1VQOP

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqoP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqoP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqoP02
3CCRP 1Q86Q 3I56P 3CCMP 1VQ8P 3OW2O 3CXCO 1K73Q 1JJ2O 1VQ5P 3CCQP 1VQKP 3CPWO 1N8RQ 1QVFO 3G4SP 1KC8Q 2QA4P 3CD6P 3CCVP 1M90Q 1VQ7P 3CC4P 3CCEP 1VQNP 1YJ9P 1M1KQ 1VQPP 1Q82Q 3G71P 1YIJP 1VQ9P 3CCLP 1QVGO 3CCSP 1KD1Q 1VQOP 2OTLP 1VQMP 1K9MQ 1YI2P 1NJIQ 3CCUP 1YJWP 1W2BO 3CCJP 1YITP 1Q81Q 2QEXP 1KQSO 3G6EP 1VQ4P 1VQLP 3CC2P 3CC7P 1VQ6P 3I55P 1Q7YQ 1YHQP 3CMEP 2OTJP 1K8AQ 1YJNP 1S72P 3CMAP
chains in the Genus database with same CATH superfamily
1VQKP 2O1JA 1DEBA 5EFWB 2IFNA 2W8ZA 3V4WA 2WITA 1AVYA 1VQOP 2WZ7A 2D2CB 4XFZA 1JOCA 1BDCA 5APWA 2C9LY 4GKGA 1HWTC 2V4HA 3A0BE 1BGYD 1L0LJ 2MJZA 2PY8A 3HE4B 5KAIE 2M5RA 2OQQA 2FY8A 3A5TA 1JNMA 1HGVA 5KAFE 4NPDA 2G3AA 3ABVC 1LP1B 1SQQG 4UB6H 2PGDA 2YO3A 5DJUB 4QNBA 1GD2E 1LJ2A 1T8KA 2MVUA 1YJNP 3DS1A 4EOTA 5TISH 3IFMA 3TK1A 3CWBJ 3CXCO 2JU1A 2WTYA 2SPZA 3C1LA 3MGEA 3HZQA 1EIAA 3H25A 4PXHB 2W6JH 2XZ1C 2ROQA 1S5LH 1NHLA 4OGQD 1ZR2A 4DJGA 5AVQB 1LWUC 1FZCC 2L9FA 2IFMA 1PP9G 4R4LA 1KYOE 2AFEA 1U57A 4H13B 2FXOA 2KOGA 1PGPA 2XNXA 2C0XA 3JCUE 4YPCA 1YJ9P 1AQTA 5AW2B 3G3ZA 1FZCB 3H1IE 3H1LD 1GW4A 2Y9ZA 1IMQA 1NTZG 5CCGD 1OIPA 1KB9E 3HE5B 2WSCH 4EDFA 2E5TA 3OW2O 1CI6A 3RK2C 5AVXB 4YTPC 3AE1C 3AE5C 2JYGA 1FJPA 4GODA 1AQ5A 2P58A 4C7NB 3CCUP 1LTIC 3CC2P 2KK7A 2HFED 1E79H 2Z4EA 4PV1D 1GW3A 4COCA 4NPEA 4EYYQ 1M74A 1M7LA 3AE2C 2L22A 5KAFH 2P10A 1FJKA 2GUSA 3L70E 3MUDC 1HTLC 2IYOA 3MIWA 4LC1A 4ZNCA 3AE8C 3A0HH 2GZFA 1SQXE 3MTUE 1UJZA 4QMAA 2E42A 2VLNA 1RHZB 3E1IA 3CLQA 2OTKE 4WYMA 1DV5A 1HJ0A 5KLIC 3BCCD 3M9HA 2J58A 3A0BH 1LTAC 2I8DA 5CCHC 2LKIA 3DS4A 2WSFH 4PH0A 2KODA 2JU2A 3L71G 1SLQA 2KG6A 3P8CE 4O9BA 1S5LE 3CWBD 3DS0A 2QM8A 1KYOH 1HVVA 1SQQK 3M1MA 4XA4A 1XTCC 2QM7A 2E74D 1K9MQ 1JM0A 2HG5D 5TISE 2ZT9C 2M3BA 1GU5A 2XT1A 3M91A 3E7KA 2LL8A 1S72P 1QVFO 4L75A 3RL0B 1L0LD 1QL1A 2R5BA 4HH2A 2FYUD 1M1KQ 3KYQA 3CXHI 2P2UA 3N4XA 1OVRA 1BSHA 4L74A 1KQGB 2WPRA 4XRQA 1FE6A 2G8YA 5APUA 3H1JJ 4D6TJ 3D71A 3BATA 2JKVA 2AEMA 3CXHH 3HTKA 2IBZD 2QE7H 3MUDA 2RH0A 1AF8A 1SQPJ 3CMEP 2DW3A 1OVUA 1LWUB 5CZDB 5AVTB 1SQXD 3AEFC 1VQ5P 1SVFA 2V7QJ 2PEMA 3L72J 1AVOA 5F2NA 2Q1KA 3W67A 1URQB 4WB4A 1YQ3C 4U0DA 2GDWA 1CSBA 1AJYA 4U0FA 4AUWA 3LRYA 2GUVA 1SQPK 2IBZE 1UIIA 2POHA 3GZLA 1Q90D 3R4YA 2M3EA 3HUSA 3QWOC 4EIJA 3CCSP 2LF4A 2WSFJ 1HGZA 2GDYA 3H1JG 3U43A 3T97A 2Q3EA 1BAJA 4UB6E 4W7YA 1A02F 2P1JA 1FDOA 1Q2NA 2YMYA 1KFMA 4H2XC 1SQPG 3H1KD 2XV5A 3B5NC 2H89C 4IL6X 2JWDA 4WY4A 4JBZA 1VQ6P 2AFDA 3EJDA 2M5AB 1GL2A 1NU1D 2BHVA 2O1KA 5B5EE 3L74D 2LIWA 2KXPB 1GL2D 3O6QA 1A43A 2KNCB 3CCJP 1VQLP 5KKZC 1ZXGA 5CBNA 3TGUE 4GR6A 1JCCA 1JB0J 1LP1A 3CMAP 4Y99B 1X22A 1DNYA 4KJMA 4BWNA 2Y0CA 1ZW0A 1QX8A 3B5IA 2K9YA 2E76B 5BVZA 5AW0B 3SFEC 1KZUB 2GA1A 1VQ7P 2OYIB 1FBMA 1PEMA 3I56P 3KPEA 3SFDC 3TGUG 1N73A 1GXGA 2A45G 3NFQA 2D2CC 2M8RA 2FKWB 1IC2A 4F37A 3HYBA 1DX7A 2L91A 1NTKK 3I5CA 5KKZB 1LTJC 2HYNA 1GDTA 1PEOA 1L0NK 2NPSD 5KP6B 1K73Q 1BE3E 3L73D 2B87A 1P84I 1AYIA 3V5BA 3A0HE 3BASA 1NTMD 5AVWB 4OGQC 1HJBA 3VMXA 3U1CA 3G71P 4H2WC 1NJIQ 1BCCE 3E2DA 2P7JA 2XNDH 1SQVJ 3CE7A 2FXMA 3L74E 1UIXA 5AW1B 1NAFA 3VP9A 1NU1E 1N7SB 3AE4C 1A02J 3JC22 2BCCE 3RL0D 1IO4A 2ZXEB 3OJAB 2NO8A 2ZT9D 1IFIA 1NTMK 1PIXA 1DH3A 3FXEA 3OA7A 1S2EA 5CCHA 3R2PA 1M56D 2VSQA 3H1KE 1IFPA 2C9NY 2IPPA 1IK9A 2FYUK 1FZFA 5CCGC 1WMKA 2WT7B 1GPJA 1NH4A 2WPTA 1Q82Q 1YIJP 1VQ9P 1NU1G 3M0DC 2LOLA 5F2OA 1H0TA 1T8ZA 4D6TG 4XE5B 2MR8A 5I4TG 3B71A 2RN0A 3EFGA 1N73C 1KQFB 2N50A 5KLVD 4BPHA 1ZRTE 1LT9B 1OW6A 3CI9A 3H1KG 1UNKA 2QJKC 1EZVE 3V4QA 3GF3A 5KP8B 1URQD 1SQPE 2PFXA 2HPCB 2Q6QA 2KYVA 3P05A 2K88A 2FVEA 2CWOA 2N6YA 1URQA 1KN7A 5KLVK 1QRJA 3FX0A 1L4AB 1KMIZ 1X9VA 2M8LA 4ZMDA 3G1IA 3AE6C 4XFJA 3ITKA 1M8OB 4BRYB 1JMMA 1SQPD 5KLVE 3KZIH 4A7PA 1MKMA 1RO0A 2XU6A 2KS1B 1FZCA 5TJHA 2N9YB 1XTGB 2Y9YA 5APQA 1ZLLA 2IZ0A 1SQVE 4EI2A 4PJ0H 2PEJA 4I1LA 3TNUA 1W2EA 3WUVA 1FDIA 3BVHA 3EJEA 3BCCJ 2A45H 1NTKD 2BUOA 1RQUA 2HR3A 1M1JA 4D6TD 1W2BO 1GL2B 1K30A 3H32B 1KFNA 2JR8A 1BXIA 1JY3N 3Q2YA 3RL0g 3L36A 3AEDC 2FADA 1SQVG 2ZAEB 1GU4A 4IFDK 1J1DB 1PGOA 3VN0A 2JQ4A 3FGAD 1H88A 5AVSB 1JY2P 5BS2A 2QIWA 2Z46A 4N3YB 1VL2A 2NZ2A 2K2QA 2JAZA 1SQXJ 4ASVA 4JPZB 2E5YA 2KIKA 1JUNA 4WBAA 2E76D 2QJKB 5AVYB 3MP7B 4BPGA 1GL2C 3Q3DA 3RK2D 4IZ6A 1EOQA 1NU1J 3DS2A 1T2KC 2FAEA 2ZXXA 2K92A 1NKNA 1BCCJ 4U3FJ 2VLPA 1DEEG 5APVA 1PV3A 5BU5A 3L70D 4TT3H 2CGQA 3HUSC 4I7ZC 3VMYA 1ZR4A 5CHXA 3L37A 1VDFA 1J2JB 1JTHA 2NPSB 4C7NA 1L0HA 4IL6H 5B66E 3CXHD 4NPFX 5AVZB 3CC7P 3G28A 3G26A 4UHPB 2YKPA 4JYCA 1CI6B 3EJBA 2K37A 4DG9A 1RF0C 4DT0A 3L4FA 5GTIE 1N7SD 1KQLA 1PP9E 3BRTB 2PEIA 2VLOA 1Q81Q 2ZT9B 5DCKA 3H1LE 1PGQA 3NXSA 3L74J 4L76A 2OYHA 1R8EA 2FYZA 1NTZE 4JQ0D 2WQYC 1RF0A 1VHNA 3G4SP 4XFYA 1NKZB 1MZ8A 1KC8Q 2FQ0A 3H1HD 3H1ID 3RK3B 2BCCD 2FVAA 3KDPB 2YXQB 1FZAA 4COPA 4N6JA 4Z1MH 2AF8A 4U0EA 3GKLC 3B5NB 2W27A 1RY3A 3RK3E 1WT6A 3L35A 2KGDA 2LMLA 1HBWA 4LLHA 1PP9D 3TSIA 3M9QA 3RK3C 1QVGO 2IBZG 1PPJE 2YIUB 4U0AA 2NPSA 2AEFA 2Z44A 2ERHA 2E76C 2C0WA 1N2DC 1JMBA 3HE4A 1RH5B 1OWAA 2R3SA 1QEXA 3VMZA 1PL5A 2XZRA 3L70G 1NGMB 3TNUB 1NYHA 2QJPB 5KLIB 3S1KA 5K5GB 2LR2A 1SQXG 5AVVB 2OGUA 2L5GB 3WBHA 1JEKA 4U3FE 3CXHE 1L4AD 5B66H 1NOHA 4CA3A 3DPHA 2EG5A 1NTMJ 4W80A 1VF5D 1QL2A 3Q1MA 3K5BA 1Z56A 1HUCA 1G2CA 3RBZA 4RJTA 5APYA 3HE5A 4UB8E 3A3YB 3IAOA 3CCEP 2WWWA 1ZOYC 3HRNA 1S9KD 1H8AA 2ZYDA 2OARA 3G0VA 1ZN5A 1PEUA 1YI2P 1OVVA 1YQ4C 2K0XA 4M0IA 4U3FG 1RE3C 1EDIA 3WU2E 2KW2A 1MZ9A 7CEIA 2CG5B 5C39A 2KSJA 3V6IA 2N1TD 5H2FH 5AW8B 1ZV8A 2FQ1A 3AEGC 3D6YA 3UIAA 2DNWA 1L0LE 2PAJA 3G21A 2N9BA 2GZJA 3M0DA 4H0LC 3L73J 1LTJB 5EJDA 2H7HA 1IUQA 1SQBK 1FOSE 4PJ0E 3CD6P 3H1JD 2KOPA 3GHGA 5AW5B 3D6ZA 2R5DA 2H88C 3F5HA 3S4RA 3H32A 4PD4H 1EXJA 5KLVJ 1F80D 2O01H 5AVRB 5HVCA 1VQ4P 1SQVD 4Y99C 1CW5A 3EQ2A 2YIUC 3CWBE 1YTZT 2O3JA 2XXMA 4BRYA 3L71J 2N6ZA 2FHSC 3AE9C 3M0AA 2IX7C 3RK2B 2UWJE 3QH9A 2B87B 3JSVC 3V2QA 1ZMEC 2ZVOB 2KORA 1EQ7A 3AEEC 2FXPA 2FFDB 1LT1A 1L0NJ 2R3CA 5L8RJ 4C46A 2ZYGA 1T2KD 2N5IA 3V2PA 2K0YA 2H43A 5CJ0A 1FR2A 2KOOA 4OVNF 1M57D 3PHLA 1FZEA 4JYBA 2GDXA 3H1IJ 4HYTB 1SQVK 1T3UA 2Z45A 1LGHB 1YJWP 2Y0DA 2W83C 1GZLA 2OYIC 2PEOA 2GZGA 3G29A 1JY2N 3VRLC 2AXTH 3PH0A 3N7NA 2KP8A 3WU2H 2E75C 3H4EA 1SQXK 3HD7D 5KJ7D 2OYHC 1VKUA 2KGCA 1EZVD 2ITAA 1KD1Q 2WSEH 4H0LB 1FU1A 1USEA 5E79H 4R4MA 1OX3A 2PNGA 1RE4C 3P7KA 2GZIA 3GZMA 3G1GA 1D1DA 1R5LA 3H6PA 1BSNA 4YXDC 3SWYA 1CEIA 4PD4I 3TF5A 2JGPA 4MRTC 3RG2A 3RK3D 2KGEA 5HGMA 5GTIH 3IF4A 2FFDC 4PD4E 1FZBA 2W6BA 3GHGB 2M0BA 3V2NA 4BPFA 3MZWB 2ZFCA 1L0LK 2E74C 3WUUA 4OWFA 5HGNA 3B5ND 2E75B 2JP3A 1VQPP 1IMPA 3AEBC 2GM4A 1LNQA 1KV4A 1RF1C 3L73G 3G6EP 2P9XA 3C8VA 1Q7YQ 4Y28J 2PRRA 4U7JA 1FAVA 1NTME 3A7OA 1BCCD 1IJDB 1IFNA 1NTKJ 5KLVG 2L0QA 3L70J 4IOIH 3H1HJ 1NTZJ 4MN4C 5HV8A 1VQMP 1PGJA 2MVVA 2Q5UA 3NTEA 2YKQA 1X8YA 3GW6A 2HPCA 4AYCA 1BE3D 3L73E 1VF5B 3IN6A 1L0LG 2R44A 2KOSA 4CPGA 2WVRA 3NTNA 3T97B 2PENA 2KI7B 3PP5A 2FYUG 1KILC 1ZNVA 1M6NA 3HUSB 1VF5C 3LIDA 4I7ZB 2LXBA 2A06E 3TYYA 1Y9BA 2N5HA 3CX5I 2IDBA 2CK3H 3NMDA 1Q86Q 1LTSC 4W7ZA 2BQ1E 3EWKA 3L74G 5KTBA 3SWFA 3B4QA 1JTHB 2RMZA 1HF9A 3TGUJ 3WUTA 1TU3F 4NEOA 4U3FD 1MFTA 2N1TB 1EXIA 2AXTE 1K04A 3FWNA 2BCCG 4UB8H 3FWLA 3HD7A 2K9JA 5KJ7A 3F89A 3W68A 1NTKG 5F2KA 5CJ4A 2NRGA 3H47A 3KZIE 5CCHD 2E1MA 2N1TC 1L0ND 4WWIA 1M90Q 1RO2A 1R5SA 2AXCA 3G9RA 5E79E 1FOSF 1M1JB 1RF1A 1JY3P 1PPJD 4M3LA 1EDKA 2MF4A 1FDMA 2MKVA 2BEZF 3O6QB 2JJLA 2EHTA 2ZJSE 3H1KJ 4D6TE 1RF1B 2NPSC 1H89A 1KILB 1S3JA 1G1IA 1NTKE 1ACPA 2HLOA 3CCLP 3LW5J 1AFOA 4B86A 2IYPA 2XDJA 4PV1C 3RL0C 2VRSA 2W6AA 1S1CX 3GF7A 3MD0A 4TLFA 2PEQA 1NWQA 2QJPC 4U0CA 3HD7C 1KB9I 5KJ7C 2E43A 2YO2A 2KZJA 1YITP 1EC5A 2WPQA 1P84D 2KLUA 3H1LG 2CPSA 1AA0A 2FACA 1J1DC 2JBGA 3HD7B 4K3AA 1GXHA 4HB1A 2HODA 1W5CE 2N98A 2L4BA 3B8EB 4H0LD 4HJGH 3Q20A 4I2LC 1IFJA 3L72G 5KAIH 2K5XA 1FS0E 3SSUA 1JJ2O 3II6A 4GDOA 2K0DX 3TDKA 1IFDA 1OFCX 3LMOA 1LT9C 1KLPA 1BDDA 5DJTB 2OYOA 1QLED 1G1JA 2JEEA 4IL6E 3BRVB 1L2PA 3E1RA 2OTJP 3HTKB 1PPJG 1IFMA 3DS3A 1X79B 2QSIA 3CX5H 4ZKPA 3GHGC 3SWKA 1SQQD 2FYNC 3L72E 1LT9A 2GZEA 5AVUB 2E75D 2KWLA 2WPSA 4PH1A 2IBZI 4R0MA 4H13C 4C7RA 2YKOA 2FYUE 2KR5A 1BGYG 4QKOA 4U0BA 3KQGA 1DD3A 4GR2A 3CCVP 2CQ8A 1K05A 1SFCB 3L71E 4RO0A 2KZIA 3BCCG 2M5AA 2WSSH 4RKUJ 3LIEA 2CNRA 1NO4A 2JWAA 1X0TA 3I55P 2MD9A 2RKLA 4H44B 2YMKA 2LIUA 2LPKA 1GK4A 1SQQE 3L75J 1KTMA 3CC4P 2KG8A 5AW3B 2R32A 4WY4C 1N7LA 2X2BA 3VP8A 2KSEA 3LW5H 3AE7C 1PZQA 5EW5E 2MY5A 1E5WA 5BS1A 3BCCE 3VMAA 4OH8B 5APXA 3CL3D 1GTWA 3USSA 1FZGA 2KS1A 5KP7B 2GYKA 2AEJA 2ONTA 3PLNA 2XZ0D 2WSEJ 3MGNA 4IPYA 2O01N 3CCMP 1MFZA 3P32A 1A8OA 2FVFA 4L73A 3RBXA 2CPBA 1N73B 2LTEA 3B5NA 3Q5PA 4GOFA 1KORA 1OXZA 4ASWA 2WMMA 2KGAA 4N78E 1IK7A 3VTPC 1SQBD 5HGOA 2QVAA 2WT7A 1KILD 3B4SA 5H2FE 5HGLA 1OZHA 1LTJA 2DGYA 3CX5E 1KYOD 1NU1K 1T6AA 4GT1A 1SQBG 1NTZK 1NTZD 1WRGA 3U1AA 5AW4B 2QNWA 5GTHH 3CX5D 1E0HA 3O8ZA 3H1JE 1Z6MA 4GOEA 2OYHB 1IZNB 3H1HE 3H0DA 2J5UA 3RG6C 1PFIA 1L0NE 1M6EX 1NVOA 3C9IA 3L75E 4WY4D 1N8RQ 1KILE 1KILA 1YTZI 4DOJA 1PEQA 3PRJA 1SQBE 4DZOA 1J1EB 1KYOI 2K94A 1EMVA 1G2CB 1YBKA 1EDLA 1SP4A 1BGYJ 1KQSO 5CMZA 1RNIA 2K9JB 2K3RA 4JF7A 3S9OA 5AW7B 2Q3IA 3AE3C 3PTZA 1U7MA 2WPVB 1LTTC 3IR9A 3VYIA 1P84H 1BGYE 2M8NA 5JPAA 3L75G 5AW6B 2ZVNB 1LTBC 2A06D 3Q5RA 3GG2A 4HKGA 2B88A 1JO5A 2XKMA 2N1TA 1OW8A 3RGUA 2FFDA 1D7MA 2B89A 2QJYB 3M9BA 2D2CD 4XFXA 5APSA 3L75D 1GMJA 1NTMG 2AVAA 1CZQA 2OYIA 1YHQP 1HH0A 1JCDA 1OW7A 1ZMBA 2H8PD 1USDA 2P67A 2B9BA 1DD4A 2FYNB 2JYLA 4PWVB 1T3JA 3NY7B 2FBWC 2Z5IA 3FXDA 3TGUD 2QG4A 3CWBG 2Q7CA 2KG9A 3L71D 3DS5A 2A45I 2IZ1A 1SFCD 1BE3G 1EZVI 1Y47A 2V7QH 3DTJA 2QEXP 1URQC 5B5EH 1SS1A 1AUMA 3CPWO 2LKMA 2ZYAA 4H44D 4LGDE 3GJNA 4IFMA 2JO1A 3D70A 4N78D 3GMAA 4OGQB 1MV8A 2QRXA 1MUUA 2BEQD 4PD4D 4YXWH 3P8CD 1N7SA 5GTHE 4H44C 4H13D 1S4XA 2K93A 3AECC 1M1JC 2K1AA 1S5LX 4GIFA 3CCQP 4ZKUA 5BU8B 3L72D 2O01J 1L4AC 3MHVA 1J1EC 2PEKA 1SFCC 2I1JA 2QJYC 1SQBJ 4WVZA 2KOQA 1Y8AA 1ZP0C 2JO0A 1JY2O 4KHXA 1QGKB 2LXCB 1RQVA 1FC2C 1LWUA 2BCCJ 1U7JA 2VLQA 1HY8A 1OR5A 4PV1B 2W90A 2Y0EA 2EHSA 1SQQJ 4HKZH 2JDIH 1P84E 2Q9IA 1ZRTD 1VQ8P 3H1HG 1EZVG 5CCGA 2KB7P 3H1IG 1L0NG 2QA4P 1LTGC 2FQ2A 5APTA 1PP9J 4XROA 2MR7A 3EFFK 1RE3A 2M8PA 5M1BA 1L0IA 1KB9D 4K35A 3A2AA 2XV6A 1SFCA 5AW9B 3U59A 2FYUJ 4IFFA 2KNCA 2KLVA 3PJSK 2EIAA 1H0TB 2OTLP 3Q5SA 5CBOA 3KHUA 1AV1A 3P8MC 2L6EA 1N7SC 3WMM0 1HQBA 1K8AQ 2J59M 3AEAC 1GK6A 4H2YC 1X3OA 1KB9H 3VOPA 4DCKA 4BXLA 4WY4B 1BE3J 2E74B 1E6JP 2Z5HA 3KXDA 2YXRB 4AQRD 2BASA 2YNYA 3OAKA 1NAYA 1N86A 4KT0J 2KUBA 3H1LJ 1JY3O 1RE4A 2WSCJ 1EDJA 1YYCA 3CCRP 3M06A 2A06G 1OMIA 2PP6A 3JCUH 3GLMA 1DIPA 1BCCG 1L4AA 4RESB 3ZDMA 2JB0A 2I1KA 1S9KE 1VPCA 2EFJA 1VQNP 3V2RA 2HODB 1NQ4A 4I6MC
chains in the Genus database with same CATH topology
1PEOA 3G1GA 1D1DA 1ZMBA 3P05A 1Q86Q 1VQ8P 3OW2O 1K73Q 1VQKP 2BQ1E 2CWOA 1EOQA 3DS2A 1IUQA 2JYLA 2QA4P 2JYGA 3CD6P 1QRJA 3CC4P 4XROA 1M1KQ 3G71P 3DS5A 1QVGO 1VQOP 4U0AA 4XFZA 2M8LA 5HGMA 3G1IA 1NJIQ 3CCUP 2Z44A 3E2DA 1VQ4P 3CC2P 3H0DA 2M8PA 1VQ6P 3RG6C 3Q20A 5BS1A 3DTJA 1M6EX 4XRQA 2XV6A 2QEXP 5F2KA 1RO0A 2PY8A 3H47A 1JJ2O 2XXMA 1AUMA 2E1MA 4COCA 3CPWO 1N8RQ 5HGNA 2BHVA 1PEQA 1M74A 1M90Q 1RO2A 1VQPP 3WBHA 2EIAA 2OTLP 1A43A 2L6EA 4QNBA 3CCJP 1KQSO 3G28A 3CC7P 1VQLP 3G6EP 2P9XA 3G26A 3DPHA 2EG5A 1RNIA 1Q7YQ 4GR6A 2ONTA 3CMEP 2OTJP 1K8AQ 1YJNP 3DS1A 2PEJA 3DS3A 3CMAP 4IPYA 3CCMP 3CXCO 1VQ5P 3CCQP 4WYMA 2PEMA 1A8OA 5F2NA 2M8NA 3CCEP 2BUOA 1E6JP 2PEKA 1Q82Q 1YIJP 5JPAA 1VQ9P 3CCLP 3MGEA 4U0DA 2PEIA 3HZQA 4PH1A 2OARA 1EIAA 3G0VA 2Z45A 3B5IA 5F2OA 1VQMP 1PEUA 3DS4A 1YI2P 1YJWP 1W2BO 1Q81Q 4PH0A 1K30A 5DCKA 5I4TG 4U0FA 2KODA 2PEOA 2JO0A 3G29A 4M0IA 3NTEA 3LRYA 1VQ7P 3VRLC 3CCRP 1PEMA 3DS0A 3I56P 2PEQA 4U0BA 3H4EA 4XFYA 3G4SP 1KC8Q 4GR2A 4U0CA 3CCVP 4XFXA 5BS2A 2PENA 1YJ9P 5HGOA 2Z46A 1KD1Q 3CCSP 2LF4A 3M1MA 3HYBA 4COPA 5HGLA 1K9MQ 2EFJA 1M6NA 1VQNP 2DGYA 1YITP 4U0EA 3I55P 1BAJA 2XT1A 3G21A 1YHQP 1S72P 1QVFO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR P;  1Q86 Q;  3I56 P;  3CCM P;  1VQ8 P;  3OW2 O;  3CXC O;  1K73 Q;  1JJ2 O;  1VQ5 P;  3CCQ P;  1VQK P;  3CPW O;  1N8R Q;  1QVF O;  3G4S P;  1KC8 Q;  2QA4 P;  3CD6 P;  3CCV P;  1M90 Q;  1VQ7 P;  3CC4 P;  3CCE P;  1VQN P;  1YJ9 P;  1M1K Q;  1VQP P;  1Q82 Q;  3G71 P;  1YIJ P;  1VQ9 P;  3CCL P;  1QVG O;  3CCS P;  1KD1 Q;  1VQO P;  2OTL P;  1VQM P;  1K9M Q;  1YI2 P;  1NJI Q;  3CCU P;  1YJW P;  1W2B O;  3CCJ P;  1YIT P;  1Q81 Q;  2QEX P;  1KQS O;  3G6E P;  1VQ4 P;  1VQL P;  3CC2 P;  3CC7 P;  1VQ6 P;  3I55 P;  1Q7Y Q;  1YHQ P;  3CME P;  2OTJ P;  1K8A Q;  1YJN P;  1S72 P;  3CMA P; 
#chains in the Genus database with same CATH topology
 1VQK P;  2O1J A;  1DEB A;  5EFW B;  2IFN A;  2W8Z A;  3V4W A;  2WIT A;  1AVY A;  1VQO P;  2WZ7 A;  2D2C B;  4XFZ A;  1JOC A;  1BDC A;  5APW A;  2C9L Y;  4GKG A;  1HWT C;  2V4H A;  3A0B E;  1BGY D;  1L0L J;  2MJZ A;  2PY8 A;  3HE4 B;  5KAI E;  2M5R A;  2OQQ A;  2FY8 A;  3A5T A;  1JNM A;  1HGV A;  5KAF E;  4NPD A;  2G3A A;  3ABV C;  1LP1 B;  1SQQ G;  4UB6 H;  2PGD A;  2YO3 A;  5DJU B;  4QNB A;  1GD2 E;  1LJ2 A;  1T8K A;  2MVU A;  1YJN P;  3DS1 A;  4EOT A;  5TIS H;  3IFM A;  3TK1 A;  3CWB J;  3CXC O;  2JU1 A;  2WTY A;  2SPZ A;  3C1L A;  3MGE A;  3HZQ A;  1EIA A;  3H25 A;  4PXH B;  2W6J H;  2XZ1 C;  2ROQ A;  1S5L H;  1NHL A;  4OGQ D;  1ZR2 A;  4DJG A;  5AVQ B;  1LWU C;  1FZC C;  2L9F A;  2IFM A;  1PP9 G;  4R4L A;  1KYO E;  2AFE A;  1U57 A;  4H13 B;  2FXO A;  2KOG A;  1PGP A;  2XNX A;  2C0X A;  3JCU E;  4YPC A;  1YJ9 P;  1AQT A;  5AW2 B;  3G3Z A;  1FZC B;  3H1I E;  3H1L D;  1GW4 A;  2Y9Z A;  1IMQ A;  1NTZ G;  5CCG D;  1OIP A;  1KB9 E;  3HE5 B;  2WSC H;  4EDF A;  2E5T A;  3OW2 O;  1CI6 A;  3RK2 C;  5AVX B;  4YTP C;  3AE1 C;  3AE5 C;  2JYG A;  1FJP A;  4GOD A;  1AQ5 A;  2P58 A;  4C7N B;  3CCU P;  1LTI C;  3CC2 P;  2KK7 A;  2HFE D;  1E79 H;  2Z4E A;  4PV1 D;  1GW3 A;  4COC A;  4NPE A;  4EYY Q;  1M74 A;  1M7L A;  3AE2 C;  2L22 A;  5KAF H;  2P10 A;  1FJK A;  2GUS A;  3L70 E;  3MUD C;  1HTL C;  2IYO A;  3MIW A;  4LC1 A;  4ZNC A;  3AE8 C;  3A0H H;  2GZF A;  1SQX E;  3MTU E;  1UJZ A;  4QMA A;  2E42 A;  2VLN A;  1RHZ B;  3E1I A;  3CLQ A;  2OTK E;  4WYM A;  1DV5 A;  1HJ0 A;  5KLI C;  3BCC D;  3M9H A;  2J58 A;  3A0B H;  1LTA C;  2I8D A;  5CCH C;  2LKI A;  3DS4 A;  2WSF H;  4PH0 A;  2KOD A;  2JU2 A;  3L71 G;  1SLQ A;  2KG6 A;  3P8C E;  4O9B A;  1S5L E;  3CWB D;  3DS0 A;  2QM8 A;  1KYO H;  1HVV A;  1SQQ K;  3M1M A;  4XA4 A;  1XTC C;  2QM7 A;  2E74 D;  1K9M Q;  1JM0 A;  2HG5 D;  5TIS E;  2ZT9 C;  2M3B A;  1GU5 A;  2XT1 A;  3M91 A;  3E7K A;  2LL8 A;  1S72 P;  1QVF O;  4L75 A;  3RL0 B;  1L0L D;  1QL1 A;  2R5B A;  4HH2 A;  2FYU D;  1M1K Q;  3KYQ A;  3CXH I;  2P2U A;  3N4X A;  1OVR A;  1BSH A;  4L74 A;  1KQG B;  2WPR A;  4XRQ A;  1FE6 A;  2G8Y A;  5APU A;  3H1J J;  4D6T J;  3D71 A;  3BAT A;  2JKV A;  2AEM A;  3CXH H;  3HTK A;  2IBZ D;  2QE7 H;  3MUD A;  2RH0 A;  1AF8 A;  1SQP J;  3CME P;  2DW3 A;  1OVU A;  1LWU B;  5CZD B;  5AVT B;  1SQX D;  3AEF C;  1VQ5 P;  1SVF A;  2V7Q J;  2PEM A;  3L72 J;  1AVO A;  5F2N A;  2Q1K A;  3W67 A;  1URQ B;  4WB4 A;  1YQ3 C;  4U0D A;  2GDW A;  1CSB A;  1AJY A;  4U0F A;  4AUW A;  3LRY A;  2GUV A;  1SQP K;  2IBZ E;  1UII A;  2POH A;  3GZL A;  1Q90 D;  3R4Y A;  2M3E A;  3HUS A;  3QWO C;  4EIJ A;  3CCS P;  2LF4 A;  2WSF J;  1HGZ A;  2GDY A;  3H1J G;  3U43 A;  3T97 A;  2Q3E A;  1BAJ A;  4UB6 E;  4W7Y A;  1A02 F;  2P1J A;  1FDO A;  1Q2N A;  2YMY A;  1KFM A;  4H2X C;  1SQP G;  3H1K D;  2XV5 A;  3B5N C;  2H89 C;  4IL6 X;  2JWD A;  4WY4 A;  4JBZ A;  1VQ6 P;  2AFD A;  3EJD A;  2M5A B;  1GL2 A;  1NU1 D;  2BHV A;  2O1K A;  5B5E E;  3L74 D;  2LIW A;  2KXP B;  1GL2 D;  3O6Q A;  1A43 A;  2KNC B;  3CCJ P;  1VQL P;  5KKZ C;  1ZXG A;  5CBN A;  3TGU E;  4GR6 A;  1JCC A;  1JB0 J;  1LP1 A;  3CMA P;  4Y99 B;  1X22 A;  1DNY A;  4KJM A;  4BWN A;  2Y0C A;  1ZW0 A;  1QX8 A;  3B5I A;  2K9Y A;  2E76 B;  5BVZ A;  5AW0 B;  3SFE C;  1KZU B;  2GA1 A;  1VQ7 P;  2OYI B;  1FBM A;  1PEM A;  3I56 P;  3KPE A;  3SFD C;  3TGU G;  1N73 A;  1GXG A;  2A45 G;  3NFQ A;  2D2C C;  2M8R A;  2FKW B;  1IC2 A;  4F37 A;  3HYB A;  1DX7 A;  2L91 A;  1NTK K;  3I5C A;  5KKZ B;  1LTJ C;  2HYN A;  1GDT A;  1PEO A;  1L0N K;  2NPS D;  5KP6 B;  1K73 Q;  1BE3 E;  3L73 D;  2B87 A;  1P84 I;  1AYI A;  3V5B A;  3A0H E;  3BAS A;  1NTM D;  5AVW B;  4OGQ C;  1HJB A;  3VMX A;  3U1C A;  3G71 P;  4H2W C;  1NJI Q;  1BCC E;  3E2D A;  2P7J A;  2XND H;  1SQV J;  3CE7 A;  2FXM A;  3L74 E;  1UIX A;  5AW1 B;  1NAF A;  3VP9 A;  1NU1 E;  1N7S B;  3AE4 C;  1A02 J;  3JC2 2;  2BCC E;  3RL0 D;  1IO4 A;  2ZXE B;  3OJA B;  2NO8 A;  2ZT9 D;  1IFI A;  1NTM K;  1PIX A;  1DH3 A;  3FXE A;  3OA7 A;  1S2E A;  5CCH A;  3R2P A;  1M56 D;  2VSQ A;  3H1K E;  1IFP A;  2C9N Y;  2IPP A;  1IK9 A;  2FYU K;  1FZF A;  5CCG C;  1WMK A;  2WT7 B;  1GPJ A;  1NH4 A;  2WPT A;  1Q82 Q;  1YIJ P;  1VQ9 P;  1NU1 G;  3M0D C;  2LOL A;  5F2O A;  1H0T A;  1T8Z A;  4D6T G;  4XE5 B;  2MR8 A;  5I4T G;  3B71 A;  2RN0 A;  3EFG A;  1N73 C;  1KQF B;  2N50 A;  5KLV D;  4BPH A;  1ZRT E;  1LT9 B;  1OW6 A;  3CI9 A;  3H1K G;  1UNK A;  2QJK C;  1EZV E;  3V4Q A;  3GF3 A;  5KP8 B;  1URQ D;  1SQP E;  2PFX A;  2HPC B;  2Q6Q A;  2KYV A;  3P05 A;  2K88 A;  2FVE A;  2CWO A;  2N6Y A;  1URQ A;  1KN7 A;  5KLV K;  1QRJ A;  3FX0 A;  1L4A B;  1KMI Z;  1X9V A;  2M8L A;  4ZMD A;  3G1I A;  3AE6 C;  4XFJ A;  3ITK A;  1M8O B;  4BRY B;  1JMM A;  1SQP D;  5KLV E;  3KZI H;  4A7P A;  1MKM A;  1RO0 A;  2XU6 A;  2KS1 B;  1FZC A;  5TJH A;  2N9Y B;  1XTG B;  2Y9Y A;  5APQ A;  1ZLL A;  2IZ0 A;  1SQV E;  4EI2 A;  4PJ0 H;  2PEJ A;  4I1L A;  3TNU A;  1W2E A;  3WUV A;  1FDI A;  3BVH A;  3EJE A;  3BCC J;  2A45 H;  1NTK D;  2BUO A;  1RQU A;  2HR3 A;  1M1J A;  4D6T D;  1W2B O;  1GL2 B;  1K30 A;  3H32 B;  1KFN A;  2JR8 A;  1BXI A;  1JY3 N;  3Q2Y A;  3RL0 g;  3L36 A;  3AED C;  2FAD A;  1SQV G;  2ZAE B;  1GU4 A;  4IFD K;  1J1D B;  1PGO A;  3VN0 A;  2JQ4 A;  3FGA D;  1H88 A;  5AVS B;  1JY2 P;  5BS2 A;  2QIW A;  2Z46 A;  4N3Y B;  1VL2 A;  2NZ2 A;  2K2Q A;  2JAZ A;  1SQX J;  4ASV A;  4JPZ B;  2E5Y A;  2KIK A;  1JUN A;  4WBA A;  2E76 D;  2QJK B;  5AVY B;  3MP7 B;  4BPG A;  1GL2 C;  3Q3D A;  3RK2 D;  4IZ6 A;  1EOQ A;  1NU1 J;  3DS2 A;  1T2K C;  2FAE A;  2ZXX A;  2K92 A;  1NKN A;  1BCC J;  4U3F J;  2VLP A;  1DEE G;  5APV A;  1PV3 A;  5BU5 A;  3L70 D;  4TT3 H;  2CGQ A;  3HUS C;  4I7Z C;  3VMY A;  1ZR4 A;  5CHX A;  3L37 A;  1VDF A;  1J2J B;  1JTH A;  2NPS B;  4C7N A;  1L0H A;  4IL6 H;  5B66 E;  3CXH D;  4NPF X;  5AVZ B;  3CC7 P;  3G28 A;  3G26 A;  4UHP B;  2YKP A;  4JYC A;  1CI6 B;  3EJB A;  2K37 A;  4DG9 A;  1RF0 C;  4DT0 A;  3L4F A;  5GTI E;  1N7S D;  1KQL A;  1PP9 E;  3BRT B;  2PEI A;  2VLO A;  1Q81 Q;  2ZT9 B;  5DCK A;  3H1L E;  1PGQ A;  3NXS A;  3L74 J;  4L76 A;  2OYH A;  1R8E A;  2FYZ A;  1NTZ E;  4JQ0 D;  2WQY C;  1RF0 A;  1VHN A;  3G4S P;  4XFY A;  1NKZ B;  1MZ8 A;  1KC8 Q;  2FQ0 A;  3H1H D;  3H1I D;  3RK3 B;  2BCC D;  2FVA A;  3KDP B;  2YXQ B;  1FZA A;  4COP A;  4N6J A;  4Z1M H;  2AF8 A;  4U0E A;  3GKL C;  3B5N B;  2W27 A;  1RY3 A;  3RK3 E;  1WT6 A;  3L35 A;  2KGD A;  2LML A;  1HBW A;  4LLH A;  1PP9 D;  3TSI A;  3M9Q A;  3RK3 C;  1QVG O;  2IBZ G;  1PPJ E;  2YIU B;  4U0A A;  2NPS A;  2AEF A;  2Z44 A;  2ERH A;  2E76 C;  2C0W A;  1N2D C;  1JMB A;  3HE4 A;  1RH5 B;  1OWA A;  2R3S A;  1QEX A;  3VMZ A;  1PL5 A;  2XZR A;  3L70 G;  1NGM B;  3TNU B;  1NYH A;  2QJP B;  5KLI B;  3S1K A;  5K5G B;  2LR2 A;  1SQX G;  5AVV B;  2OGU A;  2L5G B;  3WBH A;  1JEK A;  4U3F E;  3CXH E;  1L4A D;  5B66 H;  1NOH A;  4CA3 A;  3DPH A;  2EG5 A;  1NTM J;  4W80 A;  1VF5 D;  1QL2 A;  3Q1M A;  3K5B A;  1Z56 A;  1HUC A;  1G2C A;  3RBZ A;  4RJT A;  5APY A;  3HE5 A;  4UB8 E;  3A3Y B;  3IAO A;  3CCE P;  2WWW A;  1ZOY C;  3HRN A;  1S9K D;  1H8A A;  2ZYD A;  2OAR A;  3G0V A;  1ZN5 A;  1PEU A;  1YI2 P;  1OVV A;  1YQ4 C;  2K0X A;  4M0I A;  4U3F G;  1RE3 C;  1EDI A;  3WU2 E;  2KW2 A;  1MZ9 A;  7CEI A;  2CG5 B;  5C39 A;  2KSJ A;  3V6I A;  2N1T D;  5H2F H;  5AW8 B;  1ZV8 A;  2FQ1 A;  3AEG C;  3D6Y A;  3UIA A;  2DNW A;  1L0L E;  2PAJ A;  3G21 A;  2N9B A;  2GZJ A;  3M0D A;  4H0L C;  3L73 J;  1LTJ B;  5EJD A;  2H7H A;  1IUQ A;  1SQB K;  1FOS E;  4PJ0 E;  3CD6 P;  3H1J D;  2KOP A;  3GHG A;  5AW5 B;  3D6Z A;  2R5D A;  2H88 C;  3F5H A;  3S4R A;  3H32 A;  4PD4 H;  1EXJ A;  5KLV J;  1F80 D;  2O01 H;  5AVR B;  5HVC A;  1VQ4 P;  1SQV D;  4Y99 C;  1CW5 A;  3EQ2 A;  2YIU C;  3CWB E;  1YTZ T;  2O3J A;  2XXM A;  4BRY A;  3L71 J;  2N6Z A;  2FHS C;  3AE9 C;  3M0A A;  2IX7 C;  3RK2 B;  2UWJ E;  3QH9 A;  2B87 B;  3JSV C;  3V2Q A;  1ZME C;  2ZVO B;  2KOR A;  1EQ7 A;  3AEE C;  2FXP A;  2FFD B;  1LT1 A;  1L0N J;  2R3C A;  5L8R J;  4C46 A;  2ZYG A;  1T2K D;  2N5I A;  3V2P A;  2K0Y A;  2H43 A;  5CJ0 A;  1FR2 A;  2KOO A;  4OVN F;  1M57 D;  3PHL A;  1FZE A;  4JYB A;  2GDX A;  3H1I J;  4HYT B;  1SQV K;  1T3U A;  2Z45 A;  1LGH B;  1YJW P;  2Y0D A;  2W83 C;  1GZL A;  2OYI C;  2PEO A;  2GZG A;  3G29 A;  1JY2 N;  3VRL C;  2AXT H;  3PH0 A;  3N7N A;  2KP8 A;  3WU2 H;  2E75 C;  3H4E A;  1SQX K;  3HD7 D;  5KJ7 D;  2OYH C;  1VKU A;  2KGC A;  1EZV D;  2ITA A;  1KD1 Q;  2WSE H;  4H0L B;  1FU1 A;  1USE A;  5E79 H;  4R4M A;  1OX3 A;  2PNG A;  1RE4 C;  3P7K A;  2GZI A;  3GZM A;  3G1G A;  1D1D A;  1R5L A;  3H6P A;  1BSN A;  4YXD C;  3SWY A;  1CEI A;  4PD4 I;  3TF5 A;  2JGP A;  4MRT C;  3RG2 A;  3RK3 D;  2KGE A;  5HGM A;  5GTI H;  3IF4 A;  2FFD C;  4PD4 E;  1FZB A;  2W6B A;  3GHG B;  2M0B A;  3V2N A;  4BPF A;  3MZW B;  2ZFC A;  1L0L K;  2E74 C;  3WUU A;  4OWF A;  5HGN A;  3B5N D;  2E75 B;  2JP3 A;  1VQP P;  1IMP A;  3AEB C;  2GM4 A;  1LNQ A;  1KV4 A;  1RF1 C;  3L73 G;  3G6E P;  2P9X A;  3C8V A;  1Q7Y Q;  4Y28 J;  2PRR A;  4U7J A;  1FAV A;  1NTM E;  3A7O A;  1BCC D;  1IJD B;  1IFN A;  1NTK J;  5KLV G;  2L0Q A;  3L70 J;  4IOI H;  3H1H J;  1NTZ J;  4MN4 C;  5HV8 A;  1VQM P;  1PGJ A;  2MVV A;  2Q5U A;  3NTE A;  2YKQ A;  1X8Y A;  3GW6 A;  2HPC A;  4AYC A;  1BE3 D;  3L73 E;  1VF5 B;  3IN6 A;  1L0L G;  2R44 A;  2KOS A;  4CPG A;  2WVR A;  3NTN A;  3T97 B;  2PEN A;  2KI7 B;  3PP5 A;  2FYU G;  1KIL C;  1ZNV A;  1M6N A;  3HUS B;  1VF5 C;  3LID A;  4I7Z B;  2LXB A;  2A06 E;  3TYY A;  1Y9B A;  2N5H A;  3CX5 I;  2IDB A;  2CK3 H;  3NMD A;  1Q86 Q;  1LTS C;  4W7Z A;  2BQ1 E;  3EWK A;  3L74 G;  5KTB A;  3SWF A;  3B4Q A;  1JTH B;  2RMZ A;  1HF9 A;  3TGU J;  3WUT A;  1TU3 F;  4NEO A;  4U3F D;  1MFT A;  2N1T B;  1EXI A;  2AXT E;  1K04 A;  3FWN A;  2BCC G;  4UB8 H;  3FWL A;  3HD7 A;  2K9J A;  5KJ7 A;  3F89 A;  3W68 A;  1NTK G;  5F2K A;  5CJ4 A;  2NRG A;  3H47 A;  3KZI E;  5CCH D;  2E1M A;  2N1T C;  1L0N D;  4WWI A;  1M90 Q;  1RO2 A;  1R5S A;  2AXC A;  3G9R A;  5E79 E;  1FOS F;  1M1J B;  1RF1 A;  1JY3 P;  1PPJ D;  4M3L A;  1EDK A;  2MF4 A;  1FDM A;  2MKV A;  2BEZ F;  3O6Q B;  2JJL A;  2EHT A;  2ZJS E;  3H1K J;  4D6T E;  1RF1 B;  2NPS C;  1H89 A;  1KIL B;  1S3J A;  1G1I A;  1NTK E;  1ACP A;  2HLO A;  3CCL P;  3LW5 J;  1AFO A;  4B86 A;  2IYP A;  2XDJ A;  4PV1 C;  3RL0 C;  2VRS A;  2W6A A;  1S1C X;  3GF7 A;  3MD0 A;  4TLF A;  2PEQ A;  1NWQ A;  2QJP C;  4U0C A;  3HD7 C;  1KB9 I;  5KJ7 C;  2E43 A;  2YO2 A;  2KZJ A;  1YIT P;  1EC5 A;  2WPQ A;  1P84 D;  2KLU A;  3H1L G;  2CPS A;  1AA0 A;  2FAC A;  1J1D C;  2JBG A;  3HD7 B;  4K3A A;  1GXH A;  4HB1 A;  2HOD A;  1W5C E;  2N98 A;  2L4B A;  3B8E B;  4H0L D;  4HJG H;  3Q20 A;  4I2L C;  1IFJ A;  3L72 G;  5KAI H;  2K5X A;  1FS0 E;  3SSU A;  1JJ2 O;  3II6 A;  4GDO A;  2K0D X;  3TDK A;  1IFD A;  1OFC X;  3LMO A;  1LT9 C;  1KLP A;  1BDD A;  5DJT B;  2OYO A;  1QLE D;  1G1J A;  2JEE A;  4IL6 E;  3BRV B;  1L2P A;  3E1R A;  2OTJ P;  3HTK B;  1PPJ G;  1IFM A;  3DS3 A;  1X79 B;  2QSI A;  3CX5 H;  4ZKP A;  3GHG C;  3SWK A;  1SQQ D;  2FYN C;  3L72 E;  1LT9 A;  2GZE A;  5AVU B;  2E75 D;  2KWL A;  2WPS A;  4PH1 A;  2IBZ I;  4R0M A;  4H13 C;  4C7R A;  2YKO A;  2FYU E;  2KR5 A;  1BGY G;  4QKO A;  4U0B A;  3KQG A;  1DD3 A;  4GR2 A;  3CCV P;  2CQ8 A;  1K05 A;  1SFC B;  3L71 E;  4RO0 A;  2KZI A;  3BCC G;  2M5A A;  2WSS H;  4RKU J;  3LIE A;  2CNR A;  1NO4 A;  2JWA A;  1X0T A;  3I55 P;  2MD9 A;  2RKL A;  4H44 B;  2YMK A;  2LIU A;  2LPK A;  1GK4 A;  1SQQ E;  3L75 J;  1KTM A;  3CC4 P;  2KG8 A;  5AW3 B;  2R32 A;  4WY4 C;  1N7L A;  2X2B A;  3VP8 A;  2KSE A;  3LW5 H;  3AE7 C;  1PZQ A;  5EW5 E;  2MY5 A;  1E5W A;  5BS1 A;  3BCC E;  3VMA A;  4OH8 B;  5APX A;  3CL3 D;  1GTW A;  3USS A;  1FZG A;  2KS1 A;  5KP7 B;  2GYK A;  2AEJ A;  2ONT A;  3PLN A;  2XZ0 D;  2WSE J;  3MGN A;  4IPY A;  2O01 N;  3CCM P;  1MFZ A;  3P32 A;  1A8O A;  2FVF A;  4L73 A;  3RBX A;  2CPB A;  1N73 B;  2LTE A;  3B5N A;  3Q5P A;  4GOF A;  1KOR A;  1OXZ A;  4ASW A;  2WMM A;  2KGA A;  4N78 E;  1IK7 A;  3VTP C;  1SQB D;  5HGO A;  2QVA A;  2WT7 A;  1KIL D;  3B4S A;  5H2F E;  5HGL A;  1OZH A;  1LTJ A;  2DGY A;  3CX5 E;  1KYO D;  1NU1 K;  1T6A A;  4GT1 A;  1SQB G;  1NTZ K;  1NTZ D;  1WRG A;  3U1A A;  5AW4 B;  2QNW A;  5GTH H;  3CX5 D;  1E0H A;  3O8Z A;  3H1J E;  1Z6M A;  4GOE A;  2OYH B;  1IZN B;  3H1H E;  3H0D A;  2J5U A;  3RG6 C;  1PFI A;  1L0N E;  1M6E X;  1NVO A;  3C9I A;  3L75 E;  4WY4 D;  1N8R Q;  1KIL E;  1KIL A;  1YTZ I;  4DOJ A;  1PEQ A;  3PRJ A;  1SQB E;  4DZO A;  1J1E B;  1KYO I;  2K94 A;  1EMV A;  1G2C B;  1YBK A;  1EDL A;  1SP4 A;  1BGY J;  1KQS O;  5CMZ A;  1RNI A;  2K9J B;  2K3R A;  4JF7 A;  3S9O A;  5AW7 B;  2Q3I A;  3AE3 C;  3PTZ A;  1U7M A;  2WPV B;  1LTT C;  3IR9 A;  3VYI A;  1P84 H;  1BGY E;  2M8N A;  5JPA A;  3L75 G;  5AW6 B;  2ZVN B;  1LTB C;  2A06 D;  3Q5R A;  3GG2 A;  4HKG A;  2B88 A;  1JO5 A;  2XKM A;  2N1T A;  1OW8 A;  3RGU A;  2FFD A;  1D7M A;  2B89 A;  2QJY B;  3M9B A;  2D2C D;  4XFX A;  5APS A;  3L75 D;  1GMJ A;  1NTM G;  2AVA A;  1CZQ A;  2OYI A;  1YHQ P;  1HH0 A;  1JCD A;  1OW7 A;  1ZMB A;  2H8P D;  1USD A;  2P67 A;  2B9B A;  1DD4 A;  2FYN B;  2JYL A;  4PWV B;  1T3J A;  3NY7 B;  2FBW C;  2Z5I A;  3FXD A;  3TGU D;  2QG4 A;  3CWB G;  2Q7C A;  2KG9 A;  3L71 D;  3DS5 A;  2A45 I;  2IZ1 A;  1SFC D;  1BE3 G;  1EZV I;  1Y47 A;  2V7Q H;  3DTJ A;  2QEX P;  1URQ C;  5B5E H;  1SS1 A;  1AUM A;  3CPW O;  2LKM A;  2ZYA A;  4H44 D;  4LGD E;  3GJN A;  4IFM A;  2JO1 A;  3D70 A;  4N78 D;  3GMA A;  4OGQ B;  1MV8 A;  2QRX A;  1MUU A;  2BEQ D;  4PD4 D;  4YXW H;  3P8C D;  1N7S A;  5GTH E;  4H44 C;  4H13 D;  1S4X A;  2K93 A;  3AEC C;  1M1J C;  2K1A A;  1S5L X;  4GIF A;  3CCQ P;  4ZKU A;  5BU8 B;  3L72 D;  2O01 J;  1L4A C;  3MHV A;  1J1E C;  2PEK A;  1SFC C;  2I1J A;  2QJY C;  1SQB J;  4WVZ A;  2KOQ A;  1Y8A A;  1ZP0 C;  2JO0 A;  1JY2 O;  4KHX A;  1QGK B;  2LXC B;  1RQV A;  1FC2 C;  1LWU A;  2BCC J;  1U7J A;  2VLQ A;  1HY8 A;  1OR5 A;  4PV1 B;  2W90 A;  2Y0E A;  2EHS A;  1SQQ J;  4HKZ H;  2JDI H;  1P84 E;  2Q9I A;  1ZRT D;  1VQ8 P;  3H1H G;  1EZV G;  5CCG A;  2KB7 P;  3H1I G;  1L0N G;  2QA4 P;  1LTG C;  2FQ2 A;  5APT A;  1PP9 J;  4XRO A;  2MR7 A;  3EFF K;  1RE3 A;  2M8P A;  5M1B A;  1L0I A;  1KB9 D;  4K35 A;  3A2A A;  2XV6 A;  1SFC A;  5AW9 B;  3U59 A;  2FYU J;  4IFF A;  2KNC A;  2KLV A;  3PJS K;  2EIA A;  1H0T B;  2OTL P;  3Q5S A;  5CBO A;  3KHU A;  1AV1 A;  3P8M C;  2L6E A;  1N7S C;  3WMM 0;  1HQB A;  1K8A Q;  2J59 M;  3AEA C;  1GK6 A;  4H2Y C;  1X3O A;  1KB9 H;  3VOP A;  4DCK A;  4BXL A;  4WY4 B;  1BE3 J;  2E74 B;  1E6J P;  2Z5H A;  3KXD A;  2YXR B;  4AQR D;  2BAS A;  2YNY A;  3OAK A;  1NAY A;  1N86 A;  4KT0 J;  2KUB A;  3H1L J;  1JY3 O;  1RE4 A;  2WSC J;  1EDJ A;  1YYC A;  3CCR P;  3M06 A;  2A06 G;  1OMI A;  2PP6 A;  3JCU H;  3GLM A;  1DIP A;  1BCC G;  1L4A A;  4RES B;  3ZDM A;  2JB0 A;  2I1K A;  1S9K E;  1VPC A;  2EFJ A;  1VQN P;  3V2R A;  2HOD B;  1NQ4 A;  4I6M C; 
#chains in the Genus database with same CATH homology
 1PEO A;  3G1G A;  1D1D A;  1ZMB A;  3P05 A;  1Q86 Q;  1VQ8 P;  3OW2 O;  1K73 Q;  1VQK P;  2BQ1 E;  2CWO A;  1EOQ A;  3DS2 A;  1IUQ A;  2JYL A;  2QA4 P;  2JYG A;  3CD6 P;  1QRJ A;  3CC4 P;  4XRO A;  1M1K Q;  3G71 P;  3DS5 A;  1QVG O;  1VQO P;  4U0A A;  4XFZ A;  2M8L A;  5HGM A;  3G1I A;  1NJI Q;  3CCU P;  2Z44 A;  3E2D A;  1VQ4 P;  3CC2 P;  3H0D A;  2M8P A;  1VQ6 P;  3RG6 C;  3Q20 A;  5BS1 A;  3DTJ A;  1M6E X;  4XRQ A;  2XV6 A;  2QEX P;  5F2K A;  1RO0 A;  2PY8 A;  3H47 A;  1JJ2 O;  2XXM A;  1AUM A;  2E1M A;  4COC A;  3CPW O;  1N8R Q;  5HGN A;  2BHV A;  1PEQ A;  1M74 A;  1M90 Q;  1RO2 A;  1VQP P;  3WBH A;  2EIA A;  2OTL P;  1A43 A;  2L6E A;  4QNB A;  3CCJ P;  1KQS O;  3G28 A;  3CC7 P;  1VQL P;  3G6E P;  2P9X A;  3G26 A;  3DPH A;  2EG5 A;  1RNI A;  1Q7Y Q;  4GR6 A;  2ONT A;  3CME P;  2OTJ P;  1K8A Q;  1YJN P;  3DS1 A;  2PEJ A;  3DS3 A;  3CMA P;  4IPY A;  3CCM P;  3CXC O;  1VQ5 P;  3CCQ P;  4WYM A;  2PEM A;  1A8O A;  5F2N A;  2M8N A;  3CCE P;  2BUO A;  1E6J P;  2PEK A;  1Q82 Q;  1YIJ P;  5JPA A;  1VQ9 P;  3CCL P;  3MGE A;  4U0D A;  2PEI A;  3HZQ A;  4PH1 A;  2OAR A;  1EIA A;  3G0V A;  2Z45 A;  3B5I A;  5F2O A;  1VQM P;  1PEU A;  3DS4 A;  1YI2 P;  1YJW P;  1W2B O;  1Q81 Q;  4PH0 A;  1K30 A;  5DCK A;  5I4T G;  4U0F A;  2KOD A;  2PEO A;  2JO0 A;  3G29 A;  4M0I A;  3NTE A;  3LRY A;  1VQ7 P;  3VRL C;  3CCR P;  1PEM A;  3DS0 A;  3I56 P;  2PEQ A;  4U0B A;  3H4E A;  4XFY A;  3G4S P;  1KC8 Q;  4GR2 A;  4U0C A;  3CCV P;  4XFX A;  5BS2 A;  2PEN A;  1YJ9 P;  5HGO A;  2Z46 A;  1KD1 Q;  3CCS P;  2LF4 A;  3M1M A;  3HYB A;  4COP A;  5HGL A;  1K9M Q;  2EFJ A;  1M6N A;  1VQN P;  2DGY A;  1YIT P;  4U0E A;  3I55 P;  1BAJ A;  2XT1 A;  3G21 A;  1YHQ P;  1S72 P;  1QVF O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...