1VQOP

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqoP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqoP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqoP02
1Q81Q 1VQ4P 1QVFO 1N8RQ 3CMAP 1YI2P 1VQ7P 1K8AQ 3CCUP 1VQ5P 1Q82Q 3CCSP 1KD1Q 1YIJP 2QEXP 1K9MQ 3G6EP 1M1KQ 3CCVP 3G71P 1YITP 1S72P 1VQ9P 1NJIQ 3CCLP 1KQSO 2OTJP 1Q86Q 3CMEP 1YJWP 1KC8Q 3CC4P 3I56P 1VQOP 1YJNP 3I55P 1M90Q 1VQLP 3CC2P 3CCEP 1YHQP 3CD6P 3CCQP 3OW2O 1W2BO 3CXCO 3CC7P 1VQPP 1VQMP 3CCMP 1YJ9P 1Q7YQ 1QVGO 1VQ8P 1VQKP 3CPWO 1VQ6P 1K73Q 1JJ2O 3G4SP 1VQNP 3CCRP 2OTLP 3CCJP 2QA4P
chains in the Genus database with same CATH superfamily
1PGPA 3HUSB 3BCCJ 1PGOA 1SFCA 3NXSA 3L71G 2EHSA 2LMLA 3H1JJ 1FR2A 2A06G 2IBZE 1AA0A 5KKZC 5GTHH 4PV1C 2AXTE 3RL0g 1YJ9P 1Q7YQ 5AVTB 3USSA 1SFCB 4H44C 2O01H 3BATA 5EW5E 3JC22 3NY7B 5K5GB 5H2FE 2K0DX 5CCHD 2Z46A 5HV8A 1EC5A 1N7SC 1IFIA 2AVAA 2V7QJ 1M74A 1LWUA 1M90Q 3AEGC 3CCQP 3RL0B 5TISH 1G2CA 2L0QA 4EYYQ 2N1TC 2FFDC 3JCUE 2WPTA 1LWUB 2X2BA 1LTJB 2I1JA 3L74G 3G26A 2ZYDA 1ZMEC 1G2CB 1GL2A 3CCEP 1KQFB 2IYPA 1FZFA 1Y8AA 2Q3EA 3C9IA 3G21A 4IPYA 1GL2B 2NZ2A 1HUCA 1W2EA 5HGOA 1U7MA 2LR2A 2AFEA 1BCCD 5L8RJ 3D70A 2WITA 1BDCA 3H6PA 1JCDA 3GLMA 1MKMA 1H88A 2M0BA 3IAOA 4N78D 1RF1B 3AE7C 4JBZA 3VYIA 1CEIA 3PHLA 3V2PA 1ZMBA 2PEQA 2P10A 2ONTA 3RBXA 2NPSC 1A8OA 1NTZK 1Q86Q 2W27A 2K3RA 1HF9A 2PFXA 1VQOP 1FS0E 2MY5A 5BU8B 2LXBA 1AQTA 3F89A 1VF5B 2WMMA 1QVGO 2KUBA 3AEFC 5AVSB 2OYIA 3G1IA 2E75C 2FQ1A 3L75D 1JM0A 3CWBD 4JPZB 4GR2A 3H1LJ 1X22A 1KILC 2L5GB 2RH0A 2OYIB 3AECC 3H1KD 1LT9A 3PRJA 1OR5A 1T3JA 2M5RA 3G28A 3L70D 3H47A 5CCHA 2Q6QA 1LT9B 1NTMJ 4OGQC 4U0FA 2OYHB 1SS1A 1OX3A 2LIUA 2VSQA 2OTKE 1WRGA 3H1IE 3M0DC 4L74A 3RK3C 3DS5A 2FQ2A 2CWOA 2KIKA 1SQPJ 2IBZI 2IBZD 1NTZG 5H2FH 1NYHA 2HG5D 2JQ4A 1KORA 3G3ZA 1VQNP 3GHGA 4PXHB 4HKGA 2WPQA 2CK3H 2ZYAA 3WUUA 1K30A 5I4TG 1ZN5A 3NTEA 1BGYE 2GDXA 3H32A 1KV4A 4W7ZA 4IZ6A 2WQYC 1NTKJ 3G29A 1KFMA 3GHGB 1M1JC 1VQPP 3GF7A 3RBZA 1RF0C 5AW2B 2FAEA 1U57A 2K92A 2KG8A 4AUWA 4CPGA 1FAVA 1Q90D 1ZRTD 2B87B 4Y99C 2FY8A 2C9LY 3JSVC 3SFEC 3L35A 1JMMA 3CXHE 1AQ5A 2WPVB 3MUDA 5KLIB 2FKWB 5KAFH 1Y9BA 4PD4H 3OJAB 2LKIA 3AE5C 2FHSC 1RHZB 1R8EA 3CCJP 2QM8A 1OXZA 1HGZA 2JO1A 2Z45A 1S5LE 1GMJA 4UB8E 2POHA 1H8AA 2H43A 4PWVB 2E43A 4U3FG 4WWIA 4QMAA 4IL6H 3M91A 2R32A 1KB9H 2ZT9D 1GD2E 2K94A 1BSHA 1KD1Q 3KQGA 4K3AA 4TLFA 2M5AA 1IZNB 1MZ9A 4R0MA 1PZQA 2XZRA 2SPZA 2N9YB 1OVVA 1KILE 2M5AB 5APXA 1BSNA 2HYNA 1ZR2A 1DNYA 4HJGH 4IFDK 2KW2A 2J59M 2L22A 3I55P 2HPCA 3SWFA 3HYBA 1PPJG 5AW1B 5AW0B 2D2CC 1P84H 2FYUK 4DCKA 1YTZT 2ZJSE 3ZDMA 2MR8A 1L0NE 1R5LA 2RN0A 2O01N 3RK3E 2HPCB 1SQXJ 2LF4A 1SQQG 2BCCG 1SQQJ 3VMYA 1PIXA 2KZJA 1VQMP 2ZXXA 2XZ1C 3H1ID 5HGMA 3U43A 2M3EA 3EJDA 1EZVE 4YXDC 2GZEA 1KYOE 4NPDA 3Q3DA 1N7SD 2QJYB 3CLQA 4H2YC 1NAYA 3AEAC 2YKPA 1YJNP 1BGYD 3QH9A 2Z5IA 4BPGA 2N1TD 1DD3A 1FZEA 2KI7B 2YMYA 3IR9A 5TJHA 3WUTA 2FBWC 2EHTA 2E74D 1BAJA 4XFZA 4Y28J 2FYUG 2ZYGA 1YITP 2FYUJ 3CCLP 2DW3A 2ZXEB 1MV8A 3TGUG 1SQBK 1AVYA 2KYVA 3HTKA 1GU4A 1SQVK 3CXHI 1PP9E 3CXHD 2PEMA 1IMQA 4D6TE 2KNCB 3MZWB 2HLOA 3HTKB 3M9QA 2BASA 3SWKA 2YO2A 5APVA 3H1HE 5E79H 3KYQA 2PNGA 5F2OA 2MF4A 3CI9A 1RY3A 1OWAA 4YPCA 3M1MA 1FZAA 1X9VA 1FZCC 1NVOA 3S1KA 1VQ4P 3RK2C 4M3LA 1IFPA 4GDOA 2QRXA 2NPSD 1F80D 2FACA 3L73D 3SFDC 4COCA 2XNDH 3DS0A 1FBMA 1UNKA 3E7KA 4UB6E 1SQVG 5BVZA 2A45I 4AYCA 5KLVD 3V5BA 1J1EB 1KILD 2Z4EA 2JO0A 1OVRA 1FU1A 3MD0A 4IFMA 5AW4B 1NU1G 1GZLA 1MFTA 2DGYA 1EDIA 5KKZB 1NU1J 4PV1B 1N7SA 4H44B 1GU5A 1BCCE 4OGQD 4RO0A 5F2KA 2LTEA 5AW8B 3L4FA 3RK3D 2XDJA 1N7SB 2N1TA 2FFDA 1N7LA 2K0XA 3VMAA 2KS1A 3AE8C 1HGVA 2K9YA 3BRTB 3C8VA 1OIPA 3L36A 2W6AA 2K9JA 2LXCB 2FADA 2BEQD 1G1JA 3AEBC 2N1TB 3L72G 1CZQA 1EZVI 2I8DA 1EZVD 2KS1B 1J2JB 3L72J 1Q82Q 3KZIE 1N2DC 5APTA 1KYOI 2YIUC 1KYOD 2K9JB 2VRSA 2CQ8A 1KLPA 3L75J 3CWBJ 1EDJA 3HD7C 2KK7A 5HGNA 2Y0DA 2PEJA 5AVVB 2PEIA 1IFJA 1LGHB 2JB0A 1RH5B 3AE2C 5CHXA 2IX7C 1QL1A 3H1KE 2WWWA 3A0HH 1URQC 2WPRA 3L70J 2QJKB 3O6QA 1HH0A 4JYBA 5AVRB 3V4WA 3P8MC 2GUSA 1PP9D 2NPSA 3BCCG 1LTBC 2MR7A 3O6QB 1FC2C 4D6TD 1L4AC 3H1JG 4GT1A 1NKNA 1KZUB 3CC4P 3I56P 3B5NC 2NPSB 2QE7H 2E5TA 3H1HD 1BE3E 1RNIA 5KP8B 4L73A 1KILA 5GTIH 2KGEA 2MVVA 1GPJA 1RE4C 2YKQA 4GIFA 1AJYA 1GXGA 2E75B 5AVYB 5CCGC 2KG9A 3M9HA 2XU6A 1KC8Q 3L71E 4PJ0E 4W7YA 1M56D 4U0AA 4KHXA 3WUVA 2A06E 3CCMP 1DH3A 2K88A 1JY3N 3AE6C 3VMZA 1ZRTE 1L0LK 1Q81Q 1H89A 4DZOA 2HODA 4BRYA 1LP1A 3M0DA 1H0TA 1NO4A 2E74C 4PH1A 2ZFCA 3CCVP 3P8CD 2EIAA 1LTTC 1ZW0A 1D1DA 1IFDA 2BEZF 1YHQP 4BRYB 5B5EH 2D2CD 2M8NA 3RK3B 2J5UA 1M8OB 2M8LA 4UHPB 2N5HA 1SQBD 5B66H 1IFMA 1K9MQ 3FGAD 1M1JA 1VQ9P 2O1JA 3A7OA 4BXLA 3CL3D 5DJUB 3L74E 1RF0A 1VQLP 2GA1A 3Q5PA 2WSCJ 2H88C 1NTMK 4HB1A 1M1JB 4TT3H 4YTPC 5HVCA 2FYNC 1LJ2A 1X8YA 3D6ZA 4LLHA 3W68A 2Z44A 1NWQA 1SQPK 1L0LG 2B89A 1S72P 3CMEP 1L0LJ 2FXMA 4Y99B 1Z56A 1PL5A 1MFZA 3SSUA 4B86A 1QEXA 1NGMB 3VOPA 3G1GA 3QWOC 3HUSC 2KSEA 2AEFA 3WMM0 2NRGA 2KOGA 5BU5A 3S9OA 1NTKK 2LL8A 3H1LG 1S4XA 3BVHA 3CX5E 1GW4A 4ASWA 3GZMA 1G1IA 2K1AA 4H13C 2ZAEB 1M6NA 2E1MA 2BQ1E 1EXIA 3GZLA 3CC7P 2XXMA 1FDOA 1PEOA 5AVZB 1AVOA 2XV5A 1NTMG 3DS1A 2ZVNB 5APQA 2CPSA 2KZIA 2I1KA 1K05A 3H1IJ 1VPCA 2AXTH 1UIIA 1N73C 1SQPG 1CW5A 1AF8A 3LW5J 2MVUA 3PP5A 5C39A 2R3SA 1IK7A 1LTJC 1RO0A 1CSBA 3RK2D 1AYIA 1BE3D 1KFNA 1KQGB 2PENA 4I6MC 1BGYJ 1SP4A 4NPEA 1UIXA 1NTKG 2W6JH 1OW8A 2OYOA 5BS1A 1UJZA 4GODA 3FXDA 3JCUH 1LNQA 1JY3P 3L71D 2YMKA 2KR5A 2O3JA 4XFYA 3AE4C 1QRJA 2J58A 2A06D 3H32B 1NTZE 2D2CB 3GW6A 1LTSC 4WVZA 5KAIE 1X0TA 5AVWB 1M7LA 1QLED 3II6A 4HH2A 2JYGA 2M8PA 4I1LA 3DPHA 2P2UA 4C7NA 3Q2YA 1JTHA 3IFMA 2EG5A 2QSIA 3V2RA 1HJBA 4DG9A 1JY2N 2WSCH 3P7KA 1ZNVA 1FE6A 2H89C 3Q5SA 3L74D 3D71A 1K73Q 1PGJA 4C7NB 3VTPC 2B9BA 1SQXK 1JTHB 2MKVA 1W5CE 4OWFA 1GW3A 2QJPB 3OA7A 1SQQK 3L73E 4GOEA 2PEOA 4PH0A 4H0LD 2FQ0A 3HD7D 4QKOA 5KP6B 4M0IA 2LOLA 4U3FE 1M57D 5KLVE 3MGEA 4EIJA 2N98A 2OYHC 2QA4P 3D6YA 5AW5B 1OW7A 1URQD 1SVFA 2VLPA 2IZ0A 3CX5I 2BUOA 3CX5D 2K0YA 1FZCA 3TK1A 1DV5A 4JYCA 5CMZA 4HYTB 3N4XA 1HWTC 1L0NG 3CCRP 4U0BA 1L0NJ 1FOSE 2M3BA 2R44A 1FZCB 2GZIA 1Q2NA 1L4AD 2JU2A 2JAZA 1SQXG 5APSA 3SWYA 2PAJA 1NJIQ 1DX7A 3B5ND 3B5IA 2ERHA 3LW5H 2N9BA 3OW2O 1PPJE 1RQUA 5CCGD 1BXIA 1RO2A 4Z1MH 3A3YB 5DJTB 3U1AA 2AFDA 2WZ7A 1NOHA 1YJWP 2OQQA 3M06A 1ZP0C 1EDLA 2KODA 2P67A 2YNYA 1ZR4A 1USDA 2BCCE 3AE3C 4YXWH 2R3CA 4XFJA 1SQPD 2K5XA 3CXHH 2IFNA 1YIJP 1NTZD 2N50A 4XROA 1PP9J 3GG2A 2VLQA 2C0XA 3MGNA 4D6TJ 3R4YA 1HBWA 2FVEA 1S5LH 3IF4A 3EFFK 4UB8H 2YXRB 5CJ0A 3B4QA 1A43A 3H1HJ 2MD9A 2JGPA 3G71P 3HD7A 2ZT9B 1NU1K 1JY2P 2YIUB 3NMDA 2ROQA 3TGUE 3U1CA 2KGCA 3LMOA 1CI6A 4I7ZC 1URQA 3DS2A 3LIDA 1OZHA 1S2EA 2BHVA 4O9BA 1KMIZ 1IMPA 2A45H 1URQB 3S4RA 3KHUA 1L4AA 5GTHE 2Q7CA 1PEQA 2E5YA 1FJKA 4U3FD 5KJ7C 3P8CE 2Y0EA 4XRQA 3B5NA 4W80A 2K2QA 1L4AB 3VP9A 4H13D 4XA4A 2OGUA 2WSEJ 1NAFA 1MUUA 5CJ4A 3N7NA 1RE4A 2Y0CA 3B5NB 3DS3A 2PRRA 2L4BA 1BCCJ 5CCGA 2QJYC 3LRYA 5TISE 1SQBE 2AXCA 1IJDB 1RE3C 2QVAA 4BWNA 3CCUP 1SQVE 5AW9B 1OMIA 1KN7A 4WBAA 1GDTA 2GZJA 4U7JA 2V4HA 3RGUA 1VQ8P 1HY8A 1KYOH 3FWLA 1QGKB 4LC1A 4LGDE 4I2LC 2FFDB 1IO4A 1PPJD 2Z5HA 1HTLC 7CEIA 3AE9C 2E74B 3L75G 3CWBG 4H0LC 1NQ4A 4DOJA 2KOOA 1ACPA 1E6JP 4GR6A 2NO8A 2XV6A 3H1KG 4AQRD 1SQQD 3TDKA 2BCCD 3H1KJ 2L6EA 2KP8A 3KPEA 3KDPB 3L72E 3AEDC 3L70G 1ZXGA 3CC2P 1HJ0A 1A02F 2HR3A 2FXPA 4COPA 2YXQB 4WY4C 5BS2A 3VP8A 1VQKP 3A5TA 2PY8A 1D7MA 4RESB 2JBGA 4IFFA 2JJLA 3V2QA 3ITKA 1M6EX 2GDYA 3T97A 2IBZG 5APYA 4EI2A 1E79H 2FYNB 3ABVC 4RJTA 3HUSA 1HVVA 4K35A 1BE3J 1T8ZA 2MJZA 4U0EA 1SLQA 3E2DA 2KWLA 2FYZA 2FYUD 2JDIH 1FDMA 1VQ6P 3A0BE 3G4SP 2IPPA 5KTBA 3TGUD 1S1CX 2JEEA 2XKMA 1JNMA 1GTWA 1VL2A 3BCCE 4C7RA 2E76C 3L71J 1XTGB 1BDDA 3GKLC 3H1JE 1KILB 5AW3B 4UB6H 4H13B 1N8RQ 3I5CA 1VQ7P 1N73A 3CCSP 3G6EP 4OGQB 4R4LA 2WSEH 1L0HA 1LTJA 2HODB 1LP1B 1PV3A 1VDFA 2HFED 1IC2A 1N73B 1H0TB 2JWAA 4ASVA 1K04A 4A7PA 3HE5A 1TU3F 2R5DA 2KORA 3V6IA 2KLUA 2OARA 2CG5B 2H8PD 2G3AA 3L74J 5CBNA 1PEUA 1FZGA 1SQVD 4IL6X 3HE5B 2WPSA 4WYMA 5HGLA 5KAFE 3EJEA 4PD4E 1AV1A 3KZIH 3TYYA 4ZMDA 5CBOA 1J1DC 3PH0A 4RKUJ 2QJKC 1NU1D 1RF1A 1GXHA 1RQVA 1EIAA 2YKOA 3M9BA 1FZBA 3H0DA 3NTNA 2Q1KA 4XFXA 4IL6E 3E1RA 4BPHA 1USEA 1VQ5P 1KB9E 2VLOA 2KXPB 5F2NA 3O8ZA 1QX8A 1SFCC 2KGAA 1L0IA 1T2KC 1L0LE 2GDWA 3L72D 3BASA 1JJ2O 4GOFA 1YQ4C 2UWJE 2WT7A 1U7JA 4F37A 3H1IG 3GF3A 3WU2E 3H1LE 2RMZA 3LIEA 1OFCX 3RL0C 3EWKA 3A0BH 5CZDB 2WT7B 4OVNF 2OYHA 3CXCO 3U59A 2RKLA 1LWUC 2PEKA 2Y9YA 3WBHA 1BGYG 1IFNA 2IYOA 4WB4A 1JY2O 1P84E 2KOQA 2WSFJ 2G8YA 3VN0A 3H25A 4PJ0H 1NTME 1DEBA 4OH8B 4QNBA 4R4MA 2C9NY 2P58A 2P7JA 1LTAC 3BCCD 4NEOA 2JU1A 3FXEA 1GL2C 2CGQA 3H1JD 3DTJA 1NTZJ 2GZGA 3H4EA 2LPKA 1SQPE 4DJGA 1VKUA 2JKVA 5KJ7D 1S3JA 3IN6A 3NFQA 5KLVK 4L75A 2V7QH 1T8KA 3Q1MA 5EJDA 1PGQA 1DEEG 2B87A 4N3YB 1NTKE 1S5LX 1NKZB 1RF1C 2KG6A 1YYCA 2QNWA 3CMAP 3HE4A 1L2PA 1K8AQ 3TF5A 4CA3A 2K93A 1VF5C 2N6ZA 2ITAA 1L0NK 1EQ7A 2PGDA 3HE4B 2Q3IA 3TSIA 1DIPA 3DS4A 4BPFA 4JQ0D 3L73G 2R5BA 3Q20A 2YO3A 3L73J 4PD4I 4PD4D 2OYIC 1AUMA 2A45G 4EOTA 2WVRA 5KLVG 2DNWA 2XT1A 4KT0J 4U3FJ 5KLVJ 5E79E 5AW6B 5AVQB 3P05A 1LT9C 1YQ3C 1QL2A 3CX5H 4C46A 1LT1A 2WSSH 2Y9ZA 2L91A 5CCHC 3E1IA 1KB9I 1KB9D 4WY4D 3CD6P 1W2BO 1LTGC 2H7HA 3PLNA 1L0LD 1HQBA 3PJSK 4DT0A 4H2WC 3WU2H 4I7ZB 1JMBA 2L9FA 2JYLA 2IFMA 2IDBA 3GHGC 3RK2B 1PFIA 1FDIA 2KGDA 4KJMA 1NH4A 2XNXA 1OVUA 2GZFA 5JPAA 1EZVG 3H1LD 2ZVOB 1JCCA 5KJ7A 2KLVA 1OW6A 3R2PA 1WMKA 2C0WA 5KP7B 2QG4A 2WSFH 2IZ1A 2W90A 3W67A 2LIWA 1ZOYC 2E76D 1LTIC 4JF7A 4N6JA 3CE7A 4ZKUA 5KLIC 3P32A 3EJBA 1P84I 1P84D 3HZQA 1KTMA 4PV1D 1NTMD 3AE1C 1SQXE 2KOSA 3OAKA 2BCCJ 1A02J 4H44D 1RE3A 5EFWB 1SQQE 2Q5UA 2AF8A 3MUDC 2OTLP 1Y47A 1S9KE 3V2NA 3MIWA 4ZKPA 3HRNA 3GJNA 2CNRA 5KAIH 2N5IA 1PP9G 4D6TG 2JR8A 3M0AA 2WTYA 5DCKA 1IUQA 2QJPC 5M1BA 1NTKD 2K37A 1E5WA 1YTZI 1YI2P 3G9RA 3H1HG 4L76A 2QEXP 5APUA 2KNCA 1KQSO 1GK4A 1T6AA 2E42A 3TGUJ 2FYUE 2AEJA 3PTZA 3A0HE 3MP7B 4H0LB 1FJPA 2M8RA 1JUNA 3HD7B 1YBKA 1NHLA 5AVXB 4NPFX 4EDFA 4WY4A 2FVFA 2KB7P 2PP6A 2JP3A 1DD4A 1CI6B 3B8EB 1X79B 1X3OA 3A2AA 3B4SA 4MRTC 2GYKA 1ZV8A 4GKGA 1JB0J 4WY4B 2O01J 3G0VA 1R5SA 1E0HA 3V4QA 2CPBA 5GTIE 2B88A 4HKZH 1IK9A 3L37A 1ZLLA 3B71A 1SFCD 1T2KD 3RG6C 3FWNA 1EMVA 1SQBG 2W83C 1BCCG 2P1JA 2E75D 1SQBJ 3Q5RA 2FVAA 3K5BA 1XTCC 3VMXA 1SQVJ 3EQ2A 1Z6MA 2Q9IA 2GUVA 3MHVA 1JEKA 1M1KQ 5AVUB 3EFGA 3RL0D 2W6BA 1VHNA 2E76B 3BRVB 2AEMA 1FOSF 2O1KA 2W8ZA 5B5EE 2EFJA 2JWDA 1NU1E 1QVFO 3KXDA 2KSJA 1L0ND 2XZ0D 5B66E 1GL2D 4N78E 1AFOA 3TNUA 4U0CA 1SQXD 2KOPA 3MTUE 2ZT9C 4H2XC 1EDKA 3UIAA 2FXOA 1S9KD 3TNUB 2OTJP 5AW7B 1JY3O 2QM7A 3RG2A 4MN4C 4IOIH 2N6YA 1JO5A 3CPWO 3L75E 3CWBE 3VRLC 2GM4A 3F5HA 1MZ8A 4U0DA 1EXJA 1GK6A 3GMAA 2P9XA 1J1DB 1VF5D 3FX0A 1JOCA 2VLNA 1T3UA 2QIWA 3AEEC 1BE3G 4XE5B 1EOQA 3L70E 1WT6A 4ZNCA 3T97B 1PEMA 2LKMA 3C1LA 1J1EC 5APWA 1KQLA 1N86A
chains in the Genus database with same CATH topology
2PENA 1VQ4P 1N8RQ 1VQ7P 1A43A 1ZMBA 2PEQA 3CCSP 2ONTA 1K9MQ 3G6EP 1M1KQ 1AUMA 3G71P 1VQ9P 1A8OA 2LF4A 2PEIA 1Q86Q 2BUOA 5BS1A 1VQOP 1VQLP 4COCA 2XT1A 3CXCO 1QVGO 1VQMP 1YJ9P 1Q7YQ 5DCKA 1IUQA 3DS0A 5HGMA 3P05A 1E6JP 4GR6A 1QRJA 2PEKA 4XFYA 3CCRP 4U0BA 2EFJA 2XV6A 3CCJP 3G1IA 3WBHA 1QVFO 3DS2A 2L6EA 2Z45A 1YI2P 4GR2A 2Z44A 2BHVA 2Z46A 2OARA 2QEXP 1S72P 1PEUA 1NJIQ 4QNBA 1KQSO 3CMEP 2JO0A 1M74A 3CC4P 3I56P 1YJNP 3CC2P 1M90Q 3B5IA 4COPA 3CD6P 3CCQP 3OW2O 1W2BO 3G1GA 5BS2A 2DGYA 4WYMA 5HGLA 1VQKP 1RNIA 3DTJA 3G28A 4U0CA 3H4EA 2PY8A 3H47A 1PEQA 2JYGA 2M8PA 3DPHA 1M6EX 1RO2A 4XRQA 1BAJA 4U0FA 4XFZA 5F2KA 2JYLA 1KD1Q 3G26A 1YITP 3CCLP 2OTJP 2EG5A 1YJWP 1KC8Q 3CCEP 3DS5A 4U0AA 1EIAA 1M6NA 2E1MA 2CWOA 3E2DA 2KODA 4U0EA 5JPAA 3CC7P 2BQ1E 2XXMA 3CCMP 2PEMA 3CPWO 1VQ6P 3G21A 3DS3A 1PEOA 1K73Q 4IPYA 3G4SP 3VRLC 3H0DA 1VQNP 2QA4P 3G0VA 4XFXA 3LRYA 5HGOA 3DS1A 1Q81Q 3CMAP 1K30A 4U0DA 5I4TG 3CCUP 1K8AQ 1VQ5P 1Q82Q 3NTEA 2P9XA 1YIJP 4PH1A 3CCVP 5F2NA 2PEOA 2EIAA 4PH0A 3HZQA 3RG6C 4XROA 3I55P 1D1DA 1EOQA 3G29A 5F2OA 1YHQP 3HYBA 3M1MA 1VQPP 4M0IA 1VQ8P 2M8NA 5HGNA 1JJ2O 1PEMA 3DS4A 2OTLP 1RO0A 3MGEA 2PEJA 3Q20A 2M8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 Q;  1VQ4 P;  1QVF O;  1N8R Q;  3CMA P;  1YI2 P;  1VQ7 P;  1K8A Q;  3CCU P;  1VQ5 P;  1Q82 Q;  3CCS P;  1KD1 Q;  1YIJ P;  2QEX P;  1K9M Q;  3G6E P;  1M1K Q;  3CCV P;  3G71 P;  1YIT P;  1S72 P;  1VQ9 P;  1NJI Q;  3CCL P;  1KQS O;  2OTJ P;  1Q86 Q;  3CME P;  1YJW P;  1KC8 Q;  3CC4 P;  3I56 P;  1VQO P;  1YJN P;  3I55 P;  1M90 Q;  1VQL P;  3CC2 P;  3CCE P;  1YHQ P;  3CD6 P;  3CCQ P;  3OW2 O;  1W2B O;  3CXC O;  3CC7 P;  1VQP P;  1VQM P;  3CCM P;  1YJ9 P;  1Q7Y Q;  1QVG O;  1VQ8 P;  1VQK P;  3CPW O;  1VQ6 P;  1K73 Q;  1JJ2 O;  3G4S P;  1VQN P;  3CCR P;  2OTL P;  3CCJ P;  2QA4 P; 
#chains in the Genus database with same CATH topology
 1PGP A;  3HUS B;  3BCC J;  1PGO A;  1SFC A;  3NXS A;  3L71 G;  2EHS A;  2LML A;  3H1J J;  1FR2 A;  2A06 G;  2IBZ E;  1AA0 A;  5KKZ C;  5GTH H;  4PV1 C;  2AXT E;  3RL0 g;  1YJ9 P;  1Q7Y Q;  5AVT B;  3USS A;  1SFC B;  4H44 C;  2O01 H;  3BAT A;  5EW5 E;  3JC2 2;  3NY7 B;  5K5G B;  5H2F E;  2K0D X;  5CCH D;  2Z46 A;  5HV8 A;  1EC5 A;  1N7S C;  1IFI A;  2AVA A;  2V7Q J;  1M74 A;  1LWU A;  1M90 Q;  3AEG C;  3CCQ P;  3RL0 B;  5TIS H;  1G2C A;  2L0Q A;  4EYY Q;  2N1T C;  2FFD C;  3JCU E;  2WPT A;  1LWU B;  2X2B A;  1LTJ B;  2I1J A;  3L74 G;  3G26 A;  2ZYD A;  1ZME C;  1G2C B;  1GL2 A;  3CCE P;  1KQF B;  2IYP A;  1FZF A;  1Y8A A;  2Q3E A;  3C9I A;  3G21 A;  4IPY A;  1GL2 B;  2NZ2 A;  1HUC A;  1W2E A;  5HGO A;  1U7M A;  2LR2 A;  2AFE A;  1BCC D;  5L8R J;  3D70 A;  2WIT A;  1BDC A;  3H6P A;  1JCD A;  3GLM A;  1MKM A;  1H88 A;  2M0B A;  3IAO A;  4N78 D;  1RF1 B;  3AE7 C;  4JBZ A;  3VYI A;  1CEI A;  3PHL A;  3V2P A;  1ZMB A;  2PEQ A;  2P10 A;  2ONT A;  3RBX A;  2NPS C;  1A8O A;  1NTZ K;  1Q86 Q;  2W27 A;  2K3R A;  1HF9 A;  2PFX A;  1VQO P;  1FS0 E;  2MY5 A;  5BU8 B;  2LXB A;  1AQT A;  3F89 A;  1VF5 B;  2WMM A;  1QVG O;  2KUB A;  3AEF C;  5AVS B;  2OYI A;  3G1I A;  2E75 C;  2FQ1 A;  3L75 D;  1JM0 A;  3CWB D;  4JPZ B;  4GR2 A;  3H1L J;  1X22 A;  1KIL C;  2L5G B;  2RH0 A;  2OYI B;  3AEC C;  3H1K D;  1LT9 A;  3PRJ A;  1OR5 A;  1T3J A;  2M5R A;  3G28 A;  3L70 D;  3H47 A;  5CCH A;  2Q6Q A;  1LT9 B;  1NTM J;  4OGQ C;  4U0F A;  2OYH B;  1SS1 A;  1OX3 A;  2LIU A;  2VSQ A;  2OTK E;  1WRG A;  3H1I E;  3M0D C;  4L74 A;  3RK3 C;  3DS5 A;  2FQ2 A;  2CWO A;  2KIK A;  1SQP J;  2IBZ I;  2IBZ D;  1NTZ G;  5H2F H;  1NYH A;  2HG5 D;  2JQ4 A;  1KOR A;  3G3Z A;  1VQN P;  3GHG A;  4PXH B;  4HKG A;  2WPQ A;  2CK3 H;  2ZYA A;  3WUU A;  1K30 A;  5I4T G;  1ZN5 A;  3NTE A;  1BGY E;  2GDX A;  3H32 A;  1KV4 A;  4W7Z A;  4IZ6 A;  2WQY C;  1NTK J;  3G29 A;  1KFM A;  3GHG B;  1M1J C;  1VQP P;  3GF7 A;  3RBZ A;  1RF0 C;  5AW2 B;  2FAE A;  1U57 A;  2K92 A;  2KG8 A;  4AUW A;  4CPG A;  1FAV A;  1Q90 D;  1ZRT D;  2B87 B;  4Y99 C;  2FY8 A;  2C9L Y;  3JSV C;  3SFE C;  3L35 A;  1JMM A;  3CXH E;  1AQ5 A;  2WPV B;  3MUD A;  5KLI B;  2FKW B;  5KAF H;  1Y9B A;  4PD4 H;  3OJA B;  2LKI A;  3AE5 C;  2FHS C;  1RHZ B;  1R8E A;  3CCJ P;  2QM8 A;  1OXZ A;  1HGZ A;  2JO1 A;  2Z45 A;  1S5L E;  1GMJ A;  4UB8 E;  2POH A;  1H8A A;  2H43 A;  4PWV B;  2E43 A;  4U3F G;  4WWI A;  4QMA A;  4IL6 H;  3M91 A;  2R32 A;  1KB9 H;  2ZT9 D;  1GD2 E;  2K94 A;  1BSH A;  1KD1 Q;  3KQG A;  4K3A A;  4TLF A;  2M5A A;  1IZN B;  1MZ9 A;  4R0M A;  1PZQ A;  2XZR A;  2SPZ A;  2N9Y B;  1OVV A;  1KIL E;  2M5A B;  5APX A;  1BSN A;  2HYN A;  1ZR2 A;  1DNY A;  4HJG H;  4IFD K;  2KW2 A;  2J59 M;  2L22 A;  3I55 P;  2HPC A;  3SWF A;  3HYB A;  1PPJ G;  5AW1 B;  5AW0 B;  2D2C C;  1P84 H;  2FYU K;  4DCK A;  1YTZ T;  2ZJS E;  3ZDM A;  2MR8 A;  1L0N E;  1R5L A;  2RN0 A;  2O01 N;  3RK3 E;  2HPC B;  1SQX J;  2LF4 A;  1SQQ G;  2BCC G;  1SQQ J;  3VMY A;  1PIX A;  2KZJ A;  1VQM P;  2ZXX A;  2XZ1 C;  3H1I D;  5HGM A;  3U43 A;  2M3E A;  3EJD A;  1EZV E;  4YXD C;  2GZE A;  1KYO E;  4NPD A;  3Q3D A;  1N7S D;  2QJY B;  3CLQ A;  4H2Y C;  1NAY A;  3AEA C;  2YKP A;  1YJN P;  1BGY D;  3QH9 A;  2Z5I A;  4BPG A;  2N1T D;  1DD3 A;  1FZE A;  2KI7 B;  2YMY A;  3IR9 A;  5TJH A;  3WUT A;  2FBW C;  2EHT A;  2E74 D;  1BAJ A;  4XFZ A;  4Y28 J;  2FYU G;  2ZYG A;  1YIT P;  2FYU J;  3CCL P;  2DW3 A;  2ZXE B;  1MV8 A;  3TGU G;  1SQB K;  1AVY A;  2KYV A;  3HTK A;  1GU4 A;  1SQV K;  3CXH I;  1PP9 E;  3CXH D;  2PEM A;  1IMQ A;  4D6T E;  2KNC B;  3MZW B;  2HLO A;  3HTK B;  3M9Q A;  2BAS A;  3SWK A;  2YO2 A;  5APV A;  3H1H E;  5E79 H;  3KYQ A;  2PNG A;  5F2O A;  2MF4 A;  3CI9 A;  1RY3 A;  1OWA A;  4YPC A;  3M1M A;  1FZA A;  1X9V A;  1FZC C;  1NVO A;  3S1K A;  1VQ4 P;  3RK2 C;  4M3L A;  1IFP A;  4GDO A;  2QRX A;  2NPS D;  1F80 D;  2FAC A;  3L73 D;  3SFD C;  4COC A;  2XND H;  3DS0 A;  1FBM A;  1UNK A;  3E7K A;  4UB6 E;  1SQV G;  5BVZ A;  2A45 I;  4AYC A;  5KLV D;  3V5B A;  1J1E B;  1KIL D;  2Z4E A;  2JO0 A;  1OVR A;  1FU1 A;  3MD0 A;  4IFM A;  5AW4 B;  1NU1 G;  1GZL A;  1MFT A;  2DGY A;  1EDI A;  5KKZ B;  1NU1 J;  4PV1 B;  1N7S A;  4H44 B;  1GU5 A;  1BCC E;  4OGQ D;  4RO0 A;  5F2K A;  2LTE A;  5AW8 B;  3L4F A;  3RK3 D;  2XDJ A;  1N7S B;  2N1T A;  2FFD A;  1N7L A;  2K0X A;  3VMA A;  2KS1 A;  3AE8 C;  1HGV A;  2K9Y A;  3BRT B;  3C8V A;  1OIP A;  3L36 A;  2W6A A;  2K9J A;  2LXC B;  2FAD A;  2BEQ D;  1G1J A;  3AEB C;  2N1T B;  3L72 G;  1CZQ A;  1EZV I;  2I8D A;  1EZV D;  2KS1 B;  1J2J B;  3L72 J;  1Q82 Q;  3KZI E;  1N2D C;  5APT A;  1KYO I;  2YIU C;  1KYO D;  2K9J B;  2VRS A;  2CQ8 A;  1KLP A;  3L75 J;  3CWB J;  1EDJ A;  3HD7 C;  2KK7 A;  5HGN A;  2Y0D A;  2PEJ A;  5AVV B;  2PEI A;  1IFJ A;  1LGH B;  2JB0 A;  1RH5 B;  3AE2 C;  5CHX A;  2IX7 C;  1QL1 A;  3H1K E;  2WWW A;  3A0H H;  1URQ C;  2WPR A;  3L70 J;  2QJK B;  3O6Q A;  1HH0 A;  4JYB A;  5AVR B;  3V4W A;  3P8M C;  2GUS A;  1PP9 D;  2NPS A;  3BCC G;  1LTB C;  2MR7 A;  3O6Q B;  1FC2 C;  4D6T D;  1L4A C;  3H1J G;  4GT1 A;  1NKN A;  1KZU B;  3CC4 P;  3I56 P;  3B5N C;  2NPS B;  2QE7 H;  2E5T A;  3H1H D;  1BE3 E;  1RNI A;  5KP8 B;  4L73 A;  1KIL A;  5GTI H;  2KGE A;  2MVV A;  1GPJ A;  1RE4 C;  2YKQ A;  4GIF A;  1AJY A;  1GXG A;  2E75 B;  5AVY B;  5CCG C;  2KG9 A;  3M9H A;  2XU6 A;  1KC8 Q;  3L71 E;  4PJ0 E;  4W7Y A;  1M56 D;  4U0A A;  4KHX A;  3WUV A;  2A06 E;  3CCM P;  1DH3 A;  2K88 A;  1JY3 N;  3AE6 C;  3VMZ A;  1ZRT E;  1L0L K;  1Q81 Q;  1H89 A;  4DZO A;  2HOD A;  4BRY A;  1LP1 A;  3M0D A;  1H0T A;  1NO4 A;  2E74 C;  4PH1 A;  2ZFC A;  3CCV P;  3P8C D;  2EIA A;  1LTT C;  1ZW0 A;  1D1D A;  1IFD A;  2BEZ F;  1YHQ P;  4BRY B;  5B5E H;  2D2C D;  2M8N A;  3RK3 B;  2J5U A;  1M8O B;  2M8L A;  4UHP B;  2N5H A;  1SQB D;  5B66 H;  1IFM A;  1K9M Q;  3FGA D;  1M1J A;  1VQ9 P;  2O1J A;  3A7O A;  4BXL A;  3CL3 D;  5DJU B;  3L74 E;  1RF0 A;  1VQL P;  2GA1 A;  3Q5P A;  2WSC J;  2H88 C;  1NTM K;  4HB1 A;  1M1J B;  4TT3 H;  4YTP C;  5HVC A;  2FYN C;  1LJ2 A;  1X8Y A;  3D6Z A;  4LLH A;  3W68 A;  2Z44 A;  1NWQ A;  1SQP K;  1L0L G;  2B89 A;  1S72 P;  3CME P;  1L0L J;  2FXM A;  4Y99 B;  1Z56 A;  1PL5 A;  1MFZ A;  3SSU A;  4B86 A;  1QEX A;  1NGM B;  3VOP A;  3G1G A;  3QWO C;  3HUS C;  2KSE A;  2AEF A;  3WMM 0;  2NRG A;  2KOG A;  5BU5 A;  3S9O A;  1NTK K;  2LL8 A;  3H1L G;  1S4X A;  3BVH A;  3CX5 E;  1GW4 A;  4ASW A;  3GZM A;  1G1I A;  2K1A A;  4H13 C;  2ZAE B;  1M6N A;  2E1M A;  2BQ1 E;  1EXI A;  3GZL A;  3CC7 P;  2XXM A;  1FDO A;  1PEO A;  5AVZ B;  1AVO A;  2XV5 A;  1NTM G;  3DS1 A;  2ZVN B;  5APQ A;  2CPS A;  2KZI A;  2I1K A;  1K05 A;  3H1I J;  1VPC A;  2AXT H;  1UII A;  1N73 C;  1SQP G;  1CW5 A;  1AF8 A;  3LW5 J;  2MVU A;  3PP5 A;  5C39 A;  2R3S A;  1IK7 A;  1LTJ C;  1RO0 A;  1CSB A;  3RK2 D;  1AYI A;  1BE3 D;  1KFN A;  1KQG B;  2PEN A;  4I6M C;  1BGY J;  1SP4 A;  4NPE A;  1UIX A;  1NTK G;  2W6J H;  1OW8 A;  2OYO A;  5BS1 A;  1UJZ A;  4GOD A;  3FXD A;  3JCU H;  1LNQ A;  1JY3 P;  3L71 D;  2YMK A;  2KR5 A;  2O3J A;  4XFY A;  3AE4 C;  1QRJ A;  2J58 A;  2A06 D;  3H32 B;  1NTZ E;  2D2C B;  3GW6 A;  1LTS C;  4WVZ A;  5KAI E;  1X0T A;  5AVW B;  1M7L A;  1QLE D;  3II6 A;  4HH2 A;  2JYG A;  2M8P A;  4I1L A;  3DPH A;  2P2U A;  4C7N A;  3Q2Y A;  1JTH A;  3IFM A;  2EG5 A;  2QSI A;  3V2R A;  1HJB A;  4DG9 A;  1JY2 N;  2WSC H;  3P7K A;  1ZNV A;  1FE6 A;  2H89 C;  3Q5S A;  3L74 D;  3D71 A;  1K73 Q;  1PGJ A;  4C7N B;  3VTP C;  2B9B A;  1SQX K;  1JTH B;  2MKV A;  1W5C E;  4OWF A;  1GW3 A;  2QJP B;  3OA7 A;  1SQQ K;  3L73 E;  4GOE A;  2PEO A;  4PH0 A;  4H0L D;  2FQ0 A;  3HD7 D;  4QKO A;  5KP6 B;  4M0I A;  2LOL A;  4U3F E;  1M57 D;  5KLV E;  3MGE A;  4EIJ A;  2N98 A;  2OYH C;  2QA4 P;  3D6Y A;  5AW5 B;  1OW7 A;  1URQ D;  1SVF A;  2VLP A;  2IZ0 A;  3CX5 I;  2BUO A;  3CX5 D;  2K0Y A;  1FZC A;  3TK1 A;  1DV5 A;  4JYC A;  5CMZ A;  4HYT B;  3N4X A;  1HWT C;  1L0N G;  3CCR P;  4U0B A;  1L0N J;  1FOS E;  2M3B A;  2R44 A;  1FZC B;  2GZI A;  1Q2N A;  1L4A D;  2JU2 A;  2JAZ A;  1SQX G;  5APS A;  3SWY A;  2PAJ A;  1NJI Q;  1DX7 A;  3B5N D;  3B5I A;  2ERH A;  3LW5 H;  2N9B A;  3OW2 O;  1PPJ E;  1RQU A;  5CCG D;  1BXI A;  1RO2 A;  4Z1M H;  3A3Y B;  5DJT B;  3U1A A;  2AFD A;  2WZ7 A;  1NOH A;  1YJW P;  2OQQ A;  3M06 A;  1ZP0 C;  1EDL A;  2KOD A;  2P67 A;  2YNY A;  1ZR4 A;  1USD A;  2BCC E;  3AE3 C;  4YXW H;  2R3C A;  4XFJ A;  1SQP D;  2K5X A;  3CXH H;  2IFN A;  1YIJ P;  1NTZ D;  2N50 A;  4XRO A;  1PP9 J;  3GG2 A;  2VLQ A;  2C0X A;  3MGN A;  4D6T J;  3R4Y A;  1HBW A;  2FVE A;  1S5L H;  3IF4 A;  3EFF K;  4UB8 H;  2YXR B;  5CJ0 A;  3B4Q A;  1A43 A;  3H1H J;  2MD9 A;  2JGP A;  3G71 P;  3HD7 A;  2ZT9 B;  1NU1 K;  1JY2 P;  2YIU B;  3NMD A;  2ROQ A;  3TGU E;  3U1C A;  2KGC A;  3LMO A;  1CI6 A;  4I7Z C;  1URQ A;  3DS2 A;  3LID A;  1OZH A;  1S2E A;  2BHV A;  4O9B A;  1KMI Z;  1IMP A;  2A45 H;  1URQ B;  3S4R A;  3KHU A;  1L4A A;  5GTH E;  2Q7C A;  1PEQ A;  2E5Y A;  1FJK A;  4U3F D;  5KJ7 C;  3P8C E;  2Y0E A;  4XRQ A;  3B5N A;  4W80 A;  2K2Q A;  1L4A B;  3VP9 A;  4H13 D;  4XA4 A;  2OGU A;  2WSE J;  1NAF A;  1MUU A;  5CJ4 A;  3N7N A;  1RE4 A;  2Y0C A;  3B5N B;  3DS3 A;  2PRR A;  2L4B A;  1BCC J;  5CCG A;  2QJY C;  3LRY A;  5TIS E;  1SQB E;  2AXC A;  1IJD B;  1RE3 C;  2QVA A;  4BWN A;  3CCU P;  1SQV E;  5AW9 B;  1OMI A;  1KN7 A;  4WBA A;  1GDT A;  2GZJ A;  4U7J A;  2V4H A;  3RGU A;  1VQ8 P;  1HY8 A;  1KYO H;  3FWL A;  1QGK B;  4LC1 A;  4LGD E;  4I2L C;  2FFD B;  1IO4 A;  1PPJ D;  2Z5H A;  1HTL C;  7CEI A;  3AE9 C;  2E74 B;  3L75 G;  3CWB G;  4H0L C;  1NQ4 A;  4DOJ A;  2KOO A;  1ACP A;  1E6J P;  4GR6 A;  2NO8 A;  2XV6 A;  3H1K G;  4AQR D;  1SQQ D;  3TDK A;  2BCC D;  3H1K J;  2L6E A;  2KP8 A;  3KPE A;  3KDP B;  3L72 E;  3AED C;  3L70 G;  1ZXG A;  3CC2 P;  1HJ0 A;  1A02 F;  2HR3 A;  2FXP A;  4COP A;  2YXQ B;  4WY4 C;  5BS2 A;  3VP8 A;  1VQK P;  3A5T A;  2PY8 A;  1D7M A;  4RES B;  2JBG A;  4IFF A;  2JJL A;  3V2Q A;  3ITK A;  1M6E X;  2GDY A;  3T97 A;  2IBZ G;  5APY A;  4EI2 A;  1E79 H;  2FYN B;  3ABV C;  4RJT A;  3HUS A;  1HVV A;  4K35 A;  1BE3 J;  1T8Z A;  2MJZ A;  4U0E A;  1SLQ A;  3E2D A;  2KWL A;  2FYZ A;  2FYU D;  2JDI H;  1FDM A;  1VQ6 P;  3A0B E;  3G4S P;  2IPP A;  5KTB A;  3TGU D;  1S1C X;  2JEE A;  2XKM A;  1JNM A;  1GTW A;  1VL2 A;  3BCC E;  4C7R A;  2E76 C;  3L71 J;  1XTG B;  1BDD A;  3GKL C;  3H1J E;  1KIL B;  5AW3 B;  4UB6 H;  4H13 B;  1N8R Q;  3I5C A;  1VQ7 P;  1N73 A;  3CCS P;  3G6E P;  4OGQ B;  4R4L A;  2WSE H;  1L0H A;  1LTJ A;  2HOD B;  1LP1 B;  1PV3 A;  1VDF A;  2HFE D;  1IC2 A;  1N73 B;  1H0T B;  2JWA A;  4ASV A;  1K04 A;  4A7P A;  3HE5 A;  1TU3 F;  2R5D A;  2KOR A;  3V6I A;  2KLU A;  2OAR A;  2CG5 B;  2H8P D;  2G3A A;  3L74 J;  5CBN A;  1PEU A;  1FZG A;  1SQV D;  4IL6 X;  3HE5 B;  2WPS A;  4WYM A;  5HGL A;  5KAF E;  3EJE A;  4PD4 E;  1AV1 A;  3KZI H;  3TYY A;  4ZMD A;  5CBO A;  1J1D C;  3PH0 A;  4RKU J;  2QJK C;  1NU1 D;  1RF1 A;  1GXH A;  1RQV A;  1EIA A;  2YKO A;  3M9B A;  1FZB A;  3H0D A;  3NTN A;  2Q1K A;  4XFX A;  4IL6 E;  3E1R A;  4BPH A;  1USE A;  1VQ5 P;  1KB9 E;  2VLO A;  2KXP B;  5F2N A;  3O8Z A;  1QX8 A;  1SFC C;  2KGA A;  1L0I A;  1T2K C;  1L0L E;  2GDW A;  3L72 D;  3BAS A;  1JJ2 O;  4GOF A;  1YQ4 C;  2UWJ E;  2WT7 A;  1U7J A;  4F37 A;  3H1I G;  3GF3 A;  3WU2 E;  3H1L E;  2RMZ A;  3LIE A;  1OFC X;  3RL0 C;  3EWK A;  3A0B H;  5CZD B;  2WT7 B;  4OVN F;  2OYH A;  3CXC O;  3U59 A;  2RKL A;  1LWU C;  2PEK A;  2Y9Y A;  3WBH A;  1BGY G;  1IFN A;  2IYO A;  4WB4 A;  1JY2 O;  1P84 E;  2KOQ A;  2WSF J;  2G8Y A;  3VN0 A;  3H25 A;  4PJ0 H;  1NTM E;  1DEB A;  4OH8 B;  4QNB A;  4R4M A;  2C9N Y;  2P58 A;  2P7J A;  1LTA C;  3BCC D;  4NEO A;  2JU1 A;  3FXE A;  1GL2 C;  2CGQ A;  3H1J D;  3DTJ A;  1NTZ J;  2GZG A;  3H4E A;  2LPK A;  1SQP E;  4DJG A;  1VKU A;  2JKV A;  5KJ7 D;  1S3J A;  3IN6 A;  3NFQ A;  5KLV K;  4L75 A;  2V7Q H;  1T8K A;  3Q1M A;  5EJD A;  1PGQ A;  1DEE G;  2B87 A;  4N3Y B;  1NTK E;  1S5L X;  1NKZ B;  1RF1 C;  2KG6 A;  1YYC A;  2QNW A;  3CMA P;  3HE4 A;  1L2P A;  1K8A Q;  3TF5 A;  4CA3 A;  2K93 A;  1VF5 C;  2N6Z A;  2ITA A;  1L0N K;  1EQ7 A;  2PGD A;  3HE4 B;  2Q3I A;  3TSI A;  1DIP A;  3DS4 A;  4BPF A;  4JQ0 D;  3L73 G;  2R5B A;  3Q20 A;  2YO3 A;  3L73 J;  4PD4 I;  4PD4 D;  2OYI C;  1AUM A;  2A45 G;  4EOT A;  2WVR A;  5KLV G;  2DNW A;  2XT1 A;  4KT0 J;  4U3F J;  5KLV J;  5E79 E;  5AW6 B;  5AVQ B;  3P05 A;  1LT9 C;  1YQ3 C;  1QL2 A;  3CX5 H;  4C46 A;  1LT1 A;  2WSS H;  2Y9Z A;  2L91 A;  5CCH C;  3E1I A;  1KB9 I;  1KB9 D;  4WY4 D;  3CD6 P;  1W2B O;  1LTG C;  2H7H A;  3PLN A;  1L0L D;  1HQB A;  3PJS K;  4DT0 A;  4H2W C;  3WU2 H;  4I7Z B;  1JMB A;  2L9F A;  2JYL A;  2IFM A;  2IDB A;  3GHG C;  3RK2 B;  1PFI A;  1FDI A;  2KGD A;  4KJM A;  1NH4 A;  2XNX A;  1OVU A;  2GZF A;  5JPA A;  1EZV G;  3H1L D;  2ZVO B;  1JCC A;  5KJ7 A;  2KLV A;  1OW6 A;  3R2P A;  1WMK A;  2C0W A;  5KP7 B;  2QG4 A;  2WSF H;  2IZ1 A;  2W90 A;  3W67 A;  2LIW A;  1ZOY C;  2E76 D;  1LTI C;  4JF7 A;  4N6J A;  3CE7 A;  4ZKU A;  5KLI C;  3P32 A;  3EJB A;  1P84 I;  1P84 D;  3HZQ A;  1KTM A;  4PV1 D;  1NTM D;  3AE1 C;  1SQX E;  2KOS A;  3OAK A;  2BCC J;  1A02 J;  4H44 D;  1RE3 A;  5EFW B;  1SQQ E;  2Q5U A;  2AF8 A;  3MUD C;  2OTL P;  1Y47 A;  1S9K E;  3V2N A;  3MIW A;  4ZKP A;  3HRN A;  3GJN A;  2CNR A;  5KAI H;  2N5I A;  1PP9 G;  4D6T G;  2JR8 A;  3M0A A;  2WTY A;  5DCK A;  1IUQ A;  2QJP C;  5M1B A;  1NTK D;  2K37 A;  1E5W A;  1YTZ I;  1YI2 P;  3G9R A;  3H1H G;  4L76 A;  2QEX P;  5APU A;  2KNC A;  1KQS O;  1GK4 A;  1T6A A;  2E42 A;  3TGU J;  2FYU E;  2AEJ A;  3PTZ A;  3A0H E;  3MP7 B;  4H0L B;  1FJP A;  2M8R A;  1JUN A;  3HD7 B;  1YBK A;  1NHL A;  5AVX B;  4NPF X;  4EDF A;  4WY4 A;  2FVF A;  2KB7 P;  2PP6 A;  2JP3 A;  1DD4 A;  1CI6 B;  3B8E B;  1X79 B;  1X3O A;  3A2A A;  3B4S A;  4MRT C;  2GYK A;  1ZV8 A;  4GKG A;  1JB0 J;  4WY4 B;  2O01 J;  3G0V A;  1R5S A;  1E0H A;  3V4Q A;  2CPB A;  5GTI E;  2B88 A;  4HKZ H;  1IK9 A;  3L37 A;  1ZLL A;  3B71 A;  1SFC D;  1T2K D;  3RG6 C;  3FWN A;  1EMV A;  1SQB G;  2W83 C;  1BCC G;  2P1J A;  2E75 D;  1SQB J;  3Q5R A;  2FVA A;  3K5B A;  1XTC C;  3VMX A;  1SQV J;  3EQ2 A;  1Z6M A;  2Q9I A;  2GUV A;  3MHV A;  1JEK A;  1M1K Q;  5AVU B;  3EFG A;  3RL0 D;  2W6B A;  1VHN A;  2E76 B;  3BRV B;  2AEM A;  1FOS F;  2O1K A;  2W8Z A;  5B5E E;  2EFJ A;  2JWD A;  1NU1 E;  1QVF O;  3KXD A;  2KSJ A;  1L0N D;  2XZ0 D;  5B66 E;  1GL2 D;  4N78 E;  1AFO A;  3TNU A;  4U0C A;  1SQX D;  2KOP A;  3MTU E;  2ZT9 C;  4H2X C;  1EDK A;  3UIA A;  2FXO A;  1S9K D;  3TNU B;  2OTJ P;  5AW7 B;  1JY3 O;  2QM7 A;  3RG2 A;  4MN4 C;  4IOI H;  2N6Y A;  1JO5 A;  3CPW O;  3L75 E;  3CWB E;  3VRL C;  2GM4 A;  3F5H A;  1MZ8 A;  4U0D A;  1EXJ A;  1GK6 A;  3GMA A;  2P9X A;  1J1D B;  1VF5 D;  3FX0 A;  1JOC A;  2VLN A;  1T3U A;  2QIW A;  3AEE C;  1BE3 G;  4XE5 B;  1EOQ A;  3L70 E;  1WT6 A;  4ZNC A;  3T97 B;  1PEM A;  2LKM A;  3C1L A;  1J1E C;  5APW A;  1KQL A;  1N86 A; 
#chains in the Genus database with same CATH homology
 2PEN A;  1VQ4 P;  1N8R Q;  1VQ7 P;  1A43 A;  1ZMB A;  2PEQ A;  3CCS P;  2ONT A;  1K9M Q;  3G6E P;  1M1K Q;  1AUM A;  3G71 P;  1VQ9 P;  1A8O A;  2LF4 A;  2PEI A;  1Q86 Q;  2BUO A;  5BS1 A;  1VQO P;  1VQL P;  4COC A;  2XT1 A;  3CXC O;  1QVG O;  1VQM P;  1YJ9 P;  1Q7Y Q;  5DCK A;  1IUQ A;  3DS0 A;  5HGM A;  3P05 A;  1E6J P;  4GR6 A;  1QRJ A;  2PEK A;  4XFY A;  3CCR P;  4U0B A;  2EFJ A;  2XV6 A;  3CCJ P;  3G1I A;  3WBH A;  1QVF O;  3DS2 A;  2L6E A;  2Z45 A;  1YI2 P;  4GR2 A;  2Z44 A;  2BHV A;  2Z46 A;  2OAR A;  2QEX P;  1S72 P;  1PEU A;  1NJI Q;  4QNB A;  1KQS O;  3CME P;  2JO0 A;  1M74 A;  3CC4 P;  3I56 P;  1YJN P;  3CC2 P;  1M90 Q;  3B5I A;  4COP A;  3CD6 P;  3CCQ P;  3OW2 O;  1W2B O;  3G1G A;  5BS2 A;  2DGY A;  4WYM A;  5HGL A;  1VQK P;  1RNI A;  3DTJ A;  3G28 A;  4U0C A;  3H4E A;  2PY8 A;  3H47 A;  1PEQ A;  2JYG A;  2M8P A;  3DPH A;  1M6E X;  1RO2 A;  4XRQ A;  1BAJ A;  4U0F A;  4XFZ A;  5F2K A;  2JYL A;  1KD1 Q;  3G26 A;  1YIT P;  3CCL P;  2OTJ P;  2EG5 A;  1YJW P;  1KC8 Q;  3CCE P;  3DS5 A;  4U0A A;  1EIA A;  1M6N A;  2E1M A;  2CWO A;  3E2D A;  2KOD A;  4U0E A;  5JPA A;  3CC7 P;  2BQ1 E;  2XXM A;  3CCM P;  2PEM A;  3CPW O;  1VQ6 P;  3G21 A;  3DS3 A;  1PEO A;  1K73 Q;  4IPY A;  3G4S P;  3VRL C;  3H0D A;  1VQN P;  2QA4 P;  3G0V A;  4XFX A;  3LRY A;  5HGO A;  3DS1 A;  1Q81 Q;  3CMA P;  1K30 A;  4U0D A;  5I4T G;  3CCU P;  1K8A Q;  1VQ5 P;  1Q82 Q;  3NTE A;  2P9X A;  1YIJ P;  4PH1 A;  3CCV P;  5F2N A;  2PEO A;  2EIA A;  4PH0 A;  3HZQ A;  3RG6 C;  4XRO A;  3I55 P;  1D1D A;  1EOQ A;  3G29 A;  5F2O A;  1YHQ P;  3HYB A;  3M1M A;  1VQP P;  4M0I A;  1VQ8 P;  2M8N A;  5HGN A;  1JJ2 O;  1PEM A;  3DS4 A;  2OTL P;  1RO0 A;  3MGE A;  2PEJ A;  3Q20 A;  2M8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...