1VQOP

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqoP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqoP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqoP02
1W2BO 3OW2O 1YHQP 1YI2P 1JJ2O 3CPWO 3CXCO 3CMAP 1YJNP 1VQ9P 3CD6P 3G71P 1VQ7P 1M1KQ 1VQKP 1KQSO 3CCLP 3CCQP 1VQPP 2OTJP 1VQLP 1KD1Q 2OTLP 3G6EP 1K9MQ 1YJ9P 1NJIQ 1QVFO 3I56P 1VQNP 1YIJP 1VQOP 1Q86Q 3CC2P 3CCUP 1K8AQ 3CC7P 1VQ6P 3CCSP 2QA4P 1VQMP 1YITP 1M90Q 1QVGO 1Q81Q 3G4SP 1N8RQ 3CMEP 1YJWP 1S72P 3I55P 3CCRP 1Q7YQ 2QEXP 3CCMP 1VQ4P 1VQ8P 1Q82Q 1K73Q 1VQ5P 3CCJP 1KC8Q 3CC4P 3CCVP 3CCEP
chains in the Genus database with same CATH superfamily
1FZFA 2OARA 2O01H 5APYA 1QEXA 2N5IA 1KD1Q 1UNKA 2Z5HA 2AF8A 1RHZB 1FJPA 1KV4A 1P84E 2LIWA 4XRQA 1NTKE 1PP9D 3G28A 4YXWH 3A0BE 4U3FE 3KQGA 3H1IE 1DEBA 4U0DA 1OVVA 2OTLP 1OIPA 4R4LA 2VLNA 1KILD 2M8PA 3HUSA 1K8AQ 1J1DB 1PGOA 2NO8A 3L73E 2ZVOB 1G1JA 1PGQA 2WSFJ 5L8RJ 2AEMA 5GTHH 1ZOYC 2L6EA 1N8RQ 2KGDA 1Q82Q 2KP8A 1EC5A 5H2FE 1YHQP 1FAVA 2E74C 1N7LA 1LP1A 1RQUA 4TLFA 4D6TE 2BCCE 3SWKA 1BE3G 2Q3IA 5APTA 2PEMA 2MVVA 2N1TA 3V2QA 1SQVE 4U0CA 2IZ1A 4DZOA 4Y28J 2VRSA 3OA7A 1NTKK 3P7KA 1JEKA 1OX3A 1KB9D 2IBZE 1X3OA 2E5YA 4MRTC 4QNBA 2FYUG 3KDPB 1GL2A 1SQXE 1LWUB 3WUUA 2XV5A 5AW6B 4PJ0E 1H0TA 5BU5A 1IK7A 2KK7A 2KOSA 3L70G 5DJTB 1LGHB 4HKZH 3CXHE 4ZKUA 2GDYA 2CGQA 3H32B 1K9MQ 1VF5C 4LGDE 2JO0A 1SQPD 5AW4B 3AE9C 5CCHC 4JF7A 1DH3A 1VQ8P 2O01J 3D71A 1SQVK 3L72E 3AECC 4OVNF 1HH0A 3LMOA 2GZEA 3C8VA 1YTZT 3ABVC 5APQA 3CPWO 1GK6A 1ZW0A 1HGZA 1MZ9A 3I5CA 1UIXA 3HE4B 3SFDC 2KG9A 1EXIA 1SQXK 2KNCB 1LTJB 1GD2E 1S1CX 3TGUJ 5E79H 1EIAA 2HPCB 1LTAC 1PFIA 3MUDA 3HD7B 1QRJA 3A7OA 1BSHA 3WMM0 3MUDC 1NU1E 1QLED 3GW6A 1EDJA 1DV5A 2GZJA 2QJYB 1FJKA 2WVRA 2WMMA 1J1DC 3BRTB 2KOGA 4KJMA 2GYKA 1JJ2O 1RF0A 1LTTC 3CXCO 2OYOA 2PEJA 2WPQA 1PGPA 3B8EB 1BCCJ 1M56D 1SS1A 4HYTB 1BSNA 2FY8A 4PH1A 1SQQG 1QL2A 2FFDB 3M0DC 3D70A 4PXHB 4EDFA 2KIKA 4IFFA 2JDIH 5CBNA 1HJBA 1SQQK 3S4RA 5KP8B 1GU5A 4WY4A 3W68A 2N1TD 2IX7C 1LWUA 1NU1K 3PP5A 1FZAA 1H89A 5AVWB 3C1LA 4N3YB 1LWUC 2WSCH 3DS2A 5AVRB 1PP9G 1JTHB 1GL2D 2IYPA 4UB6E 1K04A 3AE1C 3H32A 1NQ4A 1KB9E 3M0AA 3Q5PA 3H25A 2M8LA 1PIXA 4BPHA 3GF7A 1DD3A 2EHSA 1A02F 4K3AA 3DS3A 3CD6P 2B9BA 2Q5UA 4HH2A 1L0NE 3E1RA 2XXMA 4H13B 4IFDK 3HE4A 2WPRA 2KNCA 1LTJA 2ZT9D 4AYCA 4RESB 2HPCA 2QE7H 1VQ5P 4IPYA 1LTJC 1NO4A 1E79H 4I7ZB 1IZNB 3HD7A 4NPFX 1DNYA 1YJNP 3HD7C 3Q1MA 1A8OA 1SP4A 5BU8B 2L5GB 3PLNA 5EFWB 2KYVA 2XU6A 2Y0EA 4GODA 2DGYA 5APVA 3GZLA 4WBAA 2OTKE 2MR8A 1BE3J 2CNRA 1EOQA 1KILB 2K88A 2R3SA 1ZLLA 5M1BA 1L0NK 1FZCC 2JB0A 1CZQA 2DNWA 1SQPG 1GTWA 5AW1B 1OWAA 2FYUJ 2FFDA 2ERHA 1NOHA 1IK9A 2WZ7A 3U1AA 2KSJA 4K35A 4XE5B 4PD4I 2ZYAA 4ZKPA 4UB8H 3L70J 5BVZA 5KLVD 1T2KC 1FBMA 3NY7B 4YPCA 1ZNVA 3TSIA 1JO5A 2NPSD 1K05A 1EQ7A 4WY4D 1JTHA 4H2XC 3IN6A 1L0LD 1F80D 3MHVA 3KXDA 2IDBA 4GR6A 1WMKA 1E0HA 1RF1B 1ZN5A 2KLUA 1EMVA 5AVZB 3G26A 3JCUE 1QL1A 2H7HA 1JMMA 2PAJA 3V4QA 3A2AA 2LXCB 2HLOA 3BASA 4YXDC 4YTPC 1TU3F 2XV6A 3L36A 1G1IA 1OW7A 2M3EA 1EDKA 1BGYD 4MN4C 1IO4A 4GIFA 3GLMA 3IF4A 1OXZA 5KAIH 2H89C 4H13C 3L74G 2P10A 2OYHB 2JAZA 1K30A 1L0HA 1HVVA 3L37A 5APSA 4F37A 4JYCA 3TGUE 1AJYA 3NTEA 4PD4H 1M6EX 4I7ZC 2LKMA 4DOJA 3VP9A 3IFMA 5AW8B 1M74A 5GTHE 1M90Q 3M91A 3M06A 3P8CE 3CX5I 1MKMA 1FDOA 4PV1D 4HKGA 5C39A 1SQQJ 3CCJP 1RE4A 1GK4A 1KILA 2I8DA 3AE5C 2D2CD 1EDIA 3L70D 2GA1A 3VMZA 4ZNCA 1RE4C 1AVOA 1KILC 2M0BA 1XTGB 1BCCE 3JC22 2W90A 5F2NA 1Y9BA 2KWLA 4RKUJ 1HGVA 1N86A 1YYCA 5B5EE 3SWFA 1Z6MA 3B5NB 2E43A 1KC8Q 2CG5B 1ZV8A 5BS1A 2CPBA 2KOPA 4LLHA 1M1JB 1PP9J 1R8EA 2Y0DA 1AUMA 5CJ0A 2EHTA 2OYIC 1Q2NA 1BDDA 4DT0A 1YJWP 5KLIC 2N1TB 4N6JA 2KXPB 3S1KA 5DJUB 3CE7A 1JNMA 4JQ0D 3WU2H 1ZRTD 1RF1A 1QVFO 1GL2B 3RL0D 3CC2P 1X22A 1JY2P 3CX5H 2WWWA 1RF1C 2QRXA 3MTUE 1FZEA 1KLPA 2HR3A 2M5RA 3MZWB 5AVTB 1X8YA 1S3JA 1RY3A 2ZVNB 2AEFA 3FWLA 2C9LY 1EXJA 1LTGC 2JWAA 1T6AA 2KI7B 3M1MA 5CCGD 2O01N 1FDIA 2VLQA 3H0DA 2KR5A 1RNIA 2WQYC 2BUOA 2OYHA 1HUCA 3Q3DA 2QIWA 1GU4A 1JB0J 2OYHC 3CCEP 3OW2O 3H1LG 2AXCA 3N4XA 3P32A 3ZDMA 1EDLA 2ZT9B 3E1IA 2XZRA 1AYIA 3G1GA 5HV8A 2E75D 1RO0A 2G8YA 2KGAA 5KLVG 1HBWA 1SQPJ 1NTZG 1BE3E 2W8ZA 2WSEH 4H44C 1Q90D 2R32A 1YI2P 3KPEA 5KLVK 2R3CA 1L0LG 2SPZA 2WPVB 1NH4A 2MD9A 1LTBC 1E6JP 2PEQA 2PNGA 1YQ3C 1VQMP 4L75A 2FYUE 1CW5A 2PGDA 2C0WA 3HUSC 3L75D 2P9XA 3Q5SA 1PV3A 3B5NA 4I2LC 3CCVP 3G21A 2JYLA 5APUA 2O1JA 1L4AD 5JPAA 3F89A 2FYNC 2K92A 1M1JA 5GTIH 1BGYG 2V4HA 3NXSA 1M1JC 3L70E 3AEAC 4U7JA 1AQ5A 2AXTE 2YIUB 2KSEA 2W6AA 3BCCD 2N1TC 1PEMA 2M5AB 2QNWA 2ZYGA 1OVUA 1N2DC 2FQ2A 2NPSB 4WY4B 5AW5B 3RG6C 4PD4D 3RK3B 2EIAA 3FGAD 3UIAA 3CCSP 2BEQD 4C7NB 1M57D 1GL2C 2KG8A 3CCRP 2FYUK 3L74J 1FU1A 2A06G 1MFTA 2P58A 3G71P 5AW9B 1BAJA 1RQVA 1N73B 3I56P 1VQNP 2H88C 1MV8A 2YKOA 2R5BA 2GUSA 2HODA 1E5WA 4OH8B 2CK3H 2PEIA 2FBWC 2PRRA 1R5LA 3KZIE 2Q3EA 2AVAA 1X0TA 1JUNA 3VMYA 2N6ZA 4W7ZA 2ZT9C 3CC7P 2WSEJ 1S5LH 3AEDC 1Y8AA 2YO2A 5AW0B 2ZYDA 1AV1A 2AFDA 2JU1A 2K94A 4XROA 1HF9A 1SQQE 5F2KA 2ROQA 2PEKA 1S4XA 4PV1B 1M8OB 2D2CB 1KQLA 4BPFA 3AE7C 1W5CE 1QVGO 4NPDA 2NRGA 3CX5D 3A0HE 2W27A 2WITA 4UB8E 3B71A 1PP9E 3Q5RA 3Q2YA 1RF0C 2B88A 1NKNA 3B5ND 2JU2A 3L74D 1ZR2A 3WBHA 5AW2B 3S9OA 4IFMA 2XZ0D 4C46A 2Z4EA 1VHNA 3NTNA 4IL6H 3VMAA 1AF8A 4Y99B 1KILE 2YIUC 1FE6A 2M5AA 2KGCA 1DD4A 3A0BH 2AEJA 3H1KD 3H6PA 2NPSA 3BVHA 1S2EA 4U0FA 2XT1A 2W6BA 3KHUA 4H0LD 1J1EB 4COCA 1JY3N 1SFCD 2NPSC 3CCUP 2N98A 2PEOA 4WY4C 4C7NA 2YKPA 1KFNA 3RBZA 3E7KA 5TISE 4AUWA 2VLPA 3RL0B 1W2BO 1DX7A 3LW5H 1DIPA 5H2FH 5AW3B 2K9JA 3GHGB 5KAIE 4M3LA 3LIDA 3H1LJ 1N73A 1DEEG 2JYGA 1OR5A 1N73C 2IFNA 2KZJA 2WTYA 5HGMA 4GR2A 3V4WA 1MUUA 3AE4C 2L22A 5KLVJ 2KUBA 3L75G 2E1MA 4XFXA 4RJTA 1S9KD 3U43A 1NTZJ 1U7MA 3LIEA 1S5LX 2JWDA 1D1DA 1VQPP 1ZMEC 1D7MA 5KP7B 1L0LJ 4EYYQ 2B89A 2Z46A 3SWYA 3L71G 3V6IA 1SQPE 2E75B 4U0BA 2A45G 3BCCG 4DJGA 1NAYA 3VOPA 3AE8C 2JJLA 5AVUB 3FXEA 3DS4A 1MZ8A 1HJ0A 4PV1C 1BGYJ 2E42A 2KOQA 1M7LA 3PRJA 1OZHA 2D2CC 1ZMBA 4GKGA 2FQ1A 2P67A 1AFOA 2QJYC 2K93A 2LIUA 4ZMDA 3QH9A 2ZXEB 2V7QH 3RK2D 1FDMA 4IL6X 1L4AB 1UJZA 2A45I 2MKVA 3H1JD 5AVSB 3CCMP 1K73Q 4AQRD 1OW8A 2N9YB 1JM0A 2FFDC 1SQPK 3WU2E 3H1LD 2HG5D 4Y99C 4L73A 3CX5E 3L73J 1LTIC 2WSCJ 3CWBD 2Y9ZA 3VYIA 2JP3A 4W7YA 1J1EC 1NAFA 1NTZD 4KT0J 1G2CB 3L74E 1GXHA 4LC1A 3RK3D 3RL0C 1A43A 1BXIA 3GHGA 1PPJD 2PY8A 1NJIQ 2N9BA 2VLOA 5KP6B 2UWJE 3T97B 2BHVA 4BPGA 3AE2C 2FHSC 5CCGA 5CMZA 1OFCX 1AQTA 3WUTA 3A3YB 3GMAA 1USEA 3FXDA 5CCGC 1SQBD 3VTPC 1FOSE 3BRVB 3JSVC 5BS2A 1KTMA 1FR2A 2HFED 2A45H 4OWFA 3Q20A 3R2PA 4R4MA 2FVFA 2KORA 1VQ4P 4I1LA 1KYOI 4EI2A 3WUVA 1HTLC 2E75C 4UB6H 2GZFA 3H1KG 2QSIA 2Q1KA 3AE6C 2YMKA 3B4SA 1S9KE 2K5XA 2O1KA 4BRYB 4N78D 1YBKA 2L91A 2YXQB 1ZXGA 4C7RA 2A06D 1RE3A 3L73D 2V7QJ 1EZVG 3M9QA 2FXOA 2GUVA 1VL2A 1GDTA 4U0EA 1RE3C 5KTBA 3GKLC 1YITP 1L4AA 3EWKA 3PJSK 4EOTA 1L4AC 3GZMA 1QGKB 2QVAA 4PWVB 2RKLA 2XDJA 2KG6A 1FZGA 3DS0A 1KYOH 1EZVI 3W67A 1KFMA 2Z45A 3B5IA 4UHPB 2JEEA 1NTMJ 1G2CA 2EFJA 1KN7A 1SQXD 4H0LB 2K0XA 1SFCB 3O6QB 3V2RA 2YKQA 2J5UA 3KYQA 3MIWA 2KOOA 5APWA 5APXA 1IUQA 3L75J 3C9IA 3H1LE 5K5GB 3G9RA 2Q9IA 4OGQD 3T97A 1S72P 3I55P 1T2KD 2RH0A 2C0XA 5KLVE 1JMBA 1URQD 2ZAEB 3L71J 4H2WC 1NTZE 1ACPA 3BCCJ 1USDA 1PZQA 2K3RA 2GDWA 3RK3E 2Y9YA 1L0LE 5E79E 1LNQA 3FWNA 1R5SA 2QM7A 1PGJA 1MFZA 2HODB 3P05A 4QKOA 3H1JG 2MF4A 2L9FA 2QJKB 5B66H 3G29A 3GF3A 3MGNA 4BXLA 5KAFH 2G3AA 1VQLP 2I1KA 5HGNA 2YNYA 2GZIA 1VQOP 1VQ6P 3V2PA 4BRYA 1LTSC 3JCUH 1BGYE 3CWBG 1Q81Q 1JOCA 2ZXXA 1NU1D 2R5DA 3CC4P 2KLVA 4KHXA 1CI6A 1PEUA 3VMXA 1NTZK 2VSQA 1PPJG 1X9VA 3OJAB 1AA0A 1VDFA 1NTMD 2P1JA 2OGUA 1L0LK 4IL6E 2FQ0A 3EFFK 4R0MA 3RK2B 4O9BA 3DPHA 4QMAA 3O8ZA 2K1AA 3R4YA 4N78E 3TNUB 3B5NC 3VP8A 1SQBG 1A02J 2P2UA 3H47A 2KZIA 2A06E 2P7JA 2LOLA 2BQ1E 2MJZA 1FZBA 1SQBK 3VN0A 3PH0A 1SVFA 2BASA 3L71D 1SFCA 3O6QA 1FS0E 2IZ0A 4H0LC 1SFCC 1WT6A 2C9NY 4XFZA 2LL8A 1NTKG 2QA4P 3G1IA 4M0IA 4U0AA 2LF4A 3AEEC 2KS1B 1NKZB 4U3FG 3DS1A 3H1IG 1GZLA 3M9BA 5B5EH 3HTKB 2LTEA 3AE3C 1N7SD 2CPSA 2N5HA 3L73G 2PFXA 2YXRB 3MD0A 3TF5A 5TJHA 2K9JB 2ZJSE 4RO0A 3DS5A 2M8NA 1IMPA 1RH5B 1L0ND 5KJ7D 3H1KJ 1FC2C 2CQ8A 5AVVB 1ZRTE 1XTCC 1P84I 4D6TG 3PTZA 4XFYA 2CWOA 2BCCG 2QJKC 3G6EP 5CCHA 4WVZA 1YJ9P 1SQVG 1GXGA 4WB4A 2AFEA 2LKIA 4GOFA 2QG4A 5AVXB 2IBZG 3L35A 3A5TA 1IC2A 5DCKA 2E76D 3U59A 3BATA 1SQXG 3D6ZA 1KYOD 1NYHA 1QX8A 1U57A 3M9HA 1CEIA 2ZFCA 3G0VA 2N6YA 2H8PD 4DG9A 3IR9A 4COPA 2QEXP 2GM4A 4JYBA 3QWOC 4CA3A 2J58A 2L4BA 3TYYA 2QJPB 4H44D 1NGMB 3RK2C 3TNUA 2KGEA 2IBZI 4L74A 1IFNA 3SSUA 3L72G 2W6JH 2Y0CA 4BWNA 3VRLC 1GW4A 1P84H 2MR7A 4WWIA 1FZCB 3NMDA 1NTME 1YQ4C 1LJ2A 5AW7B 3CMAP 5HGLA 3V2NA 1VQ7P 1H8AA 1WRGA 1IJDB 2WT7B 1JY2N 2FXMA 3DTJA 3L75E 3M0DA 2E74D 1KZUB 3CL3D 3CXHI 3RG2A 2FVAA 2KS1A 3RK3C 4XFJA 3HTKA 1X79B 1RO2A 1EZVD 2POHA 1NU1G 1KQGB 4OGQB 3L71E 3H1JJ 4I6MC 2WSSH 3OAKA 1Z56A 1JCDA 2E5TA 2R44A 3BCCE 3EJDA 1J2JB 1YIJP 1URQB 2BEZF 1NTMG 2FYZA 4GOEA 1W2EA 1Q7YQ 2LPKA 4NPEA 3K5BA 2AXTH 4PD4E 3CWBJ 3L4FA 1NTMK 3H1HJ 3PHLA 2FADA 1KORA 1IFDA 4DCKA 4GDOA 3TK1A 3TGUD 2WPTA 1T8KA 3SFEC 1VF5D 3TDKA 1IFMA 2KODA 5HVCA 2DW3A 4TT3H 2XNDH 5CCHD 4PJ0H 2XZ1C 3P8CD 1LT9B 3CXHH 1SQBJ 2W83C 1OW6A 3N7NA 2MY5A 5KKZB 3CMEP 4HB1A 3NFQA 1BCCD 1U7JA 5CJ4A 2LXBA 2H43A 2GZGA 2J59M 3H4EA 3KZIH 2QJPC 1HWTC 2IPPA 3IAOA 1KYOE 3U1CA 5CZDB 1NTKJ 1L0NG 1FZCA 4U3FJ 2O3JA 3B4QA 3H1IJ 3GG2A 2K37A 3EJBA 3CCLP 3CCQP 2OTJP 2WT7A 2MVUA 7CEIA 4ASWA 3EQ2A 1FOSF 4PH0A 4ASVA 3H1HD 1KB9I 2RN0A 3CI9A 3HRNA 3LW5J 2LR2A 1UIIA 1ZP0C 3A0HH 1YTZI 2OYIB 4Z1MH 5HGOA 1PEQA 4D6TJ 1PEOA 1GW3A 2BCCJ 4OGQC 4JBZA 5KLIB 3F5HA 1Q86Q 2Q7CA 1URQA 4NEOA 1N7SB 3GHGC 4EIJA 1IMQA 1SQVJ 3H1KE 3FX0A 1URQC 5B66E 5CHXA 5KAFE 1T8ZA 1KMIZ 3MGEA 3CLQA 1VQ9P 1KQSO 1HY8A 3V5BA 1SQXJ 5EW5E 1EZVE 1VKUA 1Y47A 2JQ4A 3HE5B 3AEBC 4JPZB 4XA4A 1L0IA 3G4SP 1H88A 4WYMA 1IFJA 5TISH 1VPCA 2XKMA 1JCCA 2XNXA 2K0YA 2FKWB 2Z44A 1LT9A 1P84D 2K0DX 2IFMA 4HJGH 3MP7B 2EG5A 1NTKD 2IYOA 1BE3D 2K9YA 3ITKA 4W80A 1ZR4A 1LT9C 2E76B 1OVRA 1IFPA 4U3FD 2JO1A 1KB9H 2LMLA 3H1ID 3L72J 2B87B 2HYNA 3EFGA 5KKZC 4B86A 2K2QA 5GTIE 1SLQA 1CI6B 2KW2A 2FYUD 2NZ2A 1VQKP 2YMYA 2OQQA 2Q6QA 3RL0g 4CPGA 4H44B 3HD7D 1AVYA 1NHLA 5AVQB 3HZQA 1NVOA 1JY2O 4D6TD 5CBOA 2BCCD 1KQFB 1JY3O 3G3ZA 3P8MC 1NU1J 1SQVD 2M8RA 3RGUA 4L76A 3TGUG 1PL5A 3HUSB 2IBZD 2RMZA 2FYNB 2E74B 2WSFH 2L0QA 1BDCA 4A7PA 3E2DA 1OMIA 2OYIA 1CSBA 1M1KQ 1LP1B 1GPJA 2I1JA 3H1JE 5EJDA 2JR8A 2ONTA 2JBGA 4GT1A 1N7SA 3USSA 1NWQA 2WPSA 2Z5IA 3CXHD 4IZ6A 1N7SC 2PP6A 2GDXA 2YO3A 3AEFC 1GMJA 3CWBE 1BCCG 5I4TG 3RBXA 5KJ7A 1LT1A 2FVEA 3H1HE 2X2BA 5KJ7C 3II6A 2JGPA 1S5LE 3L72D 3HE5A 1HQBA 1IFIA 1JY3P 1PPJE 2PENA 1H0TB 2KB7P 1T3UA 2QM8A 2FAEA 1VF5B 1M6NA 3LRYA 4IOIH 3D6YA 2N50A 2FXPA 1L2PA 1SQQD 1T3JA 2FACA 3HYBA 2ITAA 1SQBE 5AVYB 2E76C 5F2OA 3GJNA 4H2YC 2B87A 4H13D 2M3BA 3EJEA 3H1HG 1L0NJ 2JKVA 3AEGC
chains in the Genus database with same CATH topology
1PEMA 2OARA 1M6EX 5HGOA 1IUQA 1PEQA 3DS4A 1KD1Q 3H47A 1K9MQ 3G0VA 1PEOA 2JO0A 3RG6C 3M1MA 5BS2A 1M74A 1Q86Q 2EIAA 3H0DA 1RNIA 3CCSP 1M90Q 3WBHA 2BQ1E 3Q20A 4COPA 2BUOA 4XRQA 1S72P 3I55P 3CCRP 1ZMBA 2QEXP 1VQ4P 3DS2A 1VQ8P 2KODA 3G28A 3CCJP 3CCEP 3E2DA 3MGEA 3OW2O 3CPWO 1VQ9P 3G71P 1BAJA 4U0DA 1M1KQ 1KQSO 2OTLP 3G1GA 4XFZA 4U0FA 5F2NA 2XT1A 2ONTA 3I56P 1VQNP 4COCA 1RO0A 2M8PA 3CCUP 1K8AQ 2PEOA 2QA4P 3G1IA 4M0IA 4U0AA 2M8LA 2LF4A 3G4SP 2L6EA 1N8RQ 3CMEP 3VRLC 4WYMA 1EIAA 3CCMP 3DS1A 1Q82Q 1K73Q 3P05A 3DS3A 1KC8Q 3CD6P 1W2BO 5I4TG 2PEIA 5BS1A 3G29A 1YHQP 1YI2P 1QRJA 3CMAP 2Z44A 5HGLA 1VQ7P 4GR6A 4U0EA 2XXMA 2EG5A 3H4EA 1VQLP 3DTJA 5HGNA 3G26A 1E6JP 1AUMA 2M8NA 3DS5A 2JYGA 2PEQA 1VQOP 3CC7P 1VQ6P 1YITP 1VQMP 2PEMA 1Q81Q 5HGMA 1YJWP 2PENA 4GR2A 4U0CA 2P9XA 4XROA 1VQ5P 4IPYA 3CC4P 1RO2A 3CCVP 3G21A 2E1MA 2XV6A 4XFXA 5F2KA 2JYLA 1JJ2O 4XFYA 2CWOA 3CXCO 5JPAA 1PEUA 2PEKA 1M6NA 1YJNP 2PEJA 1A43A 1VQKP 3LRYA 4QNBA 1D1DA 3CCLP 3CCQP 1VQPP 2OTJP 2PY8A 3G6EP 1A8OA 1YJ9P 1NJIQ 1QVFO 1YIJP 3CC2P 2DGYA 3HYBA 4PH1A 1QVGO 3DS0A 2Z46A 4PH0A 1K30A 3HZQA 5F2OA 2BHVA 1Q7YQ 2Z45A 3B5IA 2EFJA 1EOQA 3DPHA 3NTEA 5DCKA 4U0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B O;  3OW2 O;  1YHQ P;  1YI2 P;  1JJ2 O;  3CPW O;  3CXC O;  3CMA P;  1YJN P;  1VQ9 P;  3CD6 P;  3G71 P;  1VQ7 P;  1M1K Q;  1VQK P;  1KQS O;  3CCL P;  3CCQ P;  1VQP P;  2OTJ P;  1VQL P;  1KD1 Q;  2OTL P;  3G6E P;  1K9M Q;  1YJ9 P;  1NJI Q;  1QVF O;  3I56 P;  1VQN P;  1YIJ P;  1VQO P;  1Q86 Q;  3CC2 P;  3CCU P;  1K8A Q;  3CC7 P;  1VQ6 P;  3CCS P;  2QA4 P;  1VQM P;  1YIT P;  1M90 Q;  1QVG O;  1Q81 Q;  3G4S P;  1N8R Q;  3CME P;  1YJW P;  1S72 P;  3I55 P;  3CCR P;  1Q7Y Q;  2QEX P;  3CCM P;  1VQ4 P;  1VQ8 P;  1Q82 Q;  1K73 Q;  1VQ5 P;  3CCJ P;  1KC8 Q;  3CC4 P;  3CCV P;  3CCE P; 
#chains in the Genus database with same CATH topology
 1FZF A;  2OAR A;  2O01 H;  5APY A;  1QEX A;  2N5I A;  1KD1 Q;  1UNK A;  2Z5H A;  2AF8 A;  1RHZ B;  1FJP A;  1KV4 A;  1P84 E;  2LIW A;  4XRQ A;  1NTK E;  1PP9 D;  3G28 A;  4YXW H;  3A0B E;  4U3F E;  3KQG A;  3H1I E;  1DEB A;  4U0D A;  1OVV A;  2OTL P;  1OIP A;  4R4L A;  2VLN A;  1KIL D;  2M8P A;  3HUS A;  1K8A Q;  1J1D B;  1PGO A;  2NO8 A;  3L73 E;  2ZVO B;  1G1J A;  1PGQ A;  2WSF J;  5L8R J;  2AEM A;  5GTH H;  1ZOY C;  2L6E A;  1N8R Q;  2KGD A;  1Q82 Q;  2KP8 A;  1EC5 A;  5H2F E;  1YHQ P;  1FAV A;  2E74 C;  1N7L A;  1LP1 A;  1RQU A;  4TLF A;  4D6T E;  2BCC E;  3SWK A;  1BE3 G;  2Q3I A;  5APT A;  2PEM A;  2MVV A;  2N1T A;  3V2Q A;  1SQV E;  4U0C A;  2IZ1 A;  4DZO A;  4Y28 J;  2VRS A;  3OA7 A;  1NTK K;  3P7K A;  1JEK A;  1OX3 A;  1KB9 D;  2IBZ E;  1X3O A;  2E5Y A;  4MRT C;  4QNB A;  2FYU G;  3KDP B;  1GL2 A;  1SQX E;  1LWU B;  3WUU A;  2XV5 A;  5AW6 B;  4PJ0 E;  1H0T A;  5BU5 A;  1IK7 A;  2KK7 A;  2KOS A;  3L70 G;  5DJT B;  1LGH B;  4HKZ H;  3CXH E;  4ZKU A;  2GDY A;  2CGQ A;  3H32 B;  1K9M Q;  1VF5 C;  4LGD E;  2JO0 A;  1SQP D;  5AW4 B;  3AE9 C;  5CCH C;  4JF7 A;  1DH3 A;  1VQ8 P;  2O01 J;  3D71 A;  1SQV K;  3L72 E;  3AEC C;  4OVN F;  1HH0 A;  3LMO A;  2GZE A;  3C8V A;  1YTZ T;  3ABV C;  5APQ A;  3CPW O;  1GK6 A;  1ZW0 A;  1HGZ A;  1MZ9 A;  3I5C A;  1UIX A;  3HE4 B;  3SFD C;  2KG9 A;  1EXI A;  1SQX K;  2KNC B;  1LTJ B;  1GD2 E;  1S1C X;  3TGU J;  5E79 H;  1EIA A;  2HPC B;  1LTA C;  1PFI A;  3MUD A;  3HD7 B;  1QRJ A;  3A7O A;  1BSH A;  3WMM 0;  3MUD C;  1NU1 E;  1QLE D;  3GW6 A;  1EDJ A;  1DV5 A;  2GZJ A;  2QJY B;  1FJK A;  2WVR A;  2WMM A;  1J1D C;  3BRT B;  2KOG A;  4KJM A;  2GYK A;  1JJ2 O;  1RF0 A;  1LTT C;  3CXC O;  2OYO A;  2PEJ A;  2WPQ A;  1PGP A;  3B8E B;  1BCC J;  1M56 D;  1SS1 A;  4HYT B;  1BSN A;  2FY8 A;  4PH1 A;  1SQQ G;  1QL2 A;  2FFD B;  3M0D C;  3D70 A;  4PXH B;  4EDF A;  2KIK A;  4IFF A;  2JDI H;  5CBN A;  1HJB A;  1SQQ K;  3S4R A;  5KP8 B;  1GU5 A;  4WY4 A;  3W68 A;  2N1T D;  2IX7 C;  1LWU A;  1NU1 K;  3PP5 A;  1FZA A;  1H89 A;  5AVW B;  3C1L A;  4N3Y B;  1LWU C;  2WSC H;  3DS2 A;  5AVR B;  1PP9 G;  1JTH B;  1GL2 D;  2IYP A;  4UB6 E;  1K04 A;  3AE1 C;  3H32 A;  1NQ4 A;  1KB9 E;  3M0A A;  3Q5P A;  3H25 A;  2M8L A;  1PIX A;  4BPH A;  3GF7 A;  1DD3 A;  2EHS A;  1A02 F;  4K3A A;  3DS3 A;  3CD6 P;  2B9B A;  2Q5U A;  4HH2 A;  1L0N E;  3E1R A;  2XXM A;  4H13 B;  4IFD K;  3HE4 A;  2WPR A;  2KNC A;  1LTJ A;  2ZT9 D;  4AYC A;  4RES B;  2HPC A;  2QE7 H;  1VQ5 P;  4IPY A;  1LTJ C;  1NO4 A;  1E79 H;  4I7Z B;  1IZN B;  3HD7 A;  4NPF X;  1DNY A;  1YJN P;  3HD7 C;  3Q1M A;  1A8O A;  1SP4 A;  5BU8 B;  2L5G B;  3PLN A;  5EFW B;  2KYV A;  2XU6 A;  2Y0E A;  4GOD A;  2DGY A;  5APV A;  3GZL A;  4WBA A;  2OTK E;  2MR8 A;  1BE3 J;  2CNR A;  1EOQ A;  1KIL B;  2K88 A;  2R3S A;  1ZLL A;  5M1B A;  1L0N K;  1FZC C;  2JB0 A;  1CZQ A;  2DNW A;  1SQP G;  1GTW A;  5AW1 B;  1OWA A;  2FYU J;  2FFD A;  2ERH A;  1NOH A;  1IK9 A;  2WZ7 A;  3U1A A;  2KSJ A;  4K35 A;  4XE5 B;  4PD4 I;  2ZYA A;  4ZKP A;  4UB8 H;  3L70 J;  5BVZ A;  5KLV D;  1T2K C;  1FBM A;  3NY7 B;  4YPC A;  1ZNV A;  3TSI A;  1JO5 A;  2NPS D;  1K05 A;  1EQ7 A;  4WY4 D;  1JTH A;  4H2X C;  3IN6 A;  1L0L D;  1F80 D;  3MHV A;  3KXD A;  2IDB A;  4GR6 A;  1WMK A;  1E0H A;  1RF1 B;  1ZN5 A;  2KLU A;  1EMV A;  5AVZ B;  3G26 A;  3JCU E;  1QL1 A;  2H7H A;  1JMM A;  2PAJ A;  3V4Q A;  3A2A A;  2LXC B;  2HLO A;  3BAS A;  4YXD C;  4YTP C;  1TU3 F;  2XV6 A;  3L36 A;  1G1I A;  1OW7 A;  2M3E A;  1EDK A;  1BGY D;  4MN4 C;  1IO4 A;  4GIF A;  3GLM A;  3IF4 A;  1OXZ A;  5KAI H;  2H89 C;  4H13 C;  3L74 G;  2P10 A;  2OYH B;  2JAZ A;  1K30 A;  1L0H A;  1HVV A;  3L37 A;  5APS A;  4F37 A;  4JYC A;  3TGU E;  1AJY A;  3NTE A;  4PD4 H;  1M6E X;  4I7Z C;  2LKM A;  4DOJ A;  3VP9 A;  3IFM A;  5AW8 B;  1M74 A;  5GTH E;  1M90 Q;  3M91 A;  3M06 A;  3P8C E;  3CX5 I;  1MKM A;  1FDO A;  4PV1 D;  4HKG A;  5C39 A;  1SQQ J;  3CCJ P;  1RE4 A;  1GK4 A;  1KIL A;  2I8D A;  3AE5 C;  2D2C D;  1EDI A;  3L70 D;  2GA1 A;  3VMZ A;  4ZNC A;  1RE4 C;  1AVO A;  1KIL C;  2M0B A;  1XTG B;  1BCC E;  3JC2 2;  2W90 A;  5F2N A;  1Y9B A;  2KWL A;  4RKU J;  1HGV A;  1N86 A;  1YYC A;  5B5E E;  3SWF A;  1Z6M A;  3B5N B;  2E43 A;  1KC8 Q;  2CG5 B;  1ZV8 A;  5BS1 A;  2CPB A;  2KOP A;  4LLH A;  1M1J B;  1PP9 J;  1R8E A;  2Y0D A;  1AUM A;  5CJ0 A;  2EHT A;  2OYI C;  1Q2N A;  1BDD A;  4DT0 A;  1YJW P;  5KLI C;  2N1T B;  4N6J A;  2KXP B;  3S1K A;  5DJU B;  3CE7 A;  1JNM A;  4JQ0 D;  3WU2 H;  1ZRT D;  1RF1 A;  1QVF O;  1GL2 B;  3RL0 D;  3CC2 P;  1X22 A;  1JY2 P;  3CX5 H;  2WWW A;  1RF1 C;  2QRX A;  3MTU E;  1FZE A;  1KLP A;  2HR3 A;  2M5R A;  3MZW B;  5AVT B;  1X8Y A;  1S3J A;  1RY3 A;  2ZVN B;  2AEF A;  3FWL A;  2C9L Y;  1EXJ A;  1LTG C;  2JWA A;  1T6A A;  2KI7 B;  3M1M A;  5CCG D;  2O01 N;  1FDI A;  2VLQ A;  3H0D A;  2KR5 A;  1RNI A;  2WQY C;  2BUO A;  2OYH A;  1HUC A;  3Q3D A;  2QIW A;  1GU4 A;  1JB0 J;  2OYH C;  3CCE P;  3OW2 O;  3H1L G;  2AXC A;  3N4X A;  3P32 A;  3ZDM A;  1EDL A;  2ZT9 B;  3E1I A;  2XZR A;  1AYI A;  3G1G A;  5HV8 A;  2E75 D;  1RO0 A;  2G8Y A;  2KGA A;  5KLV G;  1HBW A;  1SQP J;  1NTZ G;  1BE3 E;  2W8Z A;  2WSE H;  4H44 C;  1Q90 D;  2R32 A;  1YI2 P;  3KPE A;  5KLV K;  2R3C A;  1L0L G;  2SPZ A;  2WPV B;  1NH4 A;  2MD9 A;  1LTB C;  1E6J P;  2PEQ A;  2PNG A;  1YQ3 C;  1VQM P;  4L75 A;  2FYU E;  1CW5 A;  2PGD A;  2C0W A;  3HUS C;  3L75 D;  2P9X A;  3Q5S A;  1PV3 A;  3B5N A;  4I2L C;  3CCV P;  3G21 A;  2JYL A;  5APU A;  2O1J A;  1L4A D;  5JPA A;  3F89 A;  2FYN C;  2K92 A;  1M1J A;  5GTI H;  1BGY G;  2V4H A;  3NXS A;  1M1J C;  3L70 E;  3AEA C;  4U7J A;  1AQ5 A;  2AXT E;  2YIU B;  2KSE A;  2W6A A;  3BCC D;  2N1T C;  1PEM A;  2M5A B;  2QNW A;  2ZYG A;  1OVU A;  1N2D C;  2FQ2 A;  2NPS B;  4WY4 B;  5AW5 B;  3RG6 C;  4PD4 D;  3RK3 B;  2EIA A;  3FGA D;  3UIA A;  3CCS P;  2BEQ D;  4C7N B;  1M57 D;  1GL2 C;  2KG8 A;  3CCR P;  2FYU K;  3L74 J;  1FU1 A;  2A06 G;  1MFT A;  2P58 A;  3G71 P;  5AW9 B;  1BAJ A;  1RQV A;  1N73 B;  3I56 P;  1VQN P;  2H88 C;  1MV8 A;  2YKO A;  2R5B A;  2GUS A;  2HOD A;  1E5W A;  4OH8 B;  2CK3 H;  2PEI A;  2FBW C;  2PRR A;  1R5L A;  3KZI E;  2Q3E A;  2AVA A;  1X0T A;  1JUN A;  3VMY A;  2N6Z A;  4W7Z A;  2ZT9 C;  3CC7 P;  2WSE J;  1S5L H;  3AED C;  1Y8A A;  2YO2 A;  5AW0 B;  2ZYD A;  1AV1 A;  2AFD A;  2JU1 A;  2K94 A;  4XRO A;  1HF9 A;  1SQQ E;  5F2K A;  2ROQ A;  2PEK A;  1S4X A;  4PV1 B;  1M8O B;  2D2C B;  1KQL A;  4BPF A;  3AE7 C;  1W5C E;  1QVG O;  4NPD A;  2NRG A;  3CX5 D;  3A0H E;  2W27 A;  2WIT A;  4UB8 E;  3B71 A;  1PP9 E;  3Q5R A;  3Q2Y A;  1RF0 C;  2B88 A;  1NKN A;  3B5N D;  2JU2 A;  3L74 D;  1ZR2 A;  3WBH A;  5AW2 B;  3S9O A;  4IFM A;  2XZ0 D;  4C46 A;  2Z4E A;  1VHN A;  3NTN A;  4IL6 H;  3VMA A;  1AF8 A;  4Y99 B;  1KIL E;  2YIU C;  1FE6 A;  2M5A A;  2KGC A;  1DD4 A;  3A0B H;  2AEJ A;  3H1K D;  3H6P A;  2NPS A;  3BVH A;  1S2E A;  4U0F A;  2XT1 A;  2W6B A;  3KHU A;  4H0L D;  1J1E B;  4COC A;  1JY3 N;  1SFC D;  2NPS C;  3CCU P;  2N98 A;  2PEO A;  4WY4 C;  4C7N A;  2YKP A;  1KFN A;  3RBZ A;  3E7K A;  5TIS E;  4AUW A;  2VLP A;  3RL0 B;  1W2B O;  1DX7 A;  3LW5 H;  1DIP A;  5H2F H;  5AW3 B;  2K9J A;  3GHG B;  5KAI E;  4M3L A;  3LID A;  3H1L J;  1N73 A;  1DEE G;  2JYG A;  1OR5 A;  1N73 C;  2IFN A;  2KZJ A;  2WTY A;  5HGM A;  4GR2 A;  3V4W A;  1MUU A;  3AE4 C;  2L22 A;  5KLV J;  2KUB A;  3L75 G;  2E1M A;  4XFX A;  4RJT A;  1S9K D;  3U43 A;  1NTZ J;  1U7M A;  3LIE A;  1S5L X;  2JWD A;  1D1D A;  1VQP P;  1ZME C;  1D7M A;  5KP7 B;  1L0L J;  4EYY Q;  2B89 A;  2Z46 A;  3SWY A;  3L71 G;  3V6I A;  1SQP E;  2E75 B;  4U0B A;  2A45 G;  3BCC G;  4DJG A;  1NAY A;  3VOP A;  3AE8 C;  2JJL A;  5AVU B;  3FXE A;  3DS4 A;  1MZ8 A;  1HJ0 A;  4PV1 C;  1BGY J;  2E42 A;  2KOQ A;  1M7L A;  3PRJ A;  1OZH A;  2D2C C;  1ZMB A;  4GKG A;  2FQ1 A;  2P67 A;  1AFO A;  2QJY C;  2K93 A;  2LIU A;  4ZMD A;  3QH9 A;  2ZXE B;  2V7Q H;  3RK2 D;  1FDM A;  4IL6 X;  1L4A B;  1UJZ A;  2A45 I;  2MKV A;  3H1J D;  5AVS B;  3CCM P;  1K73 Q;  4AQR D;  1OW8 A;  2N9Y B;  1JM0 A;  2FFD C;  1SQP K;  3WU2 E;  3H1L D;  2HG5 D;  4Y99 C;  4L73 A;  3CX5 E;  3L73 J;  1LTI C;  2WSC J;  3CWB D;  2Y9Z A;  3VYI A;  2JP3 A;  4W7Y A;  1J1E C;  1NAF A;  1NTZ D;  4KT0 J;  1G2C B;  3L74 E;  1GXH A;  4LC1 A;  3RK3 D;  3RL0 C;  1A43 A;  1BXI A;  3GHG A;  1PPJ D;  2PY8 A;  1NJI Q;  2N9B A;  2VLO A;  5KP6 B;  2UWJ E;  3T97 B;  2BHV A;  4BPG A;  3AE2 C;  2FHS C;  5CCG A;  5CMZ A;  1OFC X;  1AQT A;  3WUT A;  3A3Y B;  3GMA A;  1USE A;  3FXD A;  5CCG C;  1SQB D;  3VTP C;  1FOS E;  3BRV B;  3JSV C;  5BS2 A;  1KTM A;  1FR2 A;  2HFE D;  2A45 H;  4OWF A;  3Q20 A;  3R2P A;  4R4M A;  2FVF A;  2KOR A;  1VQ4 P;  4I1L A;  1KYO I;  4EI2 A;  3WUV A;  1HTL C;  2E75 C;  4UB6 H;  2GZF A;  3H1K G;  2QSI A;  2Q1K A;  3AE6 C;  2YMK A;  3B4S A;  1S9K E;  2K5X A;  2O1K A;  4BRY B;  4N78 D;  1YBK A;  2L91 A;  2YXQ B;  1ZXG A;  4C7R A;  2A06 D;  1RE3 A;  3L73 D;  2V7Q J;  1EZV G;  3M9Q A;  2FXO A;  2GUV A;  1VL2 A;  1GDT A;  4U0E A;  1RE3 C;  5KTB A;  3GKL C;  1YIT P;  1L4A A;  3EWK A;  3PJS K;  4EOT A;  1L4A C;  3GZM A;  1QGK B;  2QVA A;  4PWV B;  2RKL A;  2XDJ A;  2KG6 A;  1FZG A;  3DS0 A;  1KYO H;  1EZV I;  3W67 A;  1KFM A;  2Z45 A;  3B5I A;  4UHP B;  2JEE A;  1NTM J;  1G2C A;  2EFJ A;  1KN7 A;  1SQX D;  4H0L B;  2K0X A;  1SFC B;  3O6Q B;  3V2R A;  2YKQ A;  2J5U A;  3KYQ A;  3MIW A;  2KOO A;  5APW A;  5APX A;  1IUQ A;  3L75 J;  3C9I A;  3H1L E;  5K5G B;  3G9R A;  2Q9I A;  4OGQ D;  3T97 A;  1S72 P;  3I55 P;  1T2K D;  2RH0 A;  2C0X A;  5KLV E;  1JMB A;  1URQ D;  2ZAE B;  3L71 J;  4H2W C;  1NTZ E;  1ACP A;  3BCC J;  1USD A;  1PZQ A;  2K3R A;  2GDW A;  3RK3 E;  2Y9Y A;  1L0L E;  5E79 E;  1LNQ A;  3FWN A;  1R5S A;  2QM7 A;  1PGJ A;  1MFZ A;  2HOD B;  3P05 A;  4QKO A;  3H1J G;  2MF4 A;  2L9F A;  2QJK B;  5B66 H;  3G29 A;  3GF3 A;  3MGN A;  4BXL A;  5KAF H;  2G3A A;  1VQL P;  2I1K A;  5HGN A;  2YNY A;  2GZI A;  1VQO P;  1VQ6 P;  3V2P A;  4BRY A;  1LTS C;  3JCU H;  1BGY E;  3CWB G;  1Q81 Q;  1JOC A;  2ZXX A;  1NU1 D;  2R5D A;  3CC4 P;  2KLV A;  4KHX A;  1CI6 A;  1PEU A;  3VMX A;  1NTZ K;  2VSQ A;  1PPJ G;  1X9V A;  3OJA B;  1AA0 A;  1VDF A;  1NTM D;  2P1J A;  2OGU A;  1L0L K;  4IL6 E;  2FQ0 A;  3EFF K;  4R0M A;  3RK2 B;  4O9B A;  3DPH A;  4QMA A;  3O8Z A;  2K1A A;  3R4Y A;  4N78 E;  3TNU B;  3B5N C;  3VP8 A;  1SQB G;  1A02 J;  2P2U A;  3H47 A;  2KZI A;  2A06 E;  2P7J A;  2LOL A;  2BQ1 E;  2MJZ A;  1FZB A;  1SQB K;  3VN0 A;  3PH0 A;  1SVF A;  2BAS A;  3L71 D;  1SFC A;  3O6Q A;  1FS0 E;  2IZ0 A;  4H0L C;  1SFC C;  1WT6 A;  2C9N Y;  4XFZ A;  2LL8 A;  1NTK G;  2QA4 P;  3G1I A;  4M0I A;  4U0A A;  2LF4 A;  3AEE C;  2KS1 B;  1NKZ B;  4U3F G;  3DS1 A;  3H1I G;  1GZL A;  3M9B A;  5B5E H;  3HTK B;  2LTE A;  3AE3 C;  1N7S D;  2CPS A;  2N5H A;  3L73 G;  2PFX A;  2YXR B;  3MD0 A;  3TF5 A;  5TJH A;  2K9J B;  2ZJS E;  4RO0 A;  3DS5 A;  2M8N A;  1IMP A;  1RH5 B;  1L0N D;  5KJ7 D;  3H1K J;  1FC2 C;  2CQ8 A;  5AVV B;  1ZRT E;  1XTC C;  1P84 I;  4D6T G;  3PTZ A;  4XFY A;  2CWO A;  2BCC G;  2QJK C;  3G6E P;  5CCH A;  4WVZ A;  1YJ9 P;  1SQV G;  1GXG A;  4WB4 A;  2AFE A;  2LKI A;  4GOF A;  2QG4 A;  5AVX B;  2IBZ G;  3L35 A;  3A5T A;  1IC2 A;  5DCK A;  2E76 D;  3U59 A;  3BAT A;  1SQX G;  3D6Z A;  1KYO D;  1NYH A;  1QX8 A;  1U57 A;  3M9H A;  1CEI A;  2ZFC A;  3G0V A;  2N6Y A;  2H8P D;  4DG9 A;  3IR9 A;  4COP A;  2QEX P;  2GM4 A;  4JYB A;  3QWO C;  4CA3 A;  2J58 A;  2L4B A;  3TYY A;  2QJP B;  4H44 D;  1NGM B;  3RK2 C;  3TNU A;  2KGE A;  2IBZ I;  4L74 A;  1IFN A;  3SSU A;  3L72 G;  2W6J H;  2Y0C A;  4BWN A;  3VRL C;  1GW4 A;  1P84 H;  2MR7 A;  4WWI A;  1FZC B;  3NMD A;  1NTM E;  1YQ4 C;  1LJ2 A;  5AW7 B;  3CMA P;  5HGL A;  3V2N A;  1VQ7 P;  1H8A A;  1WRG A;  1IJD B;  2WT7 B;  1JY2 N;  2FXM A;  3DTJ A;  3L75 E;  3M0D A;  2E74 D;  1KZU B;  3CL3 D;  3CXH I;  3RG2 A;  2FVA A;  2KS1 A;  3RK3 C;  4XFJ A;  3HTK A;  1X79 B;  1RO2 A;  1EZV D;  2POH A;  1NU1 G;  1KQG B;  4OGQ B;  3L71 E;  3H1J J;  4I6M C;  2WSS H;  3OAK A;  1Z56 A;  1JCD A;  2E5T A;  2R44 A;  3BCC E;  3EJD A;  1J2J B;  1YIJ P;  1URQ B;  2BEZ F;  1NTM G;  2FYZ A;  4GOE A;  1W2E A;  1Q7Y Q;  2LPK A;  4NPE A;  3K5B A;  2AXT H;  4PD4 E;  3CWB J;  3L4F A;  1NTM K;  3H1H J;  3PHL A;  2FAD A;  1KOR A;  1IFD A;  4DCK A;  4GDO A;  3TK1 A;  3TGU D;  2WPT A;  1T8K A;  3SFE C;  1VF5 D;  3TDK A;  1IFM A;  2KOD A;  5HVC A;  2DW3 A;  4TT3 H;  2XND H;  5CCH D;  4PJ0 H;  2XZ1 C;  3P8C D;  1LT9 B;  3CXH H;  1SQB J;  2W83 C;  1OW6 A;  3N7N A;  2MY5 A;  5KKZ B;  3CME P;  4HB1 A;  3NFQ A;  1BCC D;  1U7J A;  5CJ4 A;  2LXB A;  2H43 A;  2GZG A;  2J59 M;  3H4E A;  3KZI H;  2QJP C;  1HWT C;  2IPP A;  3IAO A;  1KYO E;  3U1C A;  5CZD B;  1NTK J;  1L0N G;  1FZC A;  4U3F J;  2O3J A;  3B4Q A;  3H1I J;  3GG2 A;  2K37 A;  3EJB A;  3CCL P;  3CCQ P;  2OTJ P;  2WT7 A;  2MVU A;  7CEI A;  4ASW A;  3EQ2 A;  1FOS F;  4PH0 A;  4ASV A;  3H1H D;  1KB9 I;  2RN0 A;  3CI9 A;  3HRN A;  3LW5 J;  2LR2 A;  1UII A;  1ZP0 C;  3A0H H;  1YTZ I;  2OYI B;  4Z1M H;  5HGO A;  1PEQ A;  4D6T J;  1PEO A;  1GW3 A;  2BCC J;  4OGQ C;  4JBZ A;  5KLI B;  3F5H A;  1Q86 Q;  2Q7C A;  1URQ A;  4NEO A;  1N7S B;  3GHG C;  4EIJ A;  1IMQ A;  1SQV J;  3H1K E;  3FX0 A;  1URQ C;  5B66 E;  5CHX A;  5KAF E;  1T8Z A;  1KMI Z;  3MGE A;  3CLQ A;  1VQ9 P;  1KQS O;  1HY8 A;  3V5B A;  1SQX J;  5EW5 E;  1EZV E;  1VKU A;  1Y47 A;  2JQ4 A;  3HE5 B;  3AEB C;  4JPZ B;  4XA4 A;  1L0I A;  3G4S P;  1H88 A;  4WYM A;  1IFJ A;  5TIS H;  1VPC A;  2XKM A;  1JCC A;  2XNX A;  2K0Y A;  2FKW B;  2Z44 A;  1LT9 A;  1P84 D;  2K0D X;  2IFM A;  4HJG H;  3MP7 B;  2EG5 A;  1NTK D;  2IYO A;  1BE3 D;  2K9Y A;  3ITK A;  4W80 A;  1ZR4 A;  1LT9 C;  2E76 B;  1OVR A;  1IFP A;  4U3F D;  2JO1 A;  1KB9 H;  2LML A;  3H1I D;  3L72 J;  2B87 B;  2HYN A;  3EFG A;  5KKZ C;  4B86 A;  2K2Q A;  5GTI E;  1SLQ A;  1CI6 B;  2KW2 A;  2FYU D;  2NZ2 A;  1VQK P;  2YMY A;  2OQQ A;  2Q6Q A;  3RL0 g;  4CPG A;  4H44 B;  3HD7 D;  1AVY A;  1NHL A;  5AVQ B;  3HZQ A;  1NVO A;  1JY2 O;  4D6T D;  5CBO A;  2BCC D;  1KQF B;  1JY3 O;  3G3Z A;  3P8M C;  1NU1 J;  1SQV D;  2M8R A;  3RGU A;  4L76 A;  3TGU G;  1PL5 A;  3HUS B;  2IBZ D;  2RMZ A;  2FYN B;  2E74 B;  2WSF H;  2L0Q A;  1BDC A;  4A7P A;  3E2D A;  1OMI A;  2OYI A;  1CSB A;  1M1K Q;  1LP1 B;  1GPJ A;  2I1J A;  3H1J E;  5EJD A;  2JR8 A;  2ONT A;  2JBG A;  4GT1 A;  1N7S A;  3USS A;  1NWQ A;  2WPS A;  2Z5I A;  3CXH D;  4IZ6 A;  1N7S C;  2PP6 A;  2GDX A;  2YO3 A;  3AEF C;  1GMJ A;  3CWB E;  1BCC G;  5I4T G;  3RBX A;  5KJ7 A;  1LT1 A;  2FVE A;  3H1H E;  2X2B A;  5KJ7 C;  3II6 A;  2JGP A;  1S5L E;  3L72 D;  3HE5 A;  1HQB A;  1IFI A;  1JY3 P;  1PPJ E;  2PEN A;  1H0T B;  2KB7 P;  1T3U A;  2QM8 A;  2FAE A;  1VF5 B;  1M6N A;  3LRY A;  4IOI H;  3D6Y A;  2N50 A;  2FXP A;  1L2P A;  1SQQ D;  1T3J A;  2FAC A;  3HYB A;  2ITA A;  1SQB E;  5AVY B;  2E76 C;  5F2O A;  3GJN A;  4H2Y C;  2B87 A;  4H13 D;  2M3B A;  3EJE A;  3H1H G;  1L0N J;  2JKV A;  3AEG C; 
#chains in the Genus database with same CATH homology
 1PEM A;  2OAR A;  1M6E X;  5HGO A;  1IUQ A;  1PEQ A;  3DS4 A;  1KD1 Q;  3H47 A;  1K9M Q;  3G0V A;  1PEO A;  2JO0 A;  3RG6 C;  3M1M A;  5BS2 A;  1M74 A;  1Q86 Q;  2EIA A;  3H0D A;  1RNI A;  3CCS P;  1M90 Q;  3WBH A;  2BQ1 E;  3Q20 A;  4COP A;  2BUO A;  4XRQ A;  1S72 P;  3I55 P;  3CCR P;  1ZMB A;  2QEX P;  1VQ4 P;  3DS2 A;  1VQ8 P;  2KOD A;  3G28 A;  3CCJ P;  3CCE P;  3E2D A;  3MGE A;  3OW2 O;  3CPW O;  1VQ9 P;  3G71 P;  1BAJ A;  4U0D A;  1M1K Q;  1KQS O;  2OTL P;  3G1G A;  4XFZ A;  4U0F A;  5F2N A;  2XT1 A;  2ONT A;  3I56 P;  1VQN P;  4COC A;  1RO0 A;  2M8P A;  3CCU P;  1K8A Q;  2PEO A;  2QA4 P;  3G1I A;  4M0I A;  4U0A A;  2M8L A;  2LF4 A;  3G4S P;  2L6E A;  1N8R Q;  3CME P;  3VRL C;  4WYM A;  1EIA A;  3CCM P;  3DS1 A;  1Q82 Q;  1K73 Q;  3P05 A;  3DS3 A;  1KC8 Q;  3CD6 P;  1W2B O;  5I4T G;  2PEI A;  5BS1 A;  3G29 A;  1YHQ P;  1YI2 P;  1QRJ A;  3CMA P;  2Z44 A;  5HGL A;  1VQ7 P;  4GR6 A;  4U0E A;  2XXM A;  2EG5 A;  3H4E A;  1VQL P;  3DTJ A;  5HGN A;  3G26 A;  1E6J P;  1AUM A;  2M8N A;  3DS5 A;  2JYG A;  2PEQ A;  1VQO P;  3CC7 P;  1VQ6 P;  1YIT P;  1VQM P;  2PEM A;  1Q81 Q;  5HGM A;  1YJW P;  2PEN A;  4GR2 A;  4U0C A;  2P9X A;  4XRO A;  1VQ5 P;  4IPY A;  3CC4 P;  1RO2 A;  3CCV P;  3G21 A;  2E1M A;  2XV6 A;  4XFX A;  5F2K A;  2JYL A;  1JJ2 O;  4XFY A;  2CWO A;  3CXC O;  5JPA A;  1PEU A;  2PEK A;  1M6N A;  1YJN P;  2PEJ A;  1A43 A;  1VQK P;  3LRY A;  4QNB A;  1D1D A;  3CCL P;  3CCQ P;  1VQP P;  2OTJ P;  2PY8 A;  3G6E P;  1A8O A;  1YJ9 P;  1NJI Q;  1QVF O;  1YIJ P;  3CC2 P;  2DGY A;  3HYB A;  4PH1 A;  1QVG O;  3DS0 A;  2Z46 A;  4PH0 A;  1K30 A;  3HZQ A;  5F2O A;  2BHV A;  1Q7Y Q;  2Z45 A;  3B5I A;  2EFJ A;  1EOQ A;  3DPH A;  3NTE A;  5DCK A;  4U0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...