1VQOP

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqoP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqoP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqoP02
3OW2O 1W2BO 1KC8Q 1KD1Q 1VQKP 1YHQP 3CC7P 1YITP 1VQ7P 2QA4P 1NJIQ 1VQ8P 2QEXP 3CMEP 3CCSP 1Q7YQ 2OTJP 3CCUP 1M1KQ 3CCEP 1K73Q 1Q81Q 1K8AQ 3CCQP 3I55P 1YJ9P 1YI2P 1JJ2O 1VQ5P 3CCVP 1KQSO 1Q86Q 1VQ4P 1YIJP 3CD6P 1VQMP 1S72P 2OTLP 3CPWO 3I56P 3G6EP 3CC2P 1VQ6P 1VQNP 1VQLP 1VQ9P 1QVFO 1N8RQ 3G71P 3CXCO 1VQOP 3CC4P 1K9MQ 1Q82Q 3CCRP 1YJNP 1M90Q 1YJWP 1VQPP 3CCLP 3CCJP 3G4SP 1QVGO 3CCMP 3CMAP
chains in the Genus database with same CATH superfamily
1Y9BA 1J1DC 3LRYA 2ZYGA 1FZFA 3LW5J 1BXIA 1R5LA 5AW3B 3G1GA 1J1EB 1NTZJ 1KZUB 2FVFA 3D71A 2QJYB 1P84D 2JO0A 3MHVA 3SWYA 1VQKP 4JBZA 1DIPA 1FC2C 4BXLA 2KORA 5BU8B 1A02F 2FXPA 2N5IA 3RBZA 4NEOA 3HYBA 2BHVA 4H2WC 3C9IA 2A45G 2LXBA 2Z5IA 5AVZB 4A7PA 2W6BA 2VSQA 5HVCA 3L35A 1SQQD 3L71D 1JUNA 1KILD 4EI2A 2OYOA 3AEBC 4L75A 2RH0A 1LWUA 4QMAA 1KB9H 1R5SA 2LTEA 2BASA 4DOJA 1OW6A 2ZXXA 5HGMA 2P2UA 3DTJA 2B88A 5CBOA 1HH0A 2OTJP 1OWAA 3CCVP 4QKOA 3AE6C 1PFIA 3H1HD 4HKZH 5B66H 5CCGD 4WY4A 2IBZG 1YHQP 1ZN5A 4JYBA 2JDIH 3FXEA 2M8PA 1BGYD 3EJDA 5KP6B 1M57D 4W7YA 3VP9A 5AW9B 1SQXG 3TGUJ 5TJHA 2IBZD 3A2AA 2JGPA 2LXCB 1VF5C 1GL2A 3TSIA 2IDBA 2E76D 3CXHD 1HVVA 3G26A 4KT0J 2A06G 4COCA 2H88C 1PV3A 2ITAA 1AF8A 3AEGC 4N78D 1NTKJ 2IBZE 1DNYA 1EIAA 2LMLA 3HUSA 1S3JA 5AVQB 2JU1A 1JTHA 1SQXE 2IPPA 2PFXA 1CSBA 1U7MA 2HLOA 1PGQA 2KG9A 4U0FA 1YQ4C 4BPHA 4WVZA 2KLVA 2UWJE 3H6PA 2YXQB 5M1BA 1KYOH 1LT9A 3G1IA 4OGQD 2JBGA 1Z56A 3B4QA 2A06E 2MR8A 2GA1A 3BVHA 4H0LB 3B5NB 1GTWA 2WMMA 3BCCJ 3T97B 2E74B 4RO0A 5EJDA 3V2PA 1NTZG 1VQPP 3MZWB 2E1MA 3P8MC 5CZDB 4U3FJ 3CWBD 2CPBA 4R0MA 1S5LE 1ZW0A 2BEZF 1VQMP 1K04A 5KAIE 1X22A 1BCCJ 4ZKPA 2WVRA 4I7ZC 3AE1C 4WY4C 1PZQA 2KSJA 5KJ7A 1L0NJ 1NTZE 2Q3IA 2BCCJ 3AEFC 1SQQK 1FDIA 3H4EA 2JYGA 1S72P 2LR2A 3Q5RA 2E42A 3M9HA 1RO0A 2O01J 3M91A 1OR5A 1GL2C 2Q1KA 3IR9A 2PEIA 2E75C 1DV5A 3MTUE 2Y9YA 3A0HH 1H89A 3IF4A 4I2LC 1FZAA 3B8EB 3I56P 3L37A 1LWUB 3H0DA 3CX5D 5BVZA 2K5XA 3HUSC 1URQA 2LF4A 1YTZI 3L4FA 1K30A 1Q7YQ 1YQ3C 2JP3A 4AUWA 2Z46A 3L70D 3AE8C 2KIKA 3HZQA 3L72G 1IO4A 5E79E 1XTGB 1WRGA 2OYHB 4I7ZB 2E43A 3RK3C 5CCHC 4WY4B 3L73G 2YNYA 3SWFA 3JSVC 1FZBA 2HFED 3KXDA 3USSA 2GZJA 2N6YA 2ZAEB 1AA0A 5AVXB 1MV8A 5DJTB 3O6QB 4KJMA 5L8RJ 1L4AD 1NTKG 1ZR4A 2XZ0D 1GL2B 3RGUA 3L72E 2E75B 5APQA 4M3LA 4MN4C 5AVRB 2YMYA 1P84I 1GW4A 2KSEA 2HR3A 5KJ7C 2JWAA 3II6A 3L73E 1IFNA 1PPJE 3CPWO 4AQRD 4H2XC 5JPAA 1N86A 1X79B 1HQBA 3HUSB 1IFIA 2W90A 1OVVA 1JTHB 1NKNA 1FZCB 2DNWA 3P05A 1F80D 4NPEA 1N2DC 3BCCG 1VHNA 2XV5A 1NTKE 3H1JJ 1M6NA 1KB9E 2OTKE 3PHLA 4C7RA 1KFNA 1S4XA 1LT9B 2PEKA 1FOSE 2CG5B 3KYQA 1JY3P 1SQVG 1S9KD 4U3FG 4NPDA 2IX7C 2W6AA 2P10A 1L0LG 3MP7B 1EQ7A 3H1KJ 4Y99B 1IC2A 2KP8A 2GUSA 3KHUA 1LTJB 1URQC 2RN0A 4CPGA 1DEEG 2LIWA 2B87B 3U43A 5B66E 4TT3H 1NTMD 2ROQA 2LPKA 2M0BA 2JQ4A 3BCCE 1JCCA 2XU6A 2FYNC 2BCCG 1T3UA 2HODB 1FDOA 1K9MQ 2WWWA 4PJ0H 1SQVE 1KQLA 4U3FE 3CMAP 2EIAA 1L0LE 5F2OA 2H8PD 1GU4A 3MGEA 1PEUA 1OVRA 2IBZI 1G1IA 1MZ8A 4YPCA 1KYOD 2J5UA 2EHTA 4WYMA 4LC1A 3QWOC 3TDKA 3H1LG 2BCCE 3CXHI 4PD4D 3V2QA 2FAEA 1IJDB 4C46A 1A02J 3DS3A 3V5BA 1NU1J 2B89A 5KKZC 3SSUA 1IMQA 1KYOE 1M90Q 1URQB 2N1TD 1FZGA 1JY2N 3IFMA 2FY8A 3TK1A 2NRGA 3FGAD 1ZP0C 3ZDMA 2EHSA 1LJ2A 1NGMB 3L71J 2WSCH 2RMZA 3H1LE 1HBWA 1KV4A 3W67A 2Y0EA 4IFFA 1VQNP 2K0XA 3AE3C 3H1IJ 4EIJA 3M9BA 1E5WA 1CEIA 4I6MC 3I5CA 2GDXA 1DEBA 2KOSA 1ZRTD 4H13D 2LIUA 2AEMA 1K73Q 1JY2O 4YXDC 2ZT9D 1QGKB 1OX3A 2Z4EA 4XFJA 1J1EC 4ZMDA 4PWVB 2QJKB 2XNDH 2Z5HA 1GZLA 3CCRP 2YKOA 3N4XA 2QJYC 4ASWA 3HD7B 3RK2D 1VQ7P 5K5GB 3P8CE 1SVFA 1FU1A 2ZJSE 1SQBG 4U0BA 1JOCA 3H1JG 3GF3A 2CPSA 3A0HE 3RG2A 2K1AA 4H13B 5APVA 1HJ0A 1NOHA 1SQBD 1USEA 3VOPA 3A3YB 1SFCB 4TLFA 2WSCJ 5BS2A 1JJ2O 2JU2A 1KFMA 1AVYA 2RKLA 1NTMK 1T8ZA 2WSSH 2R32A 3WU2H 3AEEC 4GKGA 2VRSA 3B5NA 1AVOA 3CX5I 3T97A 3H1JE 2R3SA 4PV1D 2GZFA 2AXTH 5EFWB 3OA7A 2M3BA 3H1KE 1T8KA 2OTLP 3JCUH 2FQ1A 2OGUA 5KAFH 3DS4A 2AFEA 1JCDA 2FFDA 2W83C 3NFQA 2XKMA 2KWLA 1M74A 2QEXP 2Q9IA 2IYPA 4F37A 2WITA 3CWBJ 3AECC 3EJEA 1E6JP 5HGNA 1WMKA 3CL3D 2MJZA 3CXCO 1IFJA 1JMBA 3Q20A 1YJWP 1NU1G 1EZVG 3CLQA 3S4RA 2JR8A 3MUDA 1BDCA 1EDKA 1ZR2A 4D6TJ 1GXHA 2VLPA 2LKMA 1QVFO 1KQGB 1QRJA 1EDIA 3H1IG 3JC22 4I1LA 2ERHA 1PGOA 3GZMA 1NU1E 2WPQA 2VLQA 1EZVE 5APUA 2OQQA 3PH0A 1AV1A 2KOOA 2E76C 3H25A 2V7QJ 2C0WA 3V6IA 3AE2C 1KILB 2OYHA 4H0LC 3B5NC 2FQ2A 2E74C 5BU5A 2GYKA 2MD9A 2XXMA 3D6YA 2PEMA 3H32A 2MVUA 4PJ0E 3H1IE 2PENA 1AYIA 3O6QA 1W2EA 1VKUA 3NTNA 2KNCB 3VMYA 4OH8B 1SQXD 2FFDC 1SQBK 1BE3J 3LIDA 1QLED 2KGAA 2YKPA 2Q6QA 4C7NB 4LLHA 2VLNA 1RF0A 3I55P 1Y47A 5DCKA 1SQPJ 2DW3A 2AFDA 2YKQA 2PEQA 2FXOA 3IN6A 2O1JA 1AQTA 2A06D 4EDFA 4B86A 2KYVA 2E5TA 1Q82Q 4IPYA 2GDYA 1FZCA 4HKGA 1J2JB 2O01H 1KYOI 5B5EH 2ZFCA 3CE7A 5C39A 1XTCC 3MIWA 3MUDC 3PJSK 4PD4I 2XDJA 1GK6A 1PP9J 2E76B 2QJPC 2KOGA 2WPSA 1VQLP 1FE6A 4BRYA 1LWUC 3G0VA 2JEEA 2FYUJ 5GTHH 1IZNB 1LTJA 1PEMA 2IZ1A 1VF5D 3HTKB 2QNWA 4GDOA 2B87A 2CWOA 2FQ0A 1RE4A 1NTZD 2G8YA 5KLVJ 5CBNA 1VQ4P 4L76A 1BSHA 4GIFA 2KG6A 2HODA 3WUUA 2IYOA 4N3YB 2FFDB 3V2RA 3M1MA 2L9FA 2OYHC 3FX0A 4OGQB 4MRTC 2P67A 3V4WA 2M3EA 1EDJA 1PGPA 3U1AA 2WSEJ 4HH2A 2R5DA 3Q2YA 1OZHA 5AW7B 3NMDA 4UB8H 3Q5SA 3CC2P 3NY7B 4D6TG 4OVNF 3QH9A 1CI6B 3ITKA 2XNXA 2K88A 1T6AA 1N73B 2KZJA 5AW2B 5APTA 1FJPA 2QJPB 2KLUA 1RF0C 2L4BA 2VLOA 3L75J 4JQ0D 1ZOYC 3D70A 3IAOA 3WBHA 1G2CA 1FZCC 5HV8A 5AVSB 2QIWA 5KTBA 2K93A 3L74J 3WU2E 1NQ4A 4D6TE 1PEQA 2KS1B 4GOFA 1OIPA 1IMPA 1LT9C 1A8OA 4JPZB 1YYCA 2AXTE 1NVOA 1HUCA 4N6JA 1EOQA 3TGUG 3L72D 4Y99C 1SQXK 1LGHB 1LTJC 1JNMA 1HGVA 3JCUE 1PPJG 5KAFE 1HJBA 2M8RA 3H32B 2QM7A 2ZVOB 1BE3G 1RE4C 1CZQA 1GPJA 3VYIA 3L73D 5GTIH 3DS2A 1PPJD 4BPGA 1SQPG 1D7MA 1GMJA 5APXA 1KC8Q 3HD7A 1KMIZ 3TGUE 1NTKD 3B71A 3CCUP 1KB9D 4RJTA 3BATA 3RL0D 2XV6A 3GHGB 2YO2A 3G3ZA 2HG5D 1BE3E 1PP9G 3HRNA 1FDMA 2FVAA 2Y9ZA 3H47A 1SFCA 1SQPE 3G29A 2KZIA 2CGQA 1L4AB 2A45I 1OMIA 2J59M 3L36A 2K94A 3RK3D 5CCHD 1P84H 2CNRA 1FBMA 3CD6P 1EZVI 3BCCD 1NTZK 1BAJA 1MUUA 2NPSD 3VMZA 4DT0A 5KLVG 4BRYB 1ACPA 3VTPC 2I8DA 1BCCG 1SQVD 5AW8B 4EOTA 4U3FD 2GUVA 1PP9E 1Q90D 1L0LD 3RG6C 1VQ8P 2FYZA 3MGNA 3RK3E 3UIAA 4JF7A 3P32A 5AW1B 1G1JA 1QL2A 5CJ0A 2FYUE 2Q5UA 1L0NG 5KJ7D 3AEAC 1HTLC 3KDPB 3E1IA 1EDLA 2WPVB 2QVAA 1M56D 2POHA 1LNQA 2QG4A 3W68A 1QX8A 5KLVE 2BCCD 4Y28J 4UB6H 4HYTB 1BCCE 2R3CA 1JEKA 2KR5A 1JY3N 3GF7A 1VQ6P 4K3AA 1ZNVA 1SLQA 1S1CX 2AXCA 3L75G 3G21A 3M0DA 2QJKC 4U0DA 5F2KA 1RH5B 1KQFB 1L0NE 1K05A 2WT7B 5CHXA 3HD7C 2JO1A 3PRJA 4HJGH 3L74G 1HY8A 3H1LD 4R4LA 4GR6A 1JB0J 5B5EE 4BPFA 1ZMBA 1LTSC 2H43A 1RF1B 4H13C 5AW6B 1G2CB 3Q1MA 3G4SP 3CCMP 2Q3EA 1EC5A 4H44D 1SFCC 3L75E 1AUMA 5GTHE 3CXHH 1MKMA 1BDDA 1IFDA 3RBXA 1SQQJ 2OYIA 1FR2A 3AEDC 2HPCB 3L74E 1LT1A 1KILA 4DZOA 2C9LY 2LOLA 3KQGA 4IZ6A 2K9JB 2YIUC 1YBKA 3P8CD 4OWFA 2N1TB 1NTKK 2N9YB 4COPA 4XA4A 4HB1A 1DH3A 3E7KA 4WWIA 1N7SD 2WPTA 2KNCA 3H1HJ 4UB8E 1KD1Q 3CC7P 1T2KC 5CCGA 2IFNA 4C7NA 2ZXEB 3GJNA 3B4SA 1BGYJ 4XFXA 1N8RQ 4PH1A 1GW3A 2P7JA 2YXRB 3H1JD 2ZT9B 3M0DC 1SQXJ 2WZ7A 4H2YC 1VPCA 3H1KG 1SQVK 1PGJA 3CI9A 1L0LK 2EFJA 2I1KA 3CCQP 5HGLA 3H1KD 3RK2B 3BRVB 1ZXGA 4ZNCA 3Q3DA 3MD0A 3OW2O 3WUTA 3TNUB 2YIUB 3HTKA 3DS1A 1OXZA 3WMM0 3TF5A 2D2CD 1PIXA 2OYIC 1D1DA 1KILC 2V7QH 1X0TA 2N98A 2R44A 7CEIA 5APYA 1W2BO 5GTIE 3CX5H 3AE5C 1T3JA 2QE7H 4PV1B 4W80A 2XZRA 1HF9A 1IUQA 2XZ1C 1LTTC 2H7HA 5TISH 2NO8A 3HE4A 2Z44A 3CC4P 3U1CA 2D2CB 3VRLC 1WT6A 2MVVA 1ZMEC 3LMOA 1E0HA 1CI6A 1R8EA 1N73A 5F2NA 1NU1D 1KB9I 1EZVD 5CCGC 2FXMA 5AVYB 1GXGA 2L6EA 3GLMA 1OVUA 2JB0A 2P9XA 1SQQG 3L71G 2PGDA 2KGDA 1P84E 3E1RA 2P1JA 4KHXA 3VN0A 1HWTC 3D6ZA 1LP1B 3HE5B 2QRXA 1M1KQ 3CCEP 1Q81Q 2KS1A 3H1ID 2OYIB 2JWDA 2JKVA 3N7NA 4IOIH 1SS1A 1IK7A 4IFDK 2L22A 1J1DB 2AVAA 5CJ4A 1M7LA 1PL5A 1YITP 1SQQE 1M8OB 5EW5E 3L71E 1KILE 3H1HG 2E5YA 3PP5A 2KOQA 1NHLA 4PXHB 4DG9A 3V2NA 3R4YA 3L70J 1LTIC 3KZIH 3M0AA 1RY3A 1GDTA 1BGYG 4UB6E 1GU5A 1BSNA 1ZLLA 1W5CE 4RKUJ 2AEJA 1RO2A 4GT1A 3L72J 4OGQC 1EXJA 4JYCA 2KOPA 3A5TA 1JM0A 3GKLC 1FJKA 2WSEH 3GHGA 2WPRA 3H1HE 1UJZA 4ASVA 1L2PA 3L73J 2Y0CA 3WUVA 5AVUB 1YJNP 2O01N 3EFGA 3G28A 1NYHA 2FADA 3GMAA 1BGYE 2JAZA 2N6ZA 1L4AA 1VDFA 2ZVNB 3B5ND 1Q2NA 4H0LD 1N73C 4IFMA 2E74D 1NH4A 1M1JA 4XROA 2B9BA 2KG8A 4IL6X 4GR2A 3CXHE 3CCLP 1QL1A 1OW8A 5H2FH 1KTMA 3GZLA 2K37A 2MF4A 1H0TB 2YO3A 3GW6A 1X9VA 1K8AQ 4N78E 3ABVC 2G3AA 1MFZA 2W6JH 1L0IA 1FS0E 4PD4H 1H8AA 3VP8A 1IFMA 4UHPB 3EWKA 4GODA 5CCHA 2GZEA 2EG5A 1DD4A 3CWBG 2M8NA 2M5RA 3DS5A 2KI7B 3DPHA 5AVVB 2NPSA 1RNIA 1SQVJ 3FXDA 5KP7B 1L0LJ 2LL8A 4Z1MH 3VMXA 2KXPB 4U7JA 2FVEA 3AE7C 3G6EP 1NTMJ 1NU1K 2NZ2A 1SP4A 1VF5B 3HE4B 2KUBA 1EXIA 5DJUB 3C8VA 2QM8A 2WT7A 1UNKA 2X2BA 3CWBE 4D6TD 3FWNA 1UIXA 3NTEA 1YJ9P 1EMVA 4ZKUA 1ZV8A 3GHGC 1OW7A 1PEOA 2I1JA 4U0CA 3K5BA 1RF1A 1VL2A 4CA3A 1KLPA 4DJGA 4IL6H 1KORA 2M8LA 3NXSA 1RHZB 3AE9C 1L4AC 2M5AA 5I4TG 2JJLA 3A0BH 1CW5A 4WY4D 1M1JC 4U0EA 3H1LJ 1VQOP 2HPCA 3B5IA 2L0QA 1HGZA 3L70G 3O8ZA 4BWNA 1X8YA 2GM4A 1RE3A 3RL0C 2PY8A 1LTAC 1JMMA 1JO5A 2QA4P 3AE4C 2K2QA 3M9QA 3TGUD 2K9JA 2ZYAA 5AW5B 1GL2D 1NAFA 2E75D 2N1TA 2PEOA 2PNGA 3E2DA 3CX5E 1RQUA 2YMKA 1Z6MA 1IK9A 1FAVA 2Y0DA 2Z45A 3G71P 1BE3D 4XRQA 4PH0A 1MFTA 2CK3H 4M0IA 5HGOA 1E79H 3SFEC 1SQPD 2KGCA 2NPSC 5TISE 3L70E 3PTZA 4YTPC 3OAKA 1MZ9A 2FACA 3BRTB 3M06A 3S9OA 1FOSF 4RESB 4YXWH 1U7JA 3RL0g 2P58A 2HYNA 1NJIQ 1PP9D 2PEJA 2FYUG 1N7SA 3DS0A 1X3OA 1YIJP 1M1JB 2FYUD 2SPZA 3F89A 5AVTB 1A43A 3GG2A 2Q7CA 1M6EX 3RL0B 4QNBA 1RF1C 5AVWB 3OJAB 3SWKA 3PLNA 1SQBJ 3TNUA 5KLVD 2MY5A 2R5BA 2KW2A 3SFDC 1BCCD 2KGEA 2A45H 3V4QA 2DGYA 2K3RA 1UIIA 2N9BA 2K9YA 2BQ1E 3RK3B 1NTMG 4K35A 2CQ8A 1RE3C 1L0ND 2NPSB 3R2PA 3KZIE 4AYCA 2GZGA 2K92A 4NPFX 4LGDE 5AW0B 2W27A 1S9KE 1S2EA 3BASA 2N1TC 2L91A 2MKVA 3U59A 4H44C 1S5LX 1QEXA 4U0AA 1JY2P 2AF8A 1IFPA 3F5HA 3S1KA 3EQ2A 1GK4A 1NTME 1LTGC 3L75D 1URQD 5KLIC 1NWQA 4XFZA 5KP8B 1KN7A 2PAJA 1USDA 1VQ9P 1AQ5A 3L74D 2QSIA 1JY3O 2W8ZA 2ZT9C 1GD2E 1LP1A 3HE5A 2IFMA 2M5AB 1N7SC 5H2FE 2PRRA 2ZYDA 1U57A 3P7KA 3RK2C 2N50A 4WBAA 1OFCX 2N5HA 2JYLA 4GOEA 2BUOA 1FZEA 4PD4E 1H88A 5AW4B 5BS1A 2K0DX 1DX7A 3CCSP 2FKWB 4O9BA 1AFOA 1LTBC 3KPEA 1SQPK 4R4MA 4WB4A 1Q86Q 2FYNB 2O3JA 3G9RA 3HD7D 2V4HA 4H44B 2OARA 4DCKA 4L73A 3A7OA 1YTZT 1N7LA 3C1LA 2WSFH 1S5LH 5KAIH 2C0XA 4EYYQ 2KODA 2XT1A 2KB7P 5KLIB 4PV1C 3LW5H 1SFCD 2FHSC 2LKIA 5APWA 3TYYA 2C9NY 2FYUK 3CCJP 1QVGO 4L74A 2D2CC 3EFFK 1NKZB 2WTYA 2KK7A 1NO4A 1ZRTE 2O1KA 4XE5B 1DD3A 1N7SB 2IZ0A 5KLVK 1Y8AA 4IL6E 5APSA 1YI2P 1KQSO 5KKZB 2FBWC 4W7ZA 2H89C 3Q5PA 2PP6A 4XFYA 3EJBA 1AJYA 3A0BE 2MR7A 3LIEA 2AEFA 3CMEP 1TU3F 2BEQD 2GZIA 1L0NK 2ONTA 5CMZA 1H0TA 3FWLA 1VQ5P 2L5GB 2GDWA 1NAYA 1RQVA 2J58A 2K0YA 1T2KD 2WQYC 1L0HA 1SQBE 2WSFJ 3VMAA 5E79H
chains in the Genus database with same CATH topology
3G28A 1KD1Q 2M8LA 1YHQP 5BS1A 3CC7P 3LRYA 5F2NA 3CCSP 2M8PA 2CWOA 5I4TG 5BS2A 1JJ2O 3DS3A 3H4EA 2JYGA 1Q86Q 1VQ4P 1S72P 3CPWO 3G1GA 4XROA 2DGYA 3DS2A 2L6EA 5JPAA 1VQ6P 4XFXA 2OARA 4U0EA 2BQ1E 2P9XA 1RO0A 1N8RQ 1VQOP 3B5IA 3G21A 4GR2A 3M1MA 4PH1A 1M90Q 4U0DA 3CCLP 3P05A 2JO0A 2PEIA 5F2KA 2PY8A 1KC8Q 1VQKP 2QA4P 3G26A 1M6NA 2XXMA 2PEMA 4COCA 3CCUP 1M1KQ 3CCEP 2KODA 2XT1A 2EFJA 1Q81Q 2PEKA 3CCQP 1K8AQ 2PEOA 3HYBA 2XV6A 2BHVA 2PENA 3E2DA 4GR6A 1EIAA 5HGLA 3I56P 1ZMBA 3H0DA 2OTLP 3CC2P 1VQNP 2Z45A 3DS4A 3G71P 4XRQA 2EG5A 4PH0A 2M8NA 4U0AA 3CCJP 3G4SP 1QVGO 3DS5A 3CCMP 2LF4A 1M74A 4M0IA 3H47A 3OW2O 3DPHA 4U0FA 1RNIA 3G29A 1YITP 1K30A 5HGOA 2QEXP 1Q7YQ 3DS1A 2Z46A 1AUMA 1K73Q 3I55P 3HZQA 5DCKA 3G1IA 1YI2P 1KQSO 3CD6P 2PEQA 1BAJA 3G6EP 4XFZA 1E6JP 5HGNA 1VQ9P 3CXCO 1K9MQ 4XFYA 4IPYA 3CCRP 3WBHA 1Q82Q 1D1DA 3Q20A 1VQPP 1YJWP 2E1MA 3CMAP 1W2BO 2EIAA 1RO2A 5HGMA 5F2OA 3DTJA 1VQ7P 1NJIQ 3RG6C 2PEJA 1VQ8P 3CMEP 2OTJP 1PEQA 2ONTA 3DS0A 3MGEA 3NTEA 1YJ9P 4U0BA 4COPA 1VQ5P 3CCVP 1PEUA 1YIJP 1VQMP 1A8OA 1IUQA 1VQLP 3G0VA 1EOQA 1A43A 1QVFO 1PEOA 2JYLA 1M6EX 2Z44A 4U0CA 3CC4P 1QRJA 1YJNP 3VRLC 4QNBA 2BUOA 4WYMA 1PEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 O;  1W2B O;  1KC8 Q;  1KD1 Q;  1VQK P;  1YHQ P;  3CC7 P;  1YIT P;  1VQ7 P;  2QA4 P;  1NJI Q;  1VQ8 P;  2QEX P;  3CME P;  3CCS P;  1Q7Y Q;  2OTJ P;  3CCU P;  1M1K Q;  3CCE P;  1K73 Q;  1Q81 Q;  1K8A Q;  3CCQ P;  3I55 P;  1YJ9 P;  1YI2 P;  1JJ2 O;  1VQ5 P;  3CCV P;  1KQS O;  1Q86 Q;  1VQ4 P;  1YIJ P;  3CD6 P;  1VQM P;  1S72 P;  2OTL P;  3CPW O;  3I56 P;  3G6E P;  3CC2 P;  1VQ6 P;  1VQN P;  1VQL P;  1VQ9 P;  1QVF O;  1N8R Q;  3G71 P;  3CXC O;  1VQO P;  3CC4 P;  1K9M Q;  1Q82 Q;  3CCR P;  1YJN P;  1M90 Q;  1YJW P;  1VQP P;  3CCL P;  3CCJ P;  3G4S P;  1QVG O;  3CCM P;  3CMA P; 
#chains in the Genus database with same CATH topology
 1Y9B A;  1J1D C;  3LRY A;  2ZYG A;  1FZF A;  3LW5 J;  1BXI A;  1R5L A;  5AW3 B;  3G1G A;  1J1E B;  1NTZ J;  1KZU B;  2FVF A;  3D71 A;  2QJY B;  1P84 D;  2JO0 A;  3MHV A;  3SWY A;  1VQK P;  4JBZ A;  1DIP A;  1FC2 C;  4BXL A;  2KOR A;  5BU8 B;  1A02 F;  2FXP A;  2N5I A;  3RBZ A;  4NEO A;  3HYB A;  2BHV A;  4H2W C;  3C9I A;  2A45 G;  2LXB A;  2Z5I A;  5AVZ B;  4A7P A;  2W6B A;  2VSQ A;  5HVC A;  3L35 A;  1SQQ D;  3L71 D;  1JUN A;  1KIL D;  4EI2 A;  2OYO A;  3AEB C;  4L75 A;  2RH0 A;  1LWU A;  4QMA A;  1KB9 H;  1R5S A;  2LTE A;  2BAS A;  4DOJ A;  1OW6 A;  2ZXX A;  5HGM A;  2P2U A;  3DTJ A;  2B88 A;  5CBO A;  1HH0 A;  2OTJ P;  1OWA A;  3CCV P;  4QKO A;  3AE6 C;  1PFI A;  3H1H D;  4HKZ H;  5B66 H;  5CCG D;  4WY4 A;  2IBZ G;  1YHQ P;  1ZN5 A;  4JYB A;  2JDI H;  3FXE A;  2M8P A;  1BGY D;  3EJD A;  5KP6 B;  1M57 D;  4W7Y A;  3VP9 A;  5AW9 B;  1SQX G;  3TGU J;  5TJH A;  2IBZ D;  3A2A A;  2JGP A;  2LXC B;  1VF5 C;  1GL2 A;  3TSI A;  2IDB A;  2E76 D;  3CXH D;  1HVV A;  3G26 A;  4KT0 J;  2A06 G;  4COC A;  2H88 C;  1PV3 A;  2ITA A;  1AF8 A;  3AEG C;  4N78 D;  1NTK J;  2IBZ E;  1DNY A;  1EIA A;  2LML A;  3HUS A;  1S3J A;  5AVQ B;  2JU1 A;  1JTH A;  1SQX E;  2IPP A;  2PFX A;  1CSB A;  1U7M A;  2HLO A;  1PGQ A;  2KG9 A;  4U0F A;  1YQ4 C;  4BPH A;  4WVZ A;  2KLV A;  2UWJ E;  3H6P A;  2YXQ B;  5M1B A;  1KYO H;  1LT9 A;  3G1I A;  4OGQ D;  2JBG A;  1Z56 A;  3B4Q A;  2A06 E;  2MR8 A;  2GA1 A;  3BVH A;  4H0L B;  3B5N B;  1GTW A;  2WMM A;  3BCC J;  3T97 B;  2E74 B;  4RO0 A;  5EJD A;  3V2P A;  1NTZ G;  1VQP P;  3MZW B;  2E1M A;  3P8M C;  5CZD B;  4U3F J;  3CWB D;  2CPB A;  4R0M A;  1S5L E;  1ZW0 A;  2BEZ F;  1VQM P;  1K04 A;  5KAI E;  1X22 A;  1BCC J;  4ZKP A;  2WVR A;  4I7Z C;  3AE1 C;  4WY4 C;  1PZQ A;  2KSJ A;  5KJ7 A;  1L0N J;  1NTZ E;  2Q3I A;  2BCC J;  3AEF C;  1SQQ K;  1FDI A;  3H4E A;  2JYG A;  1S72 P;  2LR2 A;  3Q5R A;  2E42 A;  3M9H A;  1RO0 A;  2O01 J;  3M91 A;  1OR5 A;  1GL2 C;  2Q1K A;  3IR9 A;  2PEI A;  2E75 C;  1DV5 A;  3MTU E;  2Y9Y A;  3A0H H;  1H89 A;  3IF4 A;  4I2L C;  1FZA A;  3B8E B;  3I56 P;  3L37 A;  1LWU B;  3H0D A;  3CX5 D;  5BVZ A;  2K5X A;  3HUS C;  1URQ A;  2LF4 A;  1YTZ I;  3L4F A;  1K30 A;  1Q7Y Q;  1YQ3 C;  2JP3 A;  4AUW A;  2Z46 A;  3L70 D;  3AE8 C;  2KIK A;  3HZQ A;  3L72 G;  1IO4 A;  5E79 E;  1XTG B;  1WRG A;  2OYH B;  4I7Z B;  2E43 A;  3RK3 C;  5CCH C;  4WY4 B;  3L73 G;  2YNY A;  3SWF A;  3JSV C;  1FZB A;  2HFE D;  3KXD A;  3USS A;  2GZJ A;  2N6Y A;  2ZAE B;  1AA0 A;  5AVX B;  1MV8 A;  5DJT B;  3O6Q B;  4KJM A;  5L8R J;  1L4A D;  1NTK G;  1ZR4 A;  2XZ0 D;  1GL2 B;  3RGU A;  3L72 E;  2E75 B;  5APQ A;  4M3L A;  4MN4 C;  5AVR B;  2YMY A;  1P84 I;  1GW4 A;  2KSE A;  2HR3 A;  5KJ7 C;  2JWA A;  3II6 A;  3L73 E;  1IFN A;  1PPJ E;  3CPW O;  4AQR D;  4H2X C;  5JPA A;  1N86 A;  1X79 B;  1HQB A;  3HUS B;  1IFI A;  2W90 A;  1OVV A;  1JTH B;  1NKN A;  1FZC B;  2DNW A;  3P05 A;  1F80 D;  4NPE A;  1N2D C;  3BCC G;  1VHN A;  2XV5 A;  1NTK E;  3H1J J;  1M6N A;  1KB9 E;  2OTK E;  3PHL A;  4C7R A;  1KFN A;  1S4X A;  1LT9 B;  2PEK A;  1FOS E;  2CG5 B;  3KYQ A;  1JY3 P;  1SQV G;  1S9K D;  4U3F G;  4NPD A;  2IX7 C;  2W6A A;  2P10 A;  1L0L G;  3MP7 B;  1EQ7 A;  3H1K J;  4Y99 B;  1IC2 A;  2KP8 A;  2GUS A;  3KHU A;  1LTJ B;  1URQ C;  2RN0 A;  4CPG A;  1DEE G;  2LIW A;  2B87 B;  3U43 A;  5B66 E;  4TT3 H;  1NTM D;  2ROQ A;  2LPK A;  2M0B A;  2JQ4 A;  3BCC E;  1JCC A;  2XU6 A;  2FYN C;  2BCC G;  1T3U A;  2HOD B;  1FDO A;  1K9M Q;  2WWW A;  4PJ0 H;  1SQV E;  1KQL A;  4U3F E;  3CMA P;  2EIA A;  1L0L E;  5F2O A;  2H8P D;  1GU4 A;  3MGE A;  1PEU A;  1OVR A;  2IBZ I;  1G1I A;  1MZ8 A;  4YPC A;  1KYO D;  2J5U A;  2EHT A;  4WYM A;  4LC1 A;  3QWO C;  3TDK A;  3H1L G;  2BCC E;  3CXH I;  4PD4 D;  3V2Q A;  2FAE A;  1IJD B;  4C46 A;  1A02 J;  3DS3 A;  3V5B A;  1NU1 J;  2B89 A;  5KKZ C;  3SSU A;  1IMQ A;  1KYO E;  1M90 Q;  1URQ B;  2N1T D;  1FZG A;  1JY2 N;  3IFM A;  2FY8 A;  3TK1 A;  2NRG A;  3FGA D;  1ZP0 C;  3ZDM A;  2EHS A;  1LJ2 A;  1NGM B;  3L71 J;  2WSC H;  2RMZ A;  3H1L E;  1HBW A;  1KV4 A;  3W67 A;  2Y0E A;  4IFF A;  1VQN P;  2K0X A;  3AE3 C;  3H1I J;  4EIJ A;  3M9B A;  1E5W A;  1CEI A;  4I6M C;  3I5C A;  2GDX A;  1DEB A;  2KOS A;  1ZRT D;  4H13 D;  2LIU A;  2AEM A;  1K73 Q;  1JY2 O;  4YXD C;  2ZT9 D;  1QGK B;  1OX3 A;  2Z4E A;  4XFJ A;  1J1E C;  4ZMD A;  4PWV B;  2QJK B;  2XND H;  2Z5H A;  1GZL A;  3CCR P;  2YKO A;  3N4X A;  2QJY C;  4ASW A;  3HD7 B;  3RK2 D;  1VQ7 P;  5K5G B;  3P8C E;  1SVF A;  1FU1 A;  2ZJS E;  1SQB G;  4U0B A;  1JOC A;  3H1J G;  3GF3 A;  2CPS A;  3A0H E;  3RG2 A;  2K1A A;  4H13 B;  5APV A;  1HJ0 A;  1NOH A;  1SQB D;  1USE A;  3VOP A;  3A3Y B;  1SFC B;  4TLF A;  2WSC J;  5BS2 A;  1JJ2 O;  2JU2 A;  1KFM A;  1AVY A;  2RKL A;  1NTM K;  1T8Z A;  2WSS H;  2R32 A;  3WU2 H;  3AEE C;  4GKG A;  2VRS A;  3B5N A;  1AVO A;  3CX5 I;  3T97 A;  3H1J E;  2R3S A;  4PV1 D;  2GZF A;  2AXT H;  5EFW B;  3OA7 A;  2M3B A;  3H1K E;  1T8K A;  2OTL P;  3JCU H;  2FQ1 A;  2OGU A;  5KAF H;  3DS4 A;  2AFE A;  1JCD A;  2FFD A;  2W83 C;  3NFQ A;  2XKM A;  2KWL A;  1M74 A;  2QEX P;  2Q9I A;  2IYP A;  4F37 A;  2WIT A;  3CWB J;  3AEC C;  3EJE A;  1E6J P;  5HGN A;  1WMK A;  3CL3 D;  2MJZ A;  3CXC O;  1IFJ A;  1JMB A;  3Q20 A;  1YJW P;  1NU1 G;  1EZV G;  3CLQ A;  3S4R A;  2JR8 A;  3MUD A;  1BDC A;  1EDK A;  1ZR2 A;  4D6T J;  1GXH A;  2VLP A;  2LKM A;  1QVF O;  1KQG B;  1QRJ A;  1EDI A;  3H1I G;  3JC2 2;  4I1L A;  2ERH A;  1PGO A;  3GZM A;  1NU1 E;  2WPQ A;  2VLQ A;  1EZV E;  5APU A;  2OQQ A;  3PH0 A;  1AV1 A;  2KOO A;  2E76 C;  3H25 A;  2V7Q J;  2C0W A;  3V6I A;  3AE2 C;  1KIL B;  2OYH A;  4H0L C;  3B5N C;  2FQ2 A;  2E74 C;  5BU5 A;  2GYK A;  2MD9 A;  2XXM A;  3D6Y A;  2PEM A;  3H32 A;  2MVU A;  4PJ0 E;  3H1I E;  2PEN A;  1AYI A;  3O6Q A;  1W2E A;  1VKU A;  3NTN A;  2KNC B;  3VMY A;  4OH8 B;  1SQX D;  2FFD C;  1SQB K;  1BE3 J;  3LID A;  1QLE D;  2KGA A;  2YKP A;  2Q6Q A;  4C7N B;  4LLH A;  2VLN A;  1RF0 A;  3I55 P;  1Y47 A;  5DCK A;  1SQP J;  2DW3 A;  2AFD A;  2YKQ A;  2PEQ A;  2FXO A;  3IN6 A;  2O1J A;  1AQT A;  2A06 D;  4EDF A;  4B86 A;  2KYV A;  2E5T A;  1Q82 Q;  4IPY A;  2GDY A;  1FZC A;  4HKG A;  1J2J B;  2O01 H;  1KYO I;  5B5E H;  2ZFC A;  3CE7 A;  5C39 A;  1XTC C;  3MIW A;  3MUD C;  3PJS K;  4PD4 I;  2XDJ A;  1GK6 A;  1PP9 J;  2E76 B;  2QJP C;  2KOG A;  2WPS A;  1VQL P;  1FE6 A;  4BRY A;  1LWU C;  3G0V A;  2JEE A;  2FYU J;  5GTH H;  1IZN B;  1LTJ A;  1PEM A;  2IZ1 A;  1VF5 D;  3HTK B;  2QNW A;  4GDO A;  2B87 A;  2CWO A;  2FQ0 A;  1RE4 A;  1NTZ D;  2G8Y A;  5KLV J;  5CBN A;  1VQ4 P;  4L76 A;  1BSH A;  4GIF A;  2KG6 A;  2HOD A;  3WUU A;  2IYO A;  4N3Y B;  2FFD B;  3V2R A;  3M1M A;  2L9F A;  2OYH C;  3FX0 A;  4OGQ B;  4MRT C;  2P67 A;  3V4W A;  2M3E A;  1EDJ A;  1PGP A;  3U1A A;  2WSE J;  4HH2 A;  2R5D A;  3Q2Y A;  1OZH A;  5AW7 B;  3NMD A;  4UB8 H;  3Q5S A;  3CC2 P;  3NY7 B;  4D6T G;  4OVN F;  3QH9 A;  1CI6 B;  3ITK A;  2XNX A;  2K88 A;  1T6A A;  1N73 B;  2KZJ A;  5AW2 B;  5APT A;  1FJP A;  2QJP B;  2KLU A;  1RF0 C;  2L4B A;  2VLO A;  3L75 J;  4JQ0 D;  1ZOY C;  3D70 A;  3IAO A;  3WBH A;  1G2C A;  1FZC C;  5HV8 A;  5AVS B;  2QIW A;  5KTB A;  2K93 A;  3L74 J;  3WU2 E;  1NQ4 A;  4D6T E;  1PEQ A;  2KS1 B;  4GOF A;  1OIP A;  1IMP A;  1LT9 C;  1A8O A;  4JPZ B;  1YYC A;  2AXT E;  1NVO A;  1HUC A;  4N6J A;  1EOQ A;  3TGU G;  3L72 D;  4Y99 C;  1SQX K;  1LGH B;  1LTJ C;  1JNM A;  1HGV A;  3JCU E;  1PPJ G;  5KAF E;  1HJB A;  2M8R A;  3H32 B;  2QM7 A;  2ZVO B;  1BE3 G;  1RE4 C;  1CZQ A;  1GPJ A;  3VYI A;  3L73 D;  5GTI H;  3DS2 A;  1PPJ D;  4BPG A;  1SQP G;  1D7M A;  1GMJ A;  5APX A;  1KC8 Q;  3HD7 A;  1KMI Z;  3TGU E;  1NTK D;  3B71 A;  3CCU P;  1KB9 D;  4RJT A;  3BAT A;  3RL0 D;  2XV6 A;  3GHG B;  2YO2 A;  3G3Z A;  2HG5 D;  1BE3 E;  1PP9 G;  3HRN A;  1FDM A;  2FVA A;  2Y9Z A;  3H47 A;  1SFC A;  1SQP E;  3G29 A;  2KZI A;  2CGQ A;  1L4A B;  2A45 I;  1OMI A;  2J59 M;  3L36 A;  2K94 A;  3RK3 D;  5CCH D;  1P84 H;  2CNR A;  1FBM A;  3CD6 P;  1EZV I;  3BCC D;  1NTZ K;  1BAJ A;  1MUU A;  2NPS D;  3VMZ A;  4DT0 A;  5KLV G;  4BRY B;  1ACP A;  3VTP C;  2I8D A;  1BCC G;  1SQV D;  5AW8 B;  4EOT A;  4U3F D;  2GUV A;  1PP9 E;  1Q90 D;  1L0L D;  3RG6 C;  1VQ8 P;  2FYZ A;  3MGN A;  3RK3 E;  3UIA A;  4JF7 A;  3P32 A;  5AW1 B;  1G1J A;  1QL2 A;  5CJ0 A;  2FYU E;  2Q5U A;  1L0N G;  5KJ7 D;  3AEA C;  1HTL C;  3KDP B;  3E1I A;  1EDL A;  2WPV B;  2QVA A;  1M56 D;  2POH A;  1LNQ A;  2QG4 A;  3W68 A;  1QX8 A;  5KLV E;  2BCC D;  4Y28 J;  4UB6 H;  4HYT B;  1BCC E;  2R3C A;  1JEK A;  2KR5 A;  1JY3 N;  3GF7 A;  1VQ6 P;  4K3A A;  1ZNV A;  1SLQ A;  1S1C X;  2AXC A;  3L75 G;  3G21 A;  3M0D A;  2QJK C;  4U0D A;  5F2K A;  1RH5 B;  1KQF B;  1L0N E;  1K05 A;  2WT7 B;  5CHX A;  3HD7 C;  2JO1 A;  3PRJ A;  4HJG H;  3L74 G;  1HY8 A;  3H1L D;  4R4L A;  4GR6 A;  1JB0 J;  5B5E E;  4BPF A;  1ZMB A;  1LTS C;  2H43 A;  1RF1 B;  4H13 C;  5AW6 B;  1G2C B;  3Q1M A;  3G4S P;  3CCM P;  2Q3E A;  1EC5 A;  4H44 D;  1SFC C;  3L75 E;  1AUM A;  5GTH E;  3CXH H;  1MKM A;  1BDD A;  1IFD A;  3RBX A;  1SQQ J;  2OYI A;  1FR2 A;  3AED C;  2HPC B;  3L74 E;  1LT1 A;  1KIL A;  4DZO A;  2C9L Y;  2LOL A;  3KQG A;  4IZ6 A;  2K9J B;  2YIU C;  1YBK A;  3P8C D;  4OWF A;  2N1T B;  1NTK K;  2N9Y B;  4COP A;  4XA4 A;  4HB1 A;  1DH3 A;  3E7K A;  4WWI A;  1N7S D;  2WPT A;  2KNC A;  3H1H J;  4UB8 E;  1KD1 Q;  3CC7 P;  1T2K C;  5CCG A;  2IFN A;  4C7N A;  2ZXE B;  3GJN A;  3B4S A;  1BGY J;  4XFX A;  1N8R Q;  4PH1 A;  1GW3 A;  2P7J A;  2YXR B;  3H1J D;  2ZT9 B;  3M0D C;  1SQX J;  2WZ7 A;  4H2Y C;  1VPC A;  3H1K G;  1SQV K;  1PGJ A;  3CI9 A;  1L0L K;  2EFJ A;  2I1K A;  3CCQ P;  5HGL A;  3H1K D;  3RK2 B;  3BRV B;  1ZXG A;  4ZNC A;  3Q3D A;  3MD0 A;  3OW2 O;  3WUT A;  3TNU B;  2YIU B;  3HTK A;  3DS1 A;  1OXZ A;  3WMM 0;  3TF5 A;  2D2C D;  1PIX A;  2OYI C;  1D1D A;  1KIL C;  2V7Q H;  1X0T A;  2N98 A;  2R44 A;  7CEI A;  5APY A;  1W2B O;  5GTI E;  3CX5 H;  3AE5 C;  1T3J A;  2QE7 H;  4PV1 B;  4W80 A;  2XZR A;  1HF9 A;  1IUQ A;  2XZ1 C;  1LTT C;  2H7H A;  5TIS H;  2NO8 A;  3HE4 A;  2Z44 A;  3CC4 P;  3U1C A;  2D2C B;  3VRL C;  1WT6 A;  2MVV A;  1ZME C;  3LMO A;  1E0H A;  1CI6 A;  1R8E A;  1N73 A;  5F2N A;  1NU1 D;  1KB9 I;  1EZV D;  5CCG C;  2FXM A;  5AVY B;  1GXG A;  2L6E A;  3GLM A;  1OVU A;  2JB0 A;  2P9X A;  1SQQ G;  3L71 G;  2PGD A;  2KGD A;  1P84 E;  3E1R A;  2P1J A;  4KHX A;  3VN0 A;  1HWT C;  3D6Z A;  1LP1 B;  3HE5 B;  2QRX A;  1M1K Q;  3CCE P;  1Q81 Q;  2KS1 A;  3H1I D;  2OYI B;  2JWD A;  2JKV A;  3N7N A;  4IOI H;  1SS1 A;  1IK7 A;  4IFD K;  2L22 A;  1J1D B;  2AVA A;  5CJ4 A;  1M7L A;  1PL5 A;  1YIT P;  1SQQ E;  1M8O B;  5EW5 E;  3L71 E;  1KIL E;  3H1H G;  2E5Y A;  3PP5 A;  2KOQ A;  1NHL A;  4PXH B;  4DG9 A;  3V2N A;  3R4Y A;  3L70 J;  1LTI C;  3KZI H;  3M0A A;  1RY3 A;  1GDT A;  1BGY G;  4UB6 E;  1GU5 A;  1BSN A;  1ZLL A;  1W5C E;  4RKU J;  2AEJ A;  1RO2 A;  4GT1 A;  3L72 J;  4OGQ C;  1EXJ A;  4JYC A;  2KOP A;  3A5T A;  1JM0 A;  3GKL C;  1FJK A;  2WSE H;  3GHG A;  2WPR A;  3H1H E;  1UJZ A;  4ASV A;  1L2P A;  3L73 J;  2Y0C A;  3WUV A;  5AVU B;  1YJN P;  2O01 N;  3EFG A;  3G28 A;  1NYH A;  2FAD A;  3GMA A;  1BGY E;  2JAZ A;  2N6Z A;  1L4A A;  1VDF A;  2ZVN B;  3B5N D;  1Q2N A;  4H0L D;  1N73 C;  4IFM A;  2E74 D;  1NH4 A;  1M1J A;  4XRO A;  2B9B A;  2KG8 A;  4IL6 X;  4GR2 A;  3CXH E;  3CCL P;  1QL1 A;  1OW8 A;  5H2F H;  1KTM A;  3GZL A;  2K37 A;  2MF4 A;  1H0T B;  2YO3 A;  3GW6 A;  1X9V A;  1K8A Q;  4N78 E;  3ABV C;  2G3A A;  1MFZ A;  2W6J H;  1L0I A;  1FS0 E;  4PD4 H;  1H8A A;  3VP8 A;  1IFM A;  4UHP B;  3EWK A;  4GOD A;  5CCH A;  2GZE A;  2EG5 A;  1DD4 A;  3CWB G;  2M8N A;  2M5R A;  3DS5 A;  2KI7 B;  3DPH A;  5AVV B;  2NPS A;  1RNI A;  1SQV J;  3FXD A;  5KP7 B;  1L0L J;  2LL8 A;  4Z1M H;  3VMX A;  2KXP B;  4U7J A;  2FVE A;  3AE7 C;  3G6E P;  1NTM J;  1NU1 K;  2NZ2 A;  1SP4 A;  1VF5 B;  3HE4 B;  2KUB A;  1EXI A;  5DJU B;  3C8V A;  2QM8 A;  2WT7 A;  1UNK A;  2X2B A;  3CWB E;  4D6T D;  3FWN A;  1UIX A;  3NTE A;  1YJ9 P;  1EMV A;  4ZKU A;  1ZV8 A;  3GHG C;  1OW7 A;  1PEO A;  2I1J A;  4U0C A;  3K5B A;  1RF1 A;  1VL2 A;  4CA3 A;  1KLP A;  4DJG A;  4IL6 H;  1KOR A;  2M8L A;  3NXS A;  1RHZ B;  3AE9 C;  1L4A C;  2M5A A;  5I4T G;  2JJL A;  3A0B H;  1CW5 A;  4WY4 D;  1M1J C;  4U0E A;  3H1L J;  1VQO P;  2HPC A;  3B5I A;  2L0Q A;  1HGZ A;  3L70 G;  3O8Z A;  4BWN A;  1X8Y A;  2GM4 A;  1RE3 A;  3RL0 C;  2PY8 A;  1LTA C;  1JMM A;  1JO5 A;  2QA4 P;  3AE4 C;  2K2Q A;  3M9Q A;  3TGU D;  2K9J A;  2ZYA A;  5AW5 B;  1GL2 D;  1NAF A;  2E75 D;  2N1T A;  2PEO A;  2PNG A;  3E2D A;  3CX5 E;  1RQU A;  2YMK A;  1Z6M A;  1IK9 A;  1FAV A;  2Y0D A;  2Z45 A;  3G71 P;  1BE3 D;  4XRQ A;  4PH0 A;  1MFT A;  2CK3 H;  4M0I A;  5HGO A;  1E79 H;  3SFE C;  1SQP D;  2KGC A;  2NPS C;  5TIS E;  3L70 E;  3PTZ A;  4YTP C;  3OAK A;  1MZ9 A;  2FAC A;  3BRT B;  3M06 A;  3S9O A;  1FOS F;  4RES B;  4YXW H;  1U7J A;  3RL0 g;  2P58 A;  2HYN A;  1NJI Q;  1PP9 D;  2PEJ A;  2FYU G;  1N7S A;  3DS0 A;  1X3O A;  1YIJ P;  1M1J B;  2FYU D;  2SPZ A;  3F89 A;  5AVT B;  1A43 A;  3GG2 A;  2Q7C A;  1M6E X;  3RL0 B;  4QNB A;  1RF1 C;  5AVW B;  3OJA B;  3SWK A;  3PLN A;  1SQB J;  3TNU A;  5KLV D;  2MY5 A;  2R5B A;  2KW2 A;  3SFD C;  1BCC D;  2KGE A;  2A45 H;  3V4Q A;  2DGY A;  2K3R A;  1UII A;  2N9B A;  2K9Y A;  2BQ1 E;  3RK3 B;  1NTM G;  4K35 A;  2CQ8 A;  1RE3 C;  1L0N D;  2NPS B;  3R2P A;  3KZI E;  4AYC A;  2GZG A;  2K92 A;  4NPF X;  4LGD E;  5AW0 B;  2W27 A;  1S9K E;  1S2E A;  3BAS A;  2N1T C;  2L91 A;  2MKV A;  3U59 A;  4H44 C;  1S5L X;  1QEX A;  4U0A A;  1JY2 P;  2AF8 A;  1IFP A;  3F5H A;  3S1K A;  3EQ2 A;  1GK4 A;  1NTM E;  1LTG C;  3L75 D;  1URQ D;  5KLI C;  1NWQ A;  4XFZ A;  5KP8 B;  1KN7 A;  2PAJ A;  1USD A;  1VQ9 P;  1AQ5 A;  3L74 D;  2QSI A;  1JY3 O;  2W8Z A;  2ZT9 C;  1GD2 E;  1LP1 A;  3HE5 A;  2IFM A;  2M5A B;  1N7S C;  5H2F E;  2PRR A;  2ZYD A;  1U57 A;  3P7K A;  3RK2 C;  2N50 A;  4WBA A;  1OFC X;  2N5H A;  2JYL A;  4GOE A;  2BUO A;  1FZE A;  4PD4 E;  1H88 A;  5AW4 B;  5BS1 A;  2K0D X;  1DX7 A;  3CCS P;  2FKW B;  4O9B A;  1AFO A;  1LTB C;  3KPE A;  1SQP K;  4R4M A;  4WB4 A;  1Q86 Q;  2FYN B;  2O3J A;  3G9R A;  3HD7 D;  2V4H A;  4H44 B;  2OAR A;  4DCK A;  4L73 A;  3A7O A;  1YTZ T;  1N7L A;  3C1L A;  2WSF H;  1S5L H;  5KAI H;  2C0X A;  4EYY Q;  2KOD A;  2XT1 A;  2KB7 P;  5KLI B;  4PV1 C;  3LW5 H;  1SFC D;  2FHS C;  2LKI A;  5APW A;  3TYY A;  2C9N Y;  2FYU K;  3CCJ P;  1QVG O;  4L74 A;  2D2C C;  3EFF K;  1NKZ B;  2WTY A;  2KK7 A;  1NO4 A;  1ZRT E;  2O1K A;  4XE5 B;  1DD3 A;  1N7S B;  2IZ0 A;  5KLV K;  1Y8A A;  4IL6 E;  5APS A;  1YI2 P;  1KQS O;  5KKZ B;  2FBW C;  4W7Z A;  2H89 C;  3Q5P A;  2PP6 A;  4XFY A;  3EJB A;  1AJY A;  3A0B E;  2MR7 A;  3LIE A;  2AEF A;  3CME P;  1TU3 F;  2BEQ D;  2GZI A;  1L0N K;  2ONT A;  5CMZ A;  1H0T A;  3FWL A;  1VQ5 P;  2L5G B;  2GDW A;  1NAY A;  1RQV A;  2J58 A;  2K0Y A;  1T2K D;  2WQY C;  1L0H A;  1SQB E;  2WSF J;  3VMA A;  5E79 H; 
#chains in the Genus database with same CATH homology
 3G28 A;  1KD1 Q;  2M8L A;  1YHQ P;  5BS1 A;  3CC7 P;  3LRY A;  5F2N A;  3CCS P;  2M8P A;  2CWO A;  5I4T G;  5BS2 A;  1JJ2 O;  3DS3 A;  3H4E A;  2JYG A;  1Q86 Q;  1VQ4 P;  1S72 P;  3CPW O;  3G1G A;  4XRO A;  2DGY A;  3DS2 A;  2L6E A;  5JPA A;  1VQ6 P;  4XFX A;  2OAR A;  4U0E A;  2BQ1 E;  2P9X A;  1RO0 A;  1N8R Q;  1VQO P;  3B5I A;  3G21 A;  4GR2 A;  3M1M A;  4PH1 A;  1M90 Q;  4U0D A;  3CCL P;  3P05 A;  2JO0 A;  2PEI A;  5F2K A;  2PY8 A;  1KC8 Q;  1VQK P;  2QA4 P;  3G26 A;  1M6N A;  2XXM A;  2PEM A;  4COC A;  3CCU P;  1M1K Q;  3CCE P;  2KOD A;  2XT1 A;  2EFJ A;  1Q81 Q;  2PEK A;  3CCQ P;  1K8A Q;  2PEO A;  3HYB A;  2XV6 A;  2BHV A;  2PEN A;  3E2D A;  4GR6 A;  1EIA A;  5HGL A;  3I56 P;  1ZMB A;  3H0D A;  2OTL P;  3CC2 P;  1VQN P;  2Z45 A;  3DS4 A;  3G71 P;  4XRQ A;  2EG5 A;  4PH0 A;  2M8N A;  4U0A A;  3CCJ P;  3G4S P;  1QVG O;  3DS5 A;  3CCM P;  2LF4 A;  1M74 A;  4M0I A;  3H47 A;  3OW2 O;  3DPH A;  4U0F A;  1RNI A;  3G29 A;  1YIT P;  1K30 A;  5HGO A;  2QEX P;  1Q7Y Q;  3DS1 A;  2Z46 A;  1AUM A;  1K73 Q;  3I55 P;  3HZQ A;  5DCK A;  3G1I A;  1YI2 P;  1KQS O;  3CD6 P;  2PEQ A;  1BAJ A;  3G6E P;  4XFZ A;  1E6J P;  5HGN A;  1VQ9 P;  3CXC O;  1K9M Q;  4XFY A;  4IPY A;  3CCR P;  3WBH A;  1Q82 Q;  1D1D A;  3Q20 A;  1VQP P;  1YJW P;  2E1M A;  3CMA P;  1W2B O;  2EIA A;  1RO2 A;  5HGM A;  5F2O A;  3DTJ A;  1VQ7 P;  1NJI Q;  3RG6 C;  2PEJ A;  1VQ8 P;  3CME P;  2OTJ P;  1PEQ A;  2ONT A;  3DS0 A;  3MGE A;  3NTE A;  1YJ9 P;  4U0B A;  4COP A;  1VQ5 P;  3CCV P;  1PEU A;  1YIJ P;  1VQM P;  1A8O A;  1IUQ A;  1VQL P;  3G0V A;  1EOQ A;  1A43 A;  1QVF O;  1PEO A;  2JYL A;  1M6E X;  2Z44 A;  4U0C A;  3CC4 P;  1QRJ A;  1YJN P;  3VRL C;  4QNB A;  2BUO A;  4WYM A;  1PEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...