2LIUA

Nmr structure of holo-acpi domain from cura module from lyngbya majuscula
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase
molecule keywords CurA
total genus 23
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2liuA01
2N5HA 2LL8A 2JQ4A 1NQ4A 2L0QA 4H2XC 1T8KA 1F80D 4HKGA 2AVAA 3EJDA 2KOSA 2KG9A 2N5IA 3EJBA 2K92A 2MY5A 5KP7B 2EHTA 4R0MA 4H2WC 3EJEA 2EHSA 2MR8A 4PWVB 5KP6B 2KWLA 3RG2A 2KGDA 2KG6A 1KLPA 5CZDB 2MD9A 1HQBA 2L4BA 4IZ6A 2FVEA 2LIWA 2KR5A 1L0HA 2GDWA 5KP8B 1L0IA 2N98A 2PNGA 5HV8A 2FAEA 2KOOA 2KORA 2L22A 2QNWA 2FADA 3CE7A 4BPGA 2M5RA 2XZ1C 2K0YA 2DNWA 2L9FA 2KG8A 2CGQA 2GDXA 3GZMA 2LTEA 2X2BA 2K94A 2FHSC 2KOQA 2N50A 2KW2A 2LIUA 2FQ2A 2CNRA 2GDYA 2KGEA 4BPHA 2AFDA 2VSQA 4NEOA 2JU1A 2MVUA 1OR5A 1ACPA 3GZLA 1X3OA 4PXHB 4DG9A 2CG5B 2FVFA 2JU2A 3NY7B 4CA3A 2KGCA 1DNYA 2MR7A 2AFEA 1HY8A 4BPFA 4H2YC 2K2QA 5EJDA 2AF8A 2N6ZA 2LPKA 4MRTC 2FQ0A 2JGPA 2MF4A 2ROQA 2FQ1A 2MVVA 2N6YA 2K93A 2FACA 2KOPA 1AF8A 1DV5A 3LMOA 2LOLA 2XZ0D 2FVAA 2KGAA 5HVCA 2LMLA 2K0XA 1VKUA 2LKIA 2CQ8A
chains in the Genus database with same CATH superfamily
2M8PA 5DCKA 2JQ4A 1VQMP 2JYLA 3G21A 3DPHA 1BXIA 4HKGA 1VQKP 2AVAA 2KOSA 2N5IA 3EJBA 3DS0A 5KP7B 2BUOA 3B5IA 4R0MA 2PEOA 2GZEA 3EJEA 5KP6B 3NTEA 2M8LA 2KGDA 5CZDB 3CCRP 3U43A 2L4BA 2FVEA 2XT1A 5F2NA 4F37A 1L0HA 4XFXA 1L0IA 1GPJA 2WPTA 4U0DA 2QNWA 3DS4A 3Q20A 1E0HA 2FADA 3MGEA 3DS2A 3GJNA 3CCMP 1YITP 5HGNA 2CGQA 3GZMA 2GZJA 2OTLP 1K30A 1BAJA 1N8RQ 2KW2A 1W2BO 3GKLC 1UNKA 3CCVP 2VLOA 4UHPB 1RO2A 1VQ7P 2VSQA 1QVGO 3HYBA 5JPAA 2JU1A 1OR5A 2JB0A 1ACPA 4PXHB 4DG9A 1IMPA 1FR2A 5F2KA 2MR7A 4QKOA 4XROA 2K2QA 2FQ0A 2JGPA 2FQ1A 3P05A 3G4SP 1VQOP 1VQ4P 3LMOA 2FVAA 2K0XA 3M1MA 3G71P 1KQSO 3CCJP 2EG5A 2CWOA 5HGOA 2EIAA 3VRLC 1NQ4A 1A8OA 4XFZA 4IPYA 2GZIA 4COCA 2XV6A 4H2WC 1Q81Q 4PWVB 1Q86Q 1D1DA 4IZ6A 2PEMA 2JBGA 1VQ6P 4COPA 3CCUP 1S72P 2GDWA 5KP8B 1Q7YQ 2PNGA 5HV8A 2KOOA 2KORA 2VLPA 3H47A 1VQPP 4BPGA 2M5RA 4PH0A 1ZNVA 2GZGA 2PEKA 2K94A 5HGLA 4M0IA 2CNRA 2GDYA 2KGEA 1YIJP 4GR2A 2NO8A 1YJWP 3G28A 1YHQP 2Z46A 1DNYA 5HGMA 2N6ZA 2LPKA 4MRTC 1M6EX 3B4QA 2KODA 2VLNA 2EFJA 1VQLP 1MZ8A 4QNBA 1KC8Q 2VLQA 1VKUA 5BS2A 3CXCO 3CD6P 2LL8A 1AYIA 3H0DA 1GXHA 2PEJA 1RO0A 4U0BA 2MY5A 1VQ9P 1EIAA 1ZMBA 2EHSA 3CCSP 4XFYA 4XRQA 1Q82Q 1HQBA 1M6NA 2LIWA 2KR5A 4PH1A 2XXMA 5BS1A 2L22A 3I56P 2GZFA 2K0YA 1VQNP 2L9FA 2KG8A 2M8NA 2LTEA 2X2BA 2FHSC 2KOQA 3HZQA 2N50A 1QRJA 3LRYA 2E1MA 2FQ2A 2Z45A 4BPHA 3CCLP 2AFDA 1AUMA 5I4TG 2MVUA 2ERHA 2GYKA 2L6EA 3GZLA 2CG5B 3G1IA 1K8AQ 2FVFA 2JU2A 2KGCA 4GR6A 2JYGA 1RNIA 1A43A 2AFEA 3CCQP 4H2YC 5EJDA 2AF8A 2LF4A 1M1KQ 2MVVA 2PEQA 3WBHA 4WYMA 1JJ2O 3CC2P 4U0FA 1EMVA 2K0DX 2XZ0D 3CCEP 2QA4P 3CC7P 2LKIA 1K73Q 2CQ8A 3E2DA 2N5HA 3I55P 7CEIA 2L0QA 4H2XC 1M74A 1T8KA 3CC4P 1IUQA 1QVFO 1F80D 3G29A 3EJDA 2KG9A 2K92A 1NJIQ 1VQ8P 2EHTA 2MR8A 2KWLA 3G0VA 3RG2A 2KG6A 3DS1A 2JAZA 5EW5E 1KLPA 2MD9A 1M90Q 2BHVA 1VHNA 1CEIA 1Z6MA 2ONTA 2N98A 2FAEA 2PEIA 3CE7A 2XZ1C 4U0CA 4U0EA 1K9MQ 2DNWA 3H4EA 2GDXA 5F2OA 4U0AA 1KD1Q 1UJZA 2LIUA 3DTJA 2DGYA 1YI2P 4NEOA 2QEXP 3CMAP 1X3OA 3G26A 3NY7B 4CA3A 1YJ9P 2OTJP 1HY8A 3RG6C 4BPFA 2PY8A 3CMEP 3DS3A 1GXGA 1EOQA 2MF4A 3DS5A 1VQ5P 2ROQA 2P9XA 2PENA 1E6JP 1YJNP 2N6YA 2K93A 2FACA 3G1GA 2KOPA 1AF8A 2JO0A 3OW2O 1DV5A 2LOLA 2K5XA 2KGAA 2Z44A 5HVCA 3G6EP 2LMLA 2OARA 1IMQA 3CPWO
chains in the Genus database with same CATH topology
2N5HA 2LL8A 2JQ4A 1NQ4A 2L0QA 4H2XC 1T8KA 1F80D 4HKGA 2AVAA 3EJDA 2KOSA 2KG9A 2N5IA 3EJBA 2K92A 2MY5A 5KP7B 2EHTA 4R0MA 4H2WC 3EJEA 2EHSA 2MR8A 4PWVB 5KP6B 2KWLA 3RG2A 2KGDA 2KG6A 1KLPA 5CZDB 2MD9A 1HQBA 2L4BA 4IZ6A 2FVEA 2LIWA 2KR5A 1L0HA 2GDWA 5KP8B 1L0IA 2N98A 2PNGA 5HV8A 2FAEA 2KOOA 2KORA 2L22A 2QNWA 2FADA 3CE7A 4BPGA 2M5RA 2XZ1C 2K0YA 2DNWA 2L9FA 2KG8A 2CGQA 2GDXA 3GZMA 2LTEA 2X2BA 2K94A 2FHSC 2KOQA 2N50A 2KW2A 2LIUA 2FQ2A 2CNRA 2GDYA 2KGEA 4BPHA 2AFDA 2VSQA 4NEOA 2JU1A 2MVUA 1OR5A 1ACPA 3GZLA 1X3OA 4PXHB 4DG9A 2CG5B 2FVFA 2JU2A 3NY7B 4CA3A 2KGCA 1DNYA 2MR7A 2AFEA 1HY8A 4BPFA 4H2YC 2K2QA 5EJDA 2AF8A 2N6ZA 2LPKA 4MRTC 2FQ0A 2JGPA 2MF4A 2ROQA 2FQ1A 2MVVA 2N6YA 2K93A 2FACA 2KOPA 1AF8A 1DV5A 3LMOA 2LOLA 2XZ0D 2FVAA 2KGAA 5HVCA 2LMLA 2K0XA 1VKUA 2LKIA 2CQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N5H A;  2LL8 A;  2JQ4 A;  1NQ4 A;  2L0Q A;  4H2X C;  1T8K A;  1F80 D;  4HKG A;  2AVA A;  3EJD A;  2KOS A;  2KG9 A;  2N5I A;  3EJB A;  2K92 A;  2MY5 A;  5KP7 B;  2EHT A;  4R0M A;  4H2W C;  3EJE A;  2EHS A;  2MR8 A;  4PWV B;  5KP6 B;  2KWL A;  3RG2 A;  2KGD A;  2KG6 A;  1KLP A;  5CZD B;  2MD9 A;  1HQB A;  2L4B A;  4IZ6 A;  2FVE A;  2LIW A;  2KR5 A;  1L0H A;  2GDW A;  5KP8 B;  1L0I A;  2N98 A;  2PNG A;  5HV8 A;  2FAE A;  2KOO A;  2KOR A;  2L22 A;  2QNW A;  2FAD A;  3CE7 A;  4BPG A;  2M5R A;  2XZ1 C;  2K0Y A;  2DNW A;  2L9F A;  2KG8 A;  2CGQ A;  2GDX A;  3GZM A;  2LTE A;  2X2B A;  2K94 A;  2FHS C;  2KOQ A;  2N50 A;  2KW2 A;  2LIU A;  2FQ2 A;  2CNR A;  2GDY A;  2KGE A;  4BPH A;  2AFD A;  2VSQ A;  4NEO A;  2JU1 A;  2MVU A;  1OR5 A;  1ACP A;  3GZL A;  1X3O A;  4PXH B;  4DG9 A;  2CG5 B;  2FVF A;  2JU2 A;  3NY7 B;  4CA3 A;  2KGC A;  1DNY A;  2MR7 A;  2AFE A;  1HY8 A;  4BPF A;  4H2Y C;  2K2Q A;  5EJD A;  2AF8 A;  2N6Z A;  2LPK A;  4MRT C;  2FQ0 A;  2JGP A;  2MF4 A;  2ROQ A;  2FQ1 A;  2MVV A;  2N6Y A;  2K93 A;  2FAC A;  2KOP A;  1AF8 A;  1DV5 A;  3LMO A;  2LOL A;  2XZ0 D;  2FVA A;  2KGA A;  5HVC A;  2LML A;  2K0X A;  1VKU A;  2LKI A;  2CQ8 A; 
#chains in the Genus database with same CATH topology
 2M8P A;  5DCK A;  2JQ4 A;  1VQM P;  2JYL A;  3G21 A;  3DPH A;  1BXI A;  4HKG A;  1VQK P;  2AVA A;  2KOS A;  2N5I A;  3EJB A;  3DS0 A;  5KP7 B;  2BUO A;  3B5I A;  4R0M A;  2PEO A;  2GZE A;  3EJE A;  5KP6 B;  3NTE A;  2M8L A;  2KGD A;  5CZD B;  3CCR P;  3U43 A;  2L4B A;  2FVE A;  2XT1 A;  5F2N A;  4F37 A;  1L0H A;  4XFX A;  1L0I A;  1GPJ A;  2WPT A;  4U0D A;  2QNW A;  3DS4 A;  3Q20 A;  1E0H A;  2FAD A;  3MGE A;  3DS2 A;  3GJN A;  3CCM P;  1YIT P;  5HGN A;  2CGQ A;  3GZM A;  2GZJ A;  2OTL P;  1K30 A;  1BAJ A;  1N8R Q;  2KW2 A;  1W2B O;  3GKL C;  1UNK A;  3CCV P;  2VLO A;  4UHP B;  1RO2 A;  1VQ7 P;  2VSQ A;  1QVG O;  3HYB A;  5JPA A;  2JU1 A;  1OR5 A;  2JB0 A;  1ACP A;  4PXH B;  4DG9 A;  1IMP A;  1FR2 A;  5F2K A;  2MR7 A;  4QKO A;  4XRO A;  2K2Q A;  2FQ0 A;  2JGP A;  2FQ1 A;  3P05 A;  3G4S P;  1VQO P;  1VQ4 P;  3LMO A;  2FVA A;  2K0X A;  3M1M A;  3G71 P;  1KQS O;  3CCJ P;  2EG5 A;  2CWO A;  5HGO A;  2EIA A;  3VRL C;  1NQ4 A;  1A8O A;  4XFZ A;  4IPY A;  2GZI A;  4COC A;  2XV6 A;  4H2W C;  1Q81 Q;  4PWV B;  1Q86 Q;  1D1D A;  4IZ6 A;  2PEM A;  2JBG A;  1VQ6 P;  4COP A;  3CCU P;  1S72 P;  2GDW A;  5KP8 B;  1Q7Y Q;  2PNG A;  5HV8 A;  2KOO A;  2KOR A;  2VLP A;  3H47 A;  1VQP P;  4BPG A;  2M5R A;  4PH0 A;  1ZNV A;  2GZG A;  2PEK A;  2K94 A;  5HGL A;  4M0I A;  2CNR A;  2GDY A;  2KGE A;  1YIJ P;  4GR2 A;  2NO8 A;  1YJW P;  3G28 A;  1YHQ P;  2Z46 A;  1DNY A;  5HGM A;  2N6Z A;  2LPK A;  4MRT C;  1M6E X;  3B4Q A;  2KOD A;  2VLN A;  2EFJ A;  1VQL P;  1MZ8 A;  4QNB A;  1KC8 Q;  2VLQ A;  1VKU A;  5BS2 A;  3CXC O;  3CD6 P;  2LL8 A;  1AYI A;  3H0D A;  1GXH A;  2PEJ A;  1RO0 A;  4U0B A;  2MY5 A;  1VQ9 P;  1EIA A;  1ZMB A;  2EHS A;  3CCS P;  4XFY A;  4XRQ A;  1Q82 Q;  1HQB A;  1M6N A;  2LIW A;  2KR5 A;  4PH1 A;  2XXM A;  5BS1 A;  2L22 A;  3I56 P;  2GZF A;  2K0Y A;  1VQN P;  2L9F A;  2KG8 A;  2M8N A;  2LTE A;  2X2B A;  2FHS C;  2KOQ A;  3HZQ A;  2N50 A;  1QRJ A;  3LRY A;  2E1M A;  2FQ2 A;  2Z45 A;  4BPH A;  3CCL P;  2AFD A;  1AUM A;  5I4T G;  2MVU A;  2ERH A;  2GYK A;  2L6E A;  3GZL A;  2CG5 B;  3G1I A;  1K8A Q;  2FVF A;  2JU2 A;  2KGC A;  4GR6 A;  2JYG A;  1RNI A;  1A43 A;  2AFE A;  3CCQ P;  4H2Y C;  5EJD A;  2AF8 A;  2LF4 A;  1M1K Q;  2MVV A;  2PEQ A;  3WBH A;  4WYM A;  1JJ2 O;  3CC2 P;  4U0F A;  1EMV A;  2K0D X;  2XZ0 D;  3CCE P;  2QA4 P;  3CC7 P;  2LKI A;  1K73 Q;  2CQ8 A;  3E2D A;  2N5H A;  3I55 P;  7CEI A;  2L0Q A;  4H2X C;  1M74 A;  1T8K A;  3CC4 P;  1IUQ A;  1QVF O;  1F80 D;  3G29 A;  3EJD A;  2KG9 A;  2K92 A;  1NJI Q;  1VQ8 P;  2EHT A;  2MR8 A;  2KWL A;  3G0V A;  3RG2 A;  2KG6 A;  3DS1 A;  2JAZ A;  5EW5 E;  1KLP A;  2MD9 A;  1M90 Q;  2BHV A;  1VHN A;  1CEI A;  1Z6M A;  2ONT A;  2N98 A;  2FAE A;  2PEI A;  3CE7 A;  2XZ1 C;  4U0C A;  4U0E A;  1K9M Q;  2DNW A;  3H4E A;  2GDX A;  5F2O A;  4U0A A;  1KD1 Q;  1UJZ A;  2LIU A;  3DTJ A;  2DGY A;  1YI2 P;  4NEO A;  2QEX P;  3CMA P;  1X3O A;  3G26 A;  3NY7 B;  4CA3 A;  1YJ9 P;  2OTJ P;  1HY8 A;  3RG6 C;  4BPF A;  2PY8 A;  3CME P;  3DS3 A;  1GXG A;  1EOQ A;  2MF4 A;  3DS5 A;  1VQ5 P;  2ROQ A;  2P9X A;  2PEN A;  1E6J P;  1YJN P;  2N6Y A;  2K93 A;  2FAC A;  3G1G A;  2KOP A;  1AF8 A;  2JO0 A;  3OW2 O;  1DV5 A;  2LOL A;  2K5X A;  2KGA A;  2Z44 A;  5HVC A;  3G6E P;  2LML A;  2OAR A;  1IMQ A;  3CPW O; 
#chains in the Genus database with same CATH homology
 2N5H A;  2LL8 A;  2JQ4 A;  1NQ4 A;  2L0Q A;  4H2X C;  1T8K A;  1F80 D;  4HKG A;  2AVA A;  3EJD A;  2KOS A;  2KG9 A;  2N5I A;  3EJB A;  2K92 A;  2MY5 A;  5KP7 B;  2EHT A;  4R0M A;  4H2W C;  3EJE A;  2EHS A;  2MR8 A;  4PWV B;  5KP6 B;  2KWL A;  3RG2 A;  2KGD A;  2KG6 A;  1KLP A;  5CZD B;  2MD9 A;  1HQB A;  2L4B A;  4IZ6 A;  2FVE A;  2LIW A;  2KR5 A;  1L0H A;  2GDW A;  5KP8 B;  1L0I A;  2N98 A;  2PNG A;  5HV8 A;  2FAE A;  2KOO A;  2KOR A;  2L22 A;  2QNW A;  2FAD A;  3CE7 A;  4BPG A;  2M5R A;  2XZ1 C;  2K0Y A;  2DNW A;  2L9F A;  2KG8 A;  2CGQ A;  2GDX A;  3GZM A;  2LTE A;  2X2B A;  2K94 A;  2FHS C;  2KOQ A;  2N50 A;  2KW2 A;  2LIU A;  2FQ2 A;  2CNR A;  2GDY A;  2KGE A;  4BPH A;  2AFD A;  2VSQ A;  4NEO A;  2JU1 A;  2MVU A;  1OR5 A;  1ACP A;  3GZL A;  1X3O A;  4PXH B;  4DG9 A;  2CG5 B;  2FVF A;  2JU2 A;  3NY7 B;  4CA3 A;  2KGC A;  1DNY A;  2MR7 A;  2AFE A;  1HY8 A;  4BPF A;  4H2Y C;  2K2Q A;  5EJD A;  2AF8 A;  2N6Z A;  2LPK A;  4MRT C;  2FQ0 A;  2JGP A;  2MF4 A;  2ROQ A;  2FQ1 A;  2MVV A;  2N6Y A;  2K93 A;  2FAC A;  2KOP A;  1AF8 A;  1DV5 A;  3LMO A;  2LOL A;  2XZ0 D;  2FVA A;  2KGA A;  5HVC A;  2LML A;  2K0X A;  1VKU A;  2LKI A;  2CQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...