A A;  3I56 P;  4IZ6 A;  2KG6 A;  2GZJ A;  2LKI A;  4U0C A;  5F2O A;  2Z46 A;  3CME P;  2VLN A;  2M5R A;  2CGQ A;  1Q86 Q;  2GZI A;  3DS4 A;  2KR5 A;  2AFD A;  2OAR A;  2JO0 A;  4PH1 A;  2GZG A;  2PEK A;  2KOD A;  2FQ1 A;  3CCQ P;  2KGC A;  2K92 A;  2AVA A;  1DNY A;  1YHQ P;  1F80 D;  2K2Q A;  1JJ2 O;  1GXG A;  2JYL A;  2KOO A;  5EW5 E;  1T8K A;  3HZQ A;  2DGY A;  5HGL A;  2N5H A;  1VQ6 P;  2LOL A;  1Q81 Q;  3LRY A;  4DG9 A;  2KOR A;  1VQN P;  3CCV P;  1CEI A;  4H2X C;  2AFE A;  2K0X A;  4U0D A;  2L6E A;  4UHP B;  2KGE A;  2N6Z A;  4H2W C;  4COP A;  2VLO A;  1BXI A;  3EJE A;  3GKL C;  1EMV A;  1VQ5 P;  2KG8 A;  2LL8 A;  3LMO A;  3B5I A;  1QVG O;  2PEN A;  1YI2 P;  1QVF O;  3MGE A;  3M1M A;  1RO0 A;  3GJN A;  2LML A;  1VQK P;  1IUQ A;  1Z6M A;  4GR2 A;  1YIT P;  1OR5 A;  2QEX P;  3CCR P;  1EOQ A;  2FVF A;  5KP6 B;  2EIA A;  4U0E A;  3G0V A;  3G1I A; 
#chains in the Genus database with same CATH homology
 2CGQ A;  2DNW A;  5KP7 B;  4NEO A;  2MR7 A;  4BPF A;  2KR5 A;  4BPG A;  5KP8 B;  2QNW A;  1L0H A;  2EHS A;  2MVV A;  1KLP A;  2FQ2 A;  2N6Y A;  2AFD A;  4BPH A;  1DV5 A;  1VKU A;  2PNG A;  2FQ1 A;  2JQ4 A;  1AF8 A;  2XZ0 D;  3CE7 A;  2N5I A;  2CNR A;  2K93 A;  2KGC A;  4PWV B;  2K92 A;  2ROQ A;  1NQ4 A;  2AVA A;  1DNY A;  2EHT A;  1F80 D;  2K2Q A;  2L9F A;  2VSQ A;  4MRT C;  2JU1 A;  2KOO A;  1ACP A;  2KGA A;  2JGP A;  2LIW A;  2KOP A;  3EJD A;  2FAC A;  2GDX A;  1T8K A;  2LTE A;  5HV8 A;  2FAD A;  2K0Y A;  2GDW A;  1HQB A;  3EJB A;  2AF8 A;  5HVC A;  2LIU A;  2N5H A;  2KOQ A;  2N98 A;  2MR8 A;  2FQ0 A;  2N50 A;  5EJD A;  2LOL A;  3GZM A;  2CQ8 A;  2KGD A;  4DG9 A;  3NY7 B;  2KOR A;  2FVA A;  2K94 A;  4H2X C;  2KOS A;  2FAE A;  2AFE A;  2FVE A;  2K0X A;  2KG9 A;  2KGE A;  2N6Z A;  4H2W C;  2MY5 A;  1HY8 A;  3EJE A;  2FHS C;  2LPK A;  5CZD B;  2KG8 A;  2LL8 A;  3LMO A;  3RG2 A;  4PXH B;  2XZ1 C;  2L0Q A;  2MD9 A;  4HKG A;  2KWL A;  2CG5 B;  2MVU A;  2L22 A;  2LML A;  2GDY A;  1OR5 A;  4CA3 A;  4IZ6 A;  2KW2 A;  1L0I A;  2FVF A;  2KG6 A;  2MF4 A;  3GZL A;  2LKI A;  5KP6 B;  2X2B A;  4H2Y C;  2L4B A;  1X3O A;  4R0M A;  2M5R A;  2JU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...