2LIUA

Nmr structure of holo-acpi domain from cura module from lyngbya majuscula
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
SGLVPRGSHMTPQVNQVNLSEIKQVLKQQLAEALYTEESEIAEDQKFVDLGLDSIVGVEWTTTINQTYNLNLKATKLYDYPTLLELSGYIAQILSSQGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CurA
publication title Characterization of Molecular Interactions between ACP and Halogenase Domains in the Curacin A Polyketide Synthase.
pubmed doi rcsb
source organism Lyngbya majuscula
molecule tags Transferase
total genus 23
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2liuA01
2KORA 2AFDA 1KLPA 2JGPA 4H2YC 2MR7A 2QNWA 2LTEA 2CG5B 2FQ2A 2MD9A 3LMOA 1DNYA 2FAEA 3CE7A 3RG2A 5EJDA 2K92A 5KP7B 2PNGA 2GDWA 5HV8A 1ACPA 1NQ4A 2KGDA 4PWVB 2JQ4A 2CNRA 2ROQA 2KG8A 2K2QA 4H2XC 2KGAA 1F80D 2EHSA 3NY7B 2N6ZA 1HQBA 1OR5A 4HKGA 4IZ6A 1T8KA 2FACA 2AF8A 2L0QA 2L22A 2LKIA 2FVAA 1HY8A 2FVFA 3GZMA 2X2BA 3EJBA 2K94A 2JU1A 4H2WC 2LIWA 2MVUA 2N5IA 5HVCA 2AVAA 2N5HA 3EJEA 2K0XA 4R0MA 2MY5A 2FVEA 1DV5A 2MF4A 2L9FA 2FQ1A 2N98A 2KOSA 2KOQA 2CQ8A 2FADA 4MRTC 1X3OA 2DNWA 2KR5A 2LIUA 2KG6A 2FQ0A 2LPKA 1AF8A 2AFEA 2K93A 2KGCA 2CGQA 2KW2A 4CA3A 4BPGA 2LMLA 2L4BA 2N6YA 2KWLA 5CZDB 2GDYA 5KP6B 2KOPA 2JU2A 2LL8A 2MR8A 2MVVA 4NEOA 2KOOA 2KG9A 2XZ0D 3GZLA 2FHSC 2GDXA 2VSQA 1L0IA 2N50A 1L0HA 2LOLA 2KGEA 5KP8B 2XZ1C 3EJDA 4BPFA 2M5RA 4PXHB 2K0YA 4DG9A 1VKUA 2EHTA 4BPHA
chains in the Genus database with same CATH superfamily
1VQ6P 5HGOA 2MR7A 2LTEA 2PEKA 1M1KQ 2CG5B 2E1MA 2FQ2A 1RNIA 1D1DA 2PNGA 3G1GA 2GDWA 1ACPA 2K0DX 1KC8Q 4XFZA 5BS2A 1ZNVA 3G4SP 2EFJA 1HQBA 1OR5A 4HKGA 3G71P 2LKIA 2FVAA 2DGYA 2FVFA 3GZMA 2X2BA 3I56P 1KD1Q 3U43A 5HGLA 3NTEA 4H2WC 2LIWA 2MVUA 2N5IA 4R0MA 5F2OA 2OTJP 2CQ8A 2JB0A 2JAZA 4PH1A 4MRTC 4U0BA 1VQMP 2KR5A 1IMPA 1AF8A 1YJNP 1E0HA 2AFEA 1UNKA 1CEIA 4U0AA 2KGCA 1ZMBA 2BHVA 2WPTA 2KWLA 5CZDB 4COPA 3VRLC 1A43A 4NEOA 1FR2A 3CCEP 2KOOA 2Z44A 2GDXA 3CCSP 1L0IA 1L0HA 4PH0A 2KODA 4BPHA 2KORA 2AFDA 1EIAA 1AUMA 4IPYA 2QNWA 3H0DA 4XROA 3DTJA 3G29A 3CC2P 2FAEA 5EJDA 1VQ9P 3CCJP 3CCVP 1S72P 3DS4A 1VQ7P 2VLOA 4U0CA 5DCKA 1VQNP 2KG8A 2GZIA 3NY7B 1QVFO 2N6ZA 1UJZA 2ERHA 5F2KA 4IZ6A 2M8PA 2QA4P 2FACA 2AF8A 2L0QA 1VQLP 3CD6P 3G21A 3EJBA 2ONTA 1VQ4P 1Q86Q 3DS3A 3Q20A 2PEOA 2JU1A 2PEQA 3CXCO 1A8OA 1M6NA 3EJEA 1VQ8P 3DS5A 1K9MQ 2MY5A 2FVEA 2L9FA 2N98A 2PEJA 1YJ9P 1Q81Q 4XFXA 4M0IA 2PEMA 2JYLA 2FADA 1X3OA 1Z6MA 2DNWA 2LIUA 1N8RQ 2LPKA 2K93A 2KW2A 4CA3A 4BPGA 2LMLA 2GZGA 2L4BA 2N6YA 2KOPA 1K30A 2JU2A 4XFYA 2MR8A 1W2BO 2MVVA 1VQ5P 1NJIQ 3DS0A 2VSQA 5HGMA 3CCMP 1GXHA 3H47A 3EJDA 4BPFA 2M5RA 1BAJA 2JYGA 1VKUA 2OARA 3CCLP 1QRJA 1KLPA 4GR2A 2JGPA 5EW5E 2EG5A 2JO0A 3G26A 2MD9A 4F37A 2K92A 5KP7B 4U0FA 1YIJP 1IUQA 5HV8A 1AYIA 5I4TG 4PWVB 2JQ4A 4H2XC 2KGAA 1F80D 2EHSA 3B4QA 1KQSO 5BS1A 7CEIA 2L22A 3GKLC 1HY8A 2VLPA 1K73Q 3CC4P 3CCRP 2K94A 2L6EA 3DPHA 5HVCA 1MZ8A 2AVAA 2N5HA 3MGEA 4COCA 3OW2O 1DV5A 1K8AQ 3CMAP 2KOSA 2PEIA 2KOQA 5JPAA 3CMEP 2EIAA 3G6EP 1GPJA 2XV6A 2FQ0A 2XXMA 1VQOP 3HZQA 2CGQA 3G28A 5KP6B 2OTLP 2LL8A 2GZFA 4QNBA 2KG9A 2LOLA 2KGEA 2LF4A 5KP8B 2GZJA 3CPWO 3P05A 4DG9A 1YJWP 1M90Q 2BUOA 2PY8A 2EHTA 2K5XA 4H2YC 1VQKP 4U0EA 2VLNA 3LMOA 1DNYA 3LRYA 3CE7A 3I55P 3RG2A 1M6EX 3B5IA 3CCQP 3DS1A 1QVGO 5F2NA 1JJ2O 1NQ4A 1YITP 1GXGA 2KGDA 2Z46A 1YI2P 2ROQA 2CNRA 2K2QA 2Z45A 3G0VA 1RO0A 1T8KA 1RO2A 2XT1A 3CC7P 1IMQA 3WBHA 2QEXP 3HYBA 1Q7YQ 2P9XA 5HGNA 2JBGA 4XRQA 4GR6A 3M1MA 4U0DA 1YHQP 2K0XA 1Q82Q 2MF4A 1EOQA 2FQ1A 3GJNA 3DS2A 2M8NA 1VQPP 2CWOA 3H4EA 1M74A 2KG6A 4QKOA 1EMVA 2M8LA 2GYKA 2NO8A 2GDYA 4UHPB 1E6JP 1BXIA 2PENA 3RG6C 1VHNA 3G1IA 3GZLA 2XZ0D 2FHSC 2VLQA 2N50A 3CCUP 2GZEA 2XZ1C 3E2DA 4WYMA 4PXHB 2K0YA
chains in the Genus database with same CATH topology
2KORA 2AFDA 1KLPA 2JGPA 4H2YC 2MR7A 2QNWA 2LTEA 2CG5B 2FQ2A 2MD9A 3LMOA 1DNYA 2FAEA 3CE7A 3RG2A 5EJDA 2K92A 5KP7B 2PNGA 2GDWA 5HV8A 1ACPA 1NQ4A 2KGDA 4PWVB 2JQ4A 2CNRA 2ROQA 2KG8A 2K2QA 4H2XC 2KGAA 1F80D 2EHSA 3NY7B 2N6ZA 1HQBA 1OR5A 4HKGA 4IZ6A 1T8KA 2FACA 2AF8A 2L0QA 2L22A 2LKIA 2FVAA 1HY8A 2FVFA 3GZMA 2X2BA 3EJBA 2K94A 2JU1A 4H2WC 2LIWA 2MVUA 2N5IA 5HVCA 2AVAA 2N5HA 3EJEA 2K0XA 4R0MA 2MY5A 2FVEA 1DV5A 2MF4A 2L9FA 2FQ1A 2N98A 2KOSA 2KOQA 2CQ8A 2FADA 4MRTC 1X3OA 2DNWA 2KR5A 2LIUA 2KG6A 2FQ0A 2LPKA 1AF8A 2AFEA 2K93A 2KGCA 2CGQA 2KW2A 4CA3A 4BPGA 2LMLA 2L4BA 2N6YA 2KWLA 5CZDB 2GDYA 5KP6B 2KOPA 2JU2A 2LL8A 2MR8A 2MVVA 4NEOA 2KOOA 2KG9A 2XZ0D 3GZLA 2FHSC 2GDXA 2VSQA 1L0IA 2N50A 1L0HA 2LOLA 2KGEA 5KP8B 2XZ1C 3EJDA 4BPFA 2M5RA 4PXHB 2K0YA 4DG9A 1VKUA 2EHTA 4BPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOR A;  2AFD A;  1KLP A;  2JGP A;  4H2Y C;  2MR7 A;  2QNW A;  2LTE A;  2CG5 B;  2FQ2 A;  2MD9 A;  3LMO A;  1DNY A;  2FAE A;  3CE7 A;  3RG2 A;  5EJD A;  2K92 A;  5KP7 B;  2PNG A;  2GDW A;  5HV8 A;  1ACP A;  1NQ4 A;  2KGD A;  4PWV B;  2JQ4 A;  2CNR A;  2ROQ A;  2KG8 A;  2K2Q A;  4H2X C;  2KGA A;  1F80 D;  2EHS A;  3NY7 B;  2N6Z A;  1HQB A;  1OR5 A;  4HKG A;  4IZ6 A;  1T8K A;  2FAC A;  2AF8 A;  2L0Q A;  2L22 A;  2LKI A;  2FVA A;  1HY8 A;  2FVF A;  3GZM A;  2X2B A;  3EJB A;  2K94 A;  2JU1 A;  4H2W C;  2LIW A;  2MVU A;  2N5I A;  5HVC A;  2AVA A;  2N5H A;  3EJE A;  2K0X A;  4R0M A;  2MY5 A;  2FVE A;  1DV5 A;  2MF4 A;  2L9F A;  2FQ1 A;  2N98 A;  2KOS A;  2KOQ A;  2CQ8 A;  2FAD A;  4MRT C;  1X3O A;  2DNW A;  2KR5 A;  2LIU A;  2KG6 A;  2FQ0 A;  2LPK A;  1AF8 A;  2AFE A;  2K93 A;  2KGC A;  2CGQ A;  2KW2 A;  4CA3 A;  4BPG A;  2LML A;  2L4B A;  2N6Y A;  2KWL A;  5CZD B;  2GDY A;  5KP6 B;  2KOP A;  2JU2 A;  2LL8 A;  2MR8 A;  2MVV A;  4NEO A;  2KOO A;  2KG9 A;  2XZ0 D;  3GZL A;  2FHS C;  2GDX A;  2VSQ A;  1L0I A;  2N50 A;  1L0H A;  2LOL A;  2KGE A;  5KP8 B;  2XZ1 C;  3EJD A;  4BPF A;  2M5R A;  4PXH B;  2K0Y A;  4DG9 A;  1VKU A;  2EHT A;  4BPH A; 
#chains in the Genus database with same CATH topology
 1VQ6 P;  5HGO A;  2MR7 A;  2LTE A;  2PEK A;  1M1K Q;  2CG5 B;  2E1M A;  2FQ2 A;  1RNI A;  1D1D A;  2PNG A;  3G1G A;  2GDW A;  1ACP A;  2K0D X;  1KC8 Q;  4XFZ A;  5BS2 A;  1ZNV A;  3G4S P;  2EFJ A;  1HQB A;  1OR5 A;  4HKG A;  3G71 P;  2LKI A;  2FVA A;  2DGY A;  2FVF A;  3GZM A;  2X2B A;  3I56 P;  1KD1 Q;  3U43 A;  5HGL A;  3NTE A;  4H2W C;  2LIW A;  2MVU A;  2N5I A;  4R0M A;  5F2O A;  2OTJ P;  2CQ8 A;  2JB0 A;  2JAZ A;  4PH1 A;  4MRT C;  4U0B A;  1VQM P;  2KR5 A;  1IMP A;  1AF8 A;  1YJN P;  1E0H A;  2AFE A;  1UNK A;  1CEI A;  4U0A A;  2KGC A;  1ZMB A;  2BHV A;  2WPT A;  2KWL A;  5CZD B;  4COP A;  3VRL C;  1A43 A;  4NEO A;  1FR2 A;  3CCE P;  2KOO A;  2Z44 A;  2GDX A;  3CCS P;  1L0I A;  1L0H A;  4PH0 A;  2KOD A;  4BPH A;  2KOR A;  2AFD A;  1EIA A;  1AUM A;  4IPY A;  2QNW A;  3H0D A;  4XRO A;  3DTJ A;  3G29 A;  3CC2 P;  2FAE A;  5EJD A;  1VQ9 P;  3CCJ P;  3CCV P;  1S72 P;  3DS4 A;  1VQ7 P;  2VLO A;  4U0C A;  5DCK A;  1VQN P;  2KG8 A;  2GZI A;  3NY7 B;  1QVF O;  2N6Z A;  1UJZ A;  2ERH A;  5F2K A;  4IZ6 A;  2M8P A;  2QA4 P;  2FAC A;  2AF8 A;  2L0Q A;  1VQL P;  3CD6 P;  3G21 A;  3EJB A;  2ONT A;  1VQ4 P;  1Q86 Q;  3DS3 A;  3Q20 A;  2PEO A;  2JU1 A;  2PEQ A;  3CXC O;  1A8O A;  1M6N A;  3EJE A;  1VQ8 P;  3DS5 A;  1K9M Q;  2MY5 A;  2FVE A;  2L9F A;  2N98 A;  2PEJ A;  1YJ9 P;  1Q81 Q;  4XFX A;  4M0I A;  2PEM A;  2JYL A;  2FAD A;  1X3O A;  1Z6M A;  2DNW A;  2LIU A;  1N8R Q;  2LPK A;  2K93 A;  2KW2 A;  4CA3 A;  4BPG A;  2LML A;  2GZG A;  2L4B A;  2N6Y A;  2KOP A;  1K30 A;  2JU2 A;  4XFY A;  2MR8 A;  1W2B O;  2MVV A;  1VQ5 P;  1NJI Q;  3DS0 A;  2VSQ A;  5HGM A;  3CCM P;  1GXH A;  3H47 A;  3EJD A;  4BPF A;  2M5R A;  1BAJ A;  2JYG A;  1VKU A;  2OAR A;  3CCL P;  1QRJ A;  1KLP A;  4GR2 A;  2JGP A;  5EW5 E;  2EG5 A;  2JO0 A;  3G26 A;  2MD9 A;  4F37 A;  2K92 A;  5KP7 B;  4U0F A;  1YIJ P;  1IUQ A;  5HV8 A;  1AYI A;  5I4T G;  4PWV B;  2JQ4 A;  4H2X C;  2KGA A;  1F80 D;  2EHS A;  3B4Q A;  1KQS O;  5BS1 A;  7CEI A;  2L22 A;  3GKL C;  1HY8 A;  2VLP A;  1K73 Q;  3CC4 P;  3CCR P;  2K94 A;  2L6E A;  3DPH A;  5HVC A;  1MZ8 A;  2AVA A;  2N5H A;  3MGE A;  4COC A;  3OW2 O;  1DV5 A;  1K8A Q;  3CMA P;  2KOS A;  2PEI A;  2KOQ A;  5JPA A;  3CME P;  2EIA A;  3G6E P;  1GPJ A;  2XV6 A;  2FQ0 A;  2XXM A;  1VQO P;  3HZQ A;  2CGQ A;  3G28 A;  5KP6 B;  2OTL P;  2LL8 A;  2GZF A;  4QNB A;  2KG9 A;  2LOL A;  2KGE A;  2LF4 A;  5KP8 B;  2GZJ A;  3CPW O;  3P05 A;  4DG9 A;  1YJW P;  1M90 Q;  2BUO A;  2PY8 A;  2EHT A;  2K5X A;  4H2Y C;  1VQK P;  4U0E A;  2VLN A;  3LMO A;  1DNY A;  3LRY A;  3CE7 A;  3I55 P;  3RG2 A;  1M6E X;  3B5I A;  3CCQ P;  3DS1 A;  1QVG O;  5F2N A;  1JJ2 O;  1NQ4 A;  1YIT P;  1GXG A;  2KGD A;  2Z46 A;  1YI2 P;  2ROQ A;  2CNR A;  2K2Q A;  2Z45 A;  3G0V A;  1RO0 A;  1T8K A;  1RO2 A;  2XT1 A;  3CC7 P;  1IMQ A;  3WBH A;  2QEX P;  3HYB A;  1Q7Y Q;  2P9X A;  5HGN A;  2JBG A;  4XRQ A;  4GR6 A;  3M1M A;  4U0D A;  1YHQ P;  2K0X A;  1Q82 Q;  2MF4 A;  1EOQ A;  2FQ1 A;  3GJN A;  3DS2 A;  2M8N A;  1VQP P;  2CWO A;  3H4E A;  1M74 A;  2KG6 A;  4QKO A;  1EMV A;  2M8L A;  2GYK A;  2NO8 A;  2GDY A;  4UHP B;  1E6J P;  1BXI A;  2PEN A;  3RG6 C;  1VHN A;  3G1I A;  3GZL A;  2XZ0 D;  2FHS C;  2VLQ A;  2N50 A;  3CCU P;  2GZE A;  2XZ1 C;  3E2D A;  4WYM A;  4PXH B;  2K0Y A; 
#chains in the Genus database with same CATH homology
 2KOR A;  2AFD A;  1KLP A;  2JGP A;  4H2Y C;  2MR7 A;  2QNW A;  2LTE A;  2CG5 B;  2FQ2 A;  2MD9 A;  3LMO A;  1DNY A;  2FAE A;  3CE7 A;  3RG2 A;  5EJD A;  2K92 A;  5KP7 B;  2PNG A;  2GDW A;  5HV8 A;  1ACP A;  1NQ4 A;  2KGD A;  4PWV B;  2JQ4 A;  2CNR A;  2ROQ A;  2KG8 A;  2K2Q A;  4H2X C;  2KGA A;  1F80 D;  2EHS A;  3NY7 B;  2N6Z A;  1HQB A;  1OR5 A;  4HKG A;  4IZ6 A;  1T8K A;  2FAC A;  2AF8 A;  2L0Q A;  2L22 A;  2LKI A;  2FVA A;  1HY8 A;  2FVF A;  3GZM A;  2X2B A;  3EJB A;  2K94 A;  2JU1 A;  4H2W C;  2LIW A;  2MVU A;  2N5I A;  5HVC A;  2AVA A;  2N5H A;  3EJE A;  2K0X A;  4R0M A;  2MY5 A;  2FVE A;  1DV5 A;  2MF4 A;  2L9F A;  2FQ1 A;  2N98 A;  2KOS A;  2KOQ A;  2CQ8 A;  2FAD A;  4MRT C;  1X3O A;  2DNW A;  2KR5 A;  2LIU A;  2KG6 A;  2FQ0 A;  2LPK A;  1AF8 A;  2AFE A;  2K93 A;  2KGC A;  2CGQ A;  2KW2 A;  4CA3 A;  4BPG A;  2LML A;  2L4B A;  2N6Y A;  2KWL A;  5CZD B;  2GDY A;  5KP6 B;  2KOP A;  2JU2 A;  2LL8 A;  2MR8 A;  2MVV A;  4NEO A;  2KOO A;  2KG9 A;  2XZ0 D;  3GZL A;  2FHS C;  2GDX A;  2VSQ A;  1L0I A;  2N50 A;  1L0H A;  2LOL A;  2KGE A;  5KP8 B;  2XZ1 C;  3EJD A;  4BPF A;  2M5R A;  4PXH B;  2K0Y A;  4DG9 A;  1VKU A;  2EHT A;  4BPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...