2LIUA

Nmr structure of holo-acpi domain from cura module from lyngbya majuscula
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase
molecule keywords CurA
total genus 23
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2liuA01
1NQ4A 1T8KA 2EHTA 1L0HA 2KWLA 2MF4A 1OR5A 2MVVA 2FVFA 2AFEA 2FQ2A 2K0YA 2JU2A 2KGAA 2LL8A 3EJDA 2X2BA 4HKGA 2GDXA 4IZ6A 1KLPA 4H2YC 2L9FA 5EJDA 2FQ1A 2LTEA 2FVAA 2KG6A 2M5RA 2L22A 2KOPA 2N6ZA 5CZDB 2DNWA 2LOLA 4MRTC 1DNYA 2KR5A 4BPGA 2N6YA 2AVAA 2MR8A 2L0QA 1HQBA 4BPHA 2KOOA 2QNWA 1AF8A 2XZ1C 1L0IA 2LPKA 2GDWA 4CA3A 2PNGA 4R0MA 2KOQA 2MD9A 1ACPA 2LIUA 2CQ8A 4H2WC 2K94A 4PXHB 4BPFA 2N98A 2KOSA 4PWVB 2FQ0A 3EJEA 2XZ0D 2KG8A 2KGDA 5KP6B 2JU1A 2VSQA 5KP8B 2EHSA 2K92A 2FVEA 2MR7A 5HV8A 3RG2A 2LMLA 2KGCA 2GDYA 2LKIA 5KP7B 2N50A 2CNRA 2KORA 2KGEA 3GZLA 2N5IA 4H2XC 2KG9A 2N5HA 4DG9A 2K0XA 2L4BA 3EJBA 3NY7B 1VKUA 1HY8A 3LMOA 2ROQA 2MY5A 2AFDA 2CG5B 1DV5A 1F80D 2FHSC 2FAEA 1X3OA 2JQ4A 3GZMA 2LIWA 4NEOA 3CE7A 2FACA 5HVCA 2AF8A 2K2QA 2FADA 2JGPA 2CGQA 2K93A 2MVUA 2KW2A
chains in the Genus database with same CATH superfamily
2PEQA 2EHTA 1VQ7P 1ZMBA 2XV6A 2FVFA 2K0YA 1IMPA 1VQ5P 2KGAA 4HKGA 2GDXA 1IMQA 3CD6P 1M6EX 4QKOA 5F2KA 5F2NA 4MRTC 1KQSO 3CCSP 1HQBA 1AF8A 1K73Q 1UJZA 1YI2P 4CA3A 2KOQA 1ACPA 2VLQA 2PY8A 1VQ8P 1YITP 4H2WC 2N98A 4PH0A 2XZ0D 2KG8A 1Q82Q 1UNKA 2OARA 3DS5A 2VLPA 2N50A 2KGEA 1Q81Q 2M8PA 3B4QA 2N5HA 2ONTA 3NY7B 2CWOA 2AFDA 3U43A 2GZEA 2PEOA 4U0BA 3CCQP 1F80D 2FHSC 2FAEA 2DGYA 2JQ4A 3CCVP 1RO0A 4PH1A 2FACA 3CCEP 5HVCA 2EFJA 5HGNA 2JGPA 2KODA 2CGQA 2K93A 3DS2A 1IUQA 1YIJP 2BUOA 1N8RQ 2Z45A 3G29A 3G1GA 2AFEA 3CMEP 3EJDA 3CPWO 1VQMP 1KLPA 2L9FA 2M8NA 2LTEA 2FVAA 1GPJA 2PENA 2L22A 1K9MQ 2DNWA 3P05A 3H0DA 3CCMP 4U0DA 1DNYA 2P9XA 3DS1A 5I4TG 2KR5A 3RG6C 4BPHA 3LRYA 3G28A 1Q7YQ 2GZJA 2XZ1C 3VRLC 3G1IA 1L0IA 2LPKA 1CEIA 2MD9A 1KD1Q 2L6EA 2K94A 1AYIA 3GKLC 4XFZA 3EJEA 2KGDA 2VLNA 5KP6B 2BHVA 3OW2O 2ERHA 3NTEA 2Z46A 3RG2A 2LMLA 7CEIA 2KGCA 4GR2A 1BAJA 3G4SP 2CNRA 2QA4P 1JJ2O 5HGOA 4WYMA 1RO2A 2JYLA 4DG9A 2L4BA 3DS4A 3H47A 1HY8A 3LMOA 2MY5A 3GJNA 3CC7P 3I56P 3B5IA 1VQ9P 3WBHA 3HZQA 1X3OA 3CCRP 2LIWA 5EW5E 5HGLA 1Z6MA 2GZFA 1E6JP 2OTJP 1QVFO 2AF8A 3MGEA 1M74A 1GXGA 1T8KA 2GZIA 1K8AQ 1OR5A 1GXHA 1M1KQ 1VQKP 1NJIQ 4H2YC 3CXCO 2JBGA 2PEKA 1YHQP 5EJDA 2M5RA 2XT1A 2KOPA 2K5XA 2EG5A 2LOLA 1QVGO 1A43A 2JB0A 2L0QA 1S72P 3CCLP 2E1MA 4XROA 4U0CA 2GDWA 2PNGA 4R0MA 2LIUA 2NO8A 3Q20A 2GYKA 1QRJA 1VQNP 2FQ0A 2JU1A 2VSQA 2EHSA 2K92A 1W2BO 4XFXA 1RNIA 2MR7A 2GDYA 3CMAP 2KORA 1BXIA 3DPHA 2N5IA 4H2XC 5DCKA 1MZ8A 4F37A 2JYGA 2K0XA 1VKUA 3CCJP 2ROQA 3M1MA 5F2OA 1VHNA 1Q86Q 1DV5A 1VQOP 4XRQA 3GZMA 3CE7A 2GZGA 2PEIA 3G6EP 3G21A 4XFYA 4QNBA 2KW2A 1NQ4A 3E2DA 1L0HA 3CC2P 2KWLA 2MF4A 2MVVA 4IPYA 5BS1A 2FQ2A 3DS0A 2JAZA 1A8OA 3H4EA 2JU2A 2LL8A 2X2BA 2LF4A 4IZ6A 3CC4P 2EIAA 1VQPP 3CCUP 2XXMA 2FQ1A 1YJNP 1M6NA 2KG6A 1YJWP 3HYBA 1E0HA 4U0AA 2N6ZA 5CZDB 1FR2A 3G26A 1VQ6P 2WPTA 4BPGA 2K0DX 2N6YA 2AVAA 2MR8A 1ZNVA 2KOOA 4UHPB 2QNWA 1EMVA 1AUMA 1YJ9P 2CQ8A 4PXHB 4BPFA 2KOSA 1EIAA 1KC8Q 4PWVB 1VQLP 5KP8B 2PEMA 2VLOA 2OTLP 5BS2A 2FVEA 4COPA 5HV8A 2LKIA 5KP7B 3G71P 5JPAA 3GZLA 2KG9A 1K30A 3I55P 3EJBA 3DS3A 1EOQA 4U0EA 2CG5B 2M8LA 4GR6A 4NEOA 1VQ4P 4M0IA 1D1DA 2JO0A 5HGMA 2K2QA 2PEJA 2FADA 2Z44A 3G0VA 4U0FA 2MVUA 3DTJA 4COCA 2QEXP 1M90Q
chains in the Genus database with same CATH topology
1NQ4A 1T8KA 2EHTA 1L0HA 2KWLA 2MF4A 1OR5A 2MVVA 2FVFA 2AFEA 2FQ2A 2K0YA 2JU2A 2KGAA 2LL8A 3EJDA 2X2BA 4HKGA 2GDXA 4IZ6A 1KLPA 4H2YC 2L9FA 5EJDA 2FQ1A 2LTEA 2FVAA 2KG6A 2M5RA 2L22A 2KOPA 2N6ZA 5CZDB 2DNWA 2LOLA 4MRTC 1DNYA 2KR5A 4BPGA 2N6YA 2AVAA 2MR8A 2L0QA 1HQBA 4BPHA 2KOOA 2QNWA 1AF8A 2XZ1C 1L0IA 2LPKA 2GDWA 4CA3A 2PNGA 4R0MA 2KOQA 2MD9A 1ACPA 2LIUA 2CQ8A 4H2WC 2K94A 4PXHB 4BPFA 2N98A 2KOSA 4PWVB 2FQ0A 3EJEA 2XZ0D 2KG8A 2KGDA 5KP6B 2JU1A 2VSQA 5KP8B 2EHSA 2K92A 2FVEA 2MR7A 5HV8A 3RG2A 2LMLA 2KGCA 2GDYA 2LKIA 5KP7B 2N50A 2CNRA 2KORA 2KGEA 3GZLA 2N5IA 4H2XC 2KG9A 2N5HA 4DG9A 2K0XA 2L4BA 3EJBA 3NY7B 1VKUA 1HY8A 3LMOA 2ROQA 2MY5A 2AFDA 2CG5B 1DV5A 1F80D 2FHSC 2FAEA 1X3OA 2JQ4A 3GZMA 2LIWA 4NEOA 3CE7A 2FACA 5HVCA 2AF8A 2K2QA 2FADA 2JGPA 2CGQA 2K93A 2MVUA 2KW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NQ4 A;  1T8K A;  2EHT A;  1L0H A;  2KWL A;  2MF4 A;  1OR5 A;  2MVV A;  2FVF A;  2AFE A;  2FQ2 A;  2K0Y A;  2JU2 A;  2KGA A;  2LL8 A;  3EJD A;  2X2B A;  4HKG A;  2GDX A;  4IZ6 A;  1KLP A;  4H2Y C;  2L9F A;  5EJD A;  2FQ1 A;  2LTE A;  2FVA A;  2KG6 A;  2M5R A;  2L22 A;  2KOP A;  2N6Z A;  5CZD B;  2DNW A;  2LOL A;  4MRT C;  1DNY A;  2KR5 A;  4BPG A;  2N6Y A;  2AVA A;  2MR8 A;  2L0Q A;  1HQB A;  4BPH A;  2KOO A;  2QNW A;  1AF8 A;  2XZ1 C;  1L0I A;  2LPK A;  2GDW A;  4CA3 A;  2PNG A;  4R0M A;  2KOQ A;  2MD9 A;  1ACP A;  2LIU A;  2CQ8 A;  4H2W C;  2K94 A;  4PXH B;  4BPF A;  2N98 A;  2KOS A;  4PWV B;  2FQ0 A;  3EJE A;  2XZ0 D;  2KG8 A;  2KGD A;  5KP6 B;  2JU1 A;  2VSQ A;  5KP8 B;  2EHS A;  2K92 A;  2FVE A;  2MR7 A;  5HV8 A;  3RG2 A;  2LML A;  2KGC A;  2GDY A;  2LKI A;  5KP7 B;  2N50 A;  2CNR A;  2KOR A;  2KGE A;  3GZL A;  2N5I A;  4H2X C;  2KG9 A;  2N5H A;  4DG9 A;  2K0X A;  2L4B A;  3EJB A;  3NY7 B;  1VKU A;  1HY8 A;  3LMO A;  2ROQ A;  2MY5 A;  2AFD A;  2CG5 B;  1DV5 A;  1F80 D;  2FHS C;  2FAE A;  1X3O A;  2JQ4 A;  3GZM A;  2LIW A;  4NEO A;  3CE7 A;  2FAC A;  5HVC A;  2AF8 A;  2K2Q A;  2FAD A;  2JGP A;  2CGQ A;  2K93 A;  2MVU A;  2KW2 A; 
#chains in the Genus database with same CATH topology
 2PEQ A;  2EHT A;  1VQ7 P;  1ZMB A;  2XV6 A;  2FVF A;  2K0Y A;  1IMP A;  1VQ5 P;  2KGA A;  4HKG A;  2GDX A;  1IMQ A;  3CD6 P;  1M6E X;  4QKO A;  5F2K A;  5F2N A;  4MRT C;  1KQS O;  3CCS P;  1HQB A;  1AF8 A;  1K73 Q;  1UJZ A;  1YI2 P;  4CA3 A;  2KOQ A;  1ACP A;  2VLQ A;  2PY8 A;  1VQ8 P;  1YIT P;  4H2W C;  2N98 A;  4PH0 A;  2XZ0 D;  2KG8 A;  1Q82 Q;  1UNK A;  2OAR A;  3DS5 A;  2VLP A;  2N50 A;  2KGE A;  1Q81 Q;  2M8P A;  3B4Q A;  2N5H A;  2ONT A;  3NY7 B;  2CWO A;  2AFD A;  3U43 A;  2GZE A;  2PEO A;  4U0B A;  3CCQ P;  1F80 D;  2FHS C;  2FAE A;  2DGY A;  2JQ4 A;  3CCV P;  1RO0 A;  4PH1 A;  2FAC A;  3CCE P;  5HVC A;  2EFJ A;  5HGN A;  2JGP A;  2KOD A;  2CGQ A;  2K93 A;  3DS2 A;  1IUQ A;  1YIJ P;  2BUO A;  1N8R Q;  2Z45 A;  3G29 A;  3G1G A;  2AFE A;  3CME P;  3EJD A;  3CPW O;  1VQM P;  1KLP A;  2L9F A;  2M8N A;  2LTE A;  2FVA A;  1GPJ A;  2PEN A;  2L22 A;  1K9M Q;  2DNW A;  3P05 A;  3H0D A;  3CCM P;  4U0D A;  1DNY A;  2P9X A;  3DS1 A;  5I4T G;  2KR5 A;  3RG6 C;  4BPH A;  3LRY A;  3G28 A;  1Q7Y Q;  2GZJ A;  2XZ1 C;  3VRL C;  3G1I A;  1L0I A;  2LPK A;  1CEI A;  2MD9 A;  1KD1 Q;  2L6E A;  2K94 A;  1AYI A;  3GKL C;  4XFZ A;  3EJE A;  2KGD A;  2VLN A;  5KP6 B;  2BHV A;  3OW2 O;  2ERH A;  3NTE A;  2Z46 A;  3RG2 A;  2LML A;  7CEI A;  2KGC A;  4GR2 A;  1BAJ A;  3G4S P;  2CNR A;  2QA4 P;  1JJ2 O;  5HGO A;  4WYM A;  1RO2 A;  2JYL A;  4DG9 A;  2L4B A;  3DS4 A;  3H47 A;  1HY8 A;  3LMO A;  2MY5 A;  3GJN A;  3CC7 P;  3I56 P;  3B5I A;  1VQ9 P;  3WBH A;  3HZQ A;  1X3O A;  3CCR P;  2LIW A;  5EW5 E;  5HGL A;  1Z6M A;  2GZF A;  1E6J P;  2OTJ P;  1QVF O;  2AF8 A;  3MGE A;  1M74 A;  1GXG A;  1T8K A;  2GZI A;  1K8A Q;  1OR5 A;  1GXH A;  1M1K Q;  1VQK P;  1NJI Q;  4H2Y C;  3CXC O;  2JBG A;  2PEK A;  1YHQ P;  5EJD A;  2M5R A;  2XT1 A;  2KOP A;  2K5X A;  2EG5 A;  2LOL A;  1QVG O;  1A43 A;  2JB0 A;  2L0Q A;  1S72 P;  3CCL P;  2E1M A;  4XRO A;  4U0C A;  2GDW A;  2PNG A;  4R0M A;  2LIU A;  2NO8 A;  3Q20 A;  2GYK A;  1QRJ A;  1VQN P;  2FQ0 A;  2JU1 A;  2VSQ A;  2EHS A;  2K92 A;  1W2B O;  4XFX A;  1RNI A;  2MR7 A;  2GDY A;  3CMA P;  2KOR A;  1BXI A;  3DPH A;  2N5I A;  4H2X C;  5DCK A;  1MZ8 A;  4F37 A;  2JYG A;  2K0X A;  1VKU A;  3CCJ P;  2ROQ A;  3M1M A;  5F2O A;  1VHN A;  1Q86 Q;  1DV5 A;  1VQO P;  4XRQ A;  3GZM A;  3CE7 A;  2GZG A;  2PEI A;  3G6E P;  3G21 A;  4XFY A;  4QNB A;  2KW2 A;  1NQ4 A;  3E2D A;  1L0H A;  3CC2 P;  2KWL A;  2MF4 A;  2MVV A;  4IPY A;  5BS1 A;  2FQ2 A;  3DS0 A;  2JAZ A;  1A8O A;  3H4E A;  2JU2 A;  2LL8 A;  2X2B A;  2LF4 A;  4IZ6 A;  3CC4 P;  2EIA A;  1VQP P;  3CCU P;  2XXM A;  2FQ1 A;  1YJN P;  1M6N A;  2KG6 A;  1YJW P;  3HYB A;  1E0H A;  4U0A A;  2N6Z A;  5CZD B;  1FR2 A;  3G26 A;  1VQ6 P;  2WPT A;  4BPG A;  2K0D X;  2N6Y A;  2AVA A;  2MR8 A;  1ZNV A;  2KOO A;  4UHP B;  2QNW A;  1EMV A;  1AUM A;  1YJ9 P;  2CQ8 A;  4PXH B;  4BPF A;  2KOS A;  1EIA A;  1KC8 Q;  4PWV B;  1VQL P;  5KP8 B;  2PEM A;  2VLO A;  2OTL P;  5BS2 A;  2FVE A;  4COP A;  5HV8 A;  2LKI A;  5KP7 B;  3G71 P;  5JPA A;  3GZL A;  2KG9 A;  1K30 A;  3I55 P;  3EJB A;  3DS3 A;  1EOQ A;  4U0E A;  2CG5 B;  2M8L A;  4GR6 A;  4NEO A;  1VQ4 P;  4M0I A;  1D1D A;  2JO0 A;  5HGM A;  2K2Q A;  2PEJ A;  2FAD A;  2Z44 A;  3G0V A;  4U0F A;  2MVU A;  3DTJ A;  4COC A;  2QEX P;  1M90 Q; 
#chains in the Genus database with same CATH homology
 1NQ4 A;  1T8K A;  2EHT A;  1L0H A;  2KWL A;  2MF4 A;  1OR5 A;  2MVV A;  2FVF A;  2AFE A;  2FQ2 A;  2K0Y A;  2JU2 A;  2KGA A;  2LL8 A;  3EJD A;  2X2B A;  4HKG A;  2GDX A;  4IZ6 A;  1KLP A;  4H2Y C;  2L9F A;  5EJD A;  2FQ1 A;  2LTE A;  2FVA A;  2KG6 A;  2M5R A;  2L22 A;  2KOP A;  2N6Z A;  5CZD B;  2DNW A;  2LOL A;  4MRT C;  1DNY A;  2KR5 A;  4BPG A;  2N6Y A;  2AVA A;  2MR8 A;  2L0Q A;  1HQB A;  4BPH A;  2KOO A;  2QNW A;  1AF8 A;  2XZ1 C;  1L0I A;  2LPK A;  2GDW A;  4CA3 A;  2PNG A;  4R0M A;  2KOQ A;  2MD9 A;  1ACP A;  2LIU A;  2CQ8 A;  4H2W C;  2K94 A;  4PXH B;  4BPF A;  2N98 A;  2KOS A;  4PWV B;  2FQ0 A;  3EJE A;  2XZ0 D;  2KG8 A;  2KGD A;  5KP6 B;  2JU1 A;  2VSQ A;  5KP8 B;  2EHS A;  2K92 A;  2FVE A;  2MR7 A;  5HV8 A;  3RG2 A;  2LML A;  2KGC A;  2GDY A;  2LKI A;  5KP7 B;  2N50 A;  2CNR A;  2KOR A;  2KGE A;  3GZL A;  2N5I A;  4H2X C;  2KG9 A;  2N5H A;  4DG9 A;  2K0X A;  2L4B A;  3EJB A;  3NY7 B;  1VKU A;  1HY8 A;  3LMO A;  2ROQ A;  2MY5 A;  2AFD A;  2CG5 B;  1DV5 A;  1F80 D;  2FHS C;  2FAE A;  1X3O A;  2JQ4 A;  3GZM A;  2LIW A;  4NEO A;  3CE7 A;  2FAC A;  5HVC A;  2AF8 A;  2K2Q A;  2FAD A;  2JGP A;  2CGQ A;  2K93 A;  2MVU A;  2KW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...