1VQOP

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
b'TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
molecule tags Ribosome
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqoP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqoP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqoP02
3CCUP 1YJWP 1K8AQ 1QVFO 1YITP 3CCMP 1JJ2O 3CXCO 3G71P 1Q86Q 1VQLP 3CCQP 1Q82Q 1VQPP 1QVGO 1NJIQ 3CCLP 3CD6P 3I55P 1Q7YQ 1VQ8P 3CC7P 1W2BO 1M1KQ 1YI2P 2OTJP 1Q81Q 1YJNP 3CCVP 1VQKP 1YHQP 1K73Q 3CCSP 1KC8Q 3CMEP 3CPWO 3CCJP 3OW2O 1VQ7P 1VQNP 1VQ4P 1K9MQ 1YJ9P 1M90Q 1VQOP 1VQ6P 3CCRP 2QA4P 2QEXP 3CC4P 1KD1Q 3CC2P 1VQ5P 1VQMP 1S72P 3CMAP 3I56P 3G4SP 1YIJP 1N8RQ 1KQSO 1VQ9P 3CCEP 2OTLP 3G6EP
chains in the Genus database with same CATH superfamily
3CCUP 4WY4B 1AVYA 1M74A 3Q2YA 2E75D 2HG5D 1BSNA 2KGCA 3CCSP 4PJ0E 3MUDC 4U3FD 1NU1D 1MKMA 3HRNA 1NU1E 2JBGA 1JCCA 3H1JE 1FZEA 1AF8A 5HVCA 1G1IA 3RK3B 4WY4C 1NJIQ 2W6JH 2WT7A 1S9KD 5AW3B 3I5CA 2IBZE 1M1JB 3KZIH 3H1ID 1OW8A 1BGYE 1JNMA 4YPCA 1JY2P 2QEXP 2AXTH 5E79H 2H89C 1FOSF 2M3BA 1CW5A 1N73C 5APVA 2ONTA 5KAIH 1JY3O 1K30A 3VP9A 2E76C 1YTZI 3CXHI 1EC5A 4LGDE 4H44C 3LW5J 4WBAA 3TGUJ 2Y9ZA 3FXDA 4H13C 4D6TE 1UIXA 1D1DA 3V4QA 1VQ9P 3G1IA 5AW7B 1GZLA 1JTHA 1SFCA 2JKVA 1IFJA 1EQ7A 3HTKA 1KYOH 1URQD 4DG9A 1URQB 1XTCC 1DIPA 5GTIE 3RK2C 1OW7A 4NPDA 1KC8Q 1ZXGA 5KJ7A 2YNYA 2NZ2A 4CA3A 3H1HE 1AQ5A 2H7HA 1QX8A 5EFWB 1LTTC 3PRJA 2GUSA 2MR7A 5APWA 3LMOA 2XKMA 4ZKUA 2FFDB 3CX5D 1PEQA 2EG5A 1R5LA 2YIUB 1YQ4C 1G2CA 1GL2A 1GK4A 2GUVA 2BCCE 1OWAA 4BRYA 3GHGA 3HE5A 2N1TA 4PV1C 2WTYA 3VN0A 3DS1A 3O6QB 2OYHC 3L74E 3FXEA 3T97B 1VPCA 4AUWA 1NOHA 3AE4C 3GJNA 2IDBA 4OH8B 2FXMA 3USSA 3AEDC 1K05A 1NYHA 4KHXA 5AW2B 4GODA 1SQBD 2Y0DA 3RL0B 4PWVB 4IFMA 1L0LG 2YIUC 3G9RA 1DD3A 1J1EC 1U7MA 3LIEA 1BDDA 2BASA 1FZCC 2LR2A 2YXRB 1YBKA 2K0XA 1U7JA 3DS2A 1KYOE 2KOQA 5HGLA 1YYCA 3CWBG 1SQBJ 1XTGB 3A5TA 5B66E 2P7JA 4GKGA 1OX3A 1BAJA 3F5HA 3SWYA 1HWTC 1JB0J 1BE3J 1OFCX 4MRTC 1RF0C 1IK7A 4U3FJ 3H32A 4DZOA 2MF4A 1M56D 5KTBA 4EI2A 3H1KE 2CK3H 2E75C 4GIFA 4H13B 3AEEC 1KV4A 2JYLA 1KFNA 1VQOP 2QJYB 1OVUA 1VHNA 3AE5C 3AEFC 1PPJD 4H0LD 5APQA 3B8EB 2PEMA 2JO0A 4W80A 3VOPA 3CD6P 3I55P 3A0HE 5C39A 1OVVA 1KN7A 3AEGC 2P9XA 4RO0A 3IF4A 2KNCA 2DNWA 5TJHA 1VKUA 2FYNC 3MUDA 1MV8A 3GKLC 2H88C 1KQSO 2NPSA 1Q86Q 2ZT9C 1Q82Q 2HLOA 3L73E 2QNWA 3TDKA 1OR5A 1K04A 3DPHA 5M1BA 1P84D 1SQXJ 4W7ZA 3GZLA 2B9BA 1UJZA 4GOFA 1L0LK 3A7OA 2QA4P 3U43A 1KILD 1S4XA 1JCDA 2PRRA 5KKZB 4U0AA 1BGYG 3CMAP 1NTMD 2WSSH 2KOSA 2Z46A 2N6ZA 1J2JB 2Q6QA 3HUSC 1YJWP 3RL0D 1E79H 2Q5UA 5AVSB 3H1JG 5AW6B 2XZRA 1NTZE 3GZMA 1VQ8P 2OYIA 1H89A 2WT7B 3AE1C 1VDFA 1RF1A 3H1LD 1KD1Q 1ZRTD 2YMKA 2AFEA 4WVZA 2JQ4A 1FU1A 1ZOYC 1FJPA 2K3RA 2P10A 3CCMP 1KFMA 3B71A 3U1CA 1BCCD 3CPWO 1YJ9P 2C9LY 3WBHA 3L4FA 2D2CD 2R5BA 4U0CA 4U0DA 2FVEA 3H4EA 1FZGA 3G71P 4XFXA 1GW4A 4U7JA 3H1HG 3AE9C 1S5LE 2K9YA 5APXA 2KGAA 3CX5I 3GF7A 4IL6H 3A3YB 1LTJB 2JWAA 3KHUA 3N4XA 2WSCJ 4XE5B 2FBWC 2YKOA 4OVNF 5GTIH 1BDCA 2PNGA 1RO2A 1DEBA 1NWQA 2PY8A 2FFDA 5KAFH 2M5AA 3F89A 2YO2A 1LT9B 1SQXD 2Q3IA 1EZVE 2O01J 3IAOA 4EIJA 2VLQA 4PD4D 2E74C 4JPZB 2OTKE 1OZHA 4Y28J 4GDOA 1W2BO 1AFOA 1N7SB 4W7YA 3U1AA 2A45G 3K5BA 3PH0A 4BWNA 3T97A 1NO4A 2MKVA 3MD0A 4C7NB 4CPGA 1PIXA 1H8AA 3AE6C 1EXIA 2EHSA 3CX5H 5GTHH 3LRYA 2P1JA 1GDTA 2HYNA 3E1IA 1M8OB 1FBMA 3TK1A 2AEMA 3H1JJ 3GG2A 1EOQA 3G1GA 1VF5B 3LW5H 1GL2C 2YO3A 1SQPJ 2IYPA 4Y99B 2K93A 2FKWB 2W6BA 5AW9B 5TISH 1ZV8A 3H1JD 5AVVB 2KZJA 1KYOD 2YXQB 3MZWB 3ABVC 1KZUB 1FZBA 3H1KJ 3JC22 3V2RA 2KOOA 4HB1A 4PH0A 2V7QH 2XV5A 2ZYGA 1X3OA 4U0EA 1EZVI 3TYYA 3CL3D 5AVRB 3Q1MA 1FOSE 4H44B 1FE6A 4KJMA 1VQLP 1CZQA 2MVUA 2NPSB 3RBZA 3H1KD 2P2UA 3L73G 3L71J 5F2OA 1L4AD 1CI6A 1Z56A 4B86A 3GMAA 2JU1A 1U57A 2AEFA 4EOTA 1NAYA 3A0BE 4JYCA 3HUSA 3L72J 2N50A 4WY4A 2Z5IA 3D71A 1EZVG 3NXSA 1PP9J 3RK3C 1P84I 2D2CC 2J59M 4HJGH 1SQVJ 3AEAC 4NPFX 2ZXXA 2BEQD 3RK3D 3B4QA 4BPHA 2KW2A 3IFMA 1FJKA 2KGDA 5B5EE 3BCCE 4ASWA 1IK9A 3NMDA 4IFFA 2N6YA 3L75J 4IZ6A 1YJNP 5DJTB 1AV1A 3WMM0 3M1MA 3JCUE 3M9BA 2BEZF 2EHTA 2LF4A 1SFCD 2FYUK 5DCKA 5CJ4A 5BS1A 2AVAA 3H47A 1OXZA 2IPPA 4O9BA 1NTZD 1LWUC 2MR8A 1YHQP 2OYIB 1JUNA 4ZMDA 3CLQA 1PL5A 1OIPA 4D6TD 4GT1A 2A45I 4QKOA 5H2FE 3E7KA 3S9OA 1IFPA 2ZT9D 4XA4A 3HTKB 1SQQJ 3EFFK 2LTEA 2QM7A 3G29A 2B88A 1PGJA 2ZYDA 2L4BA 1NVOA 2H8PD 1PGOA 5AW0B 3A2AA 1HGZA 1M57D 4AQRD 2KB7P 5KLIB 3BASA 5BU5A 2WITA 1AUMA 1FZFA 4GOEA 4BPFA 3B5IA 2Q9IA 1S72P 1HJ0A 1KORA 3RL0g 3UIAA 3RL0C 2LOLA 2KORA 2Q7CA 2ITAA 3CXHD 4DJGA 3CXCO 3P8CE 5AVQB 1KILB 3EJDA 3CXHE 1MFTA 1EDKA 3NTEA 5KJ7D 2QG4A 3V2PA 2WSFH 1K73Q 2OGUA 3CMEP 3RGUA 3OW2O 1S3JA 1LTIC 2KSEA 2PEQA 1PP9E 2JAZA 1A8OA 3HE4A 1SQBE 3S1KA 3GHGC 4UB6H 3VTPC 3TF5A 1K8AQ 2B87A 1YTZT 2Z4EA 3WUVA 3CC7P 4HYTB 1UIIA 2I1KA 2K37A 3L37A 2CWOA 4I2LC 1LWUA 3V4WA 2Y0EA 3RG2A 3TNUB 3H25A 4EYYQ 2ZFCA 2O1JA 2K5XA 3LIDA 1GU5A 4PXHB 2CNRA 3S4RA 2PP6A 3IN6A 2B89A 1KMIZ 1VQ4P 2FYUD 1NH4A 2FYZA 2FHSC 2LIWA 2WSCH 5E79E 3H1HD 2V7QJ 1VL2A 3AEBC 1SQVK 3L75E 2X2BA 3PJSK 2NPSC 3L75D 1IMQA 2IZ1A 3CCVP 1E6JP 1IZNB 3C1LA 1X9VA 3VMYA 1BCCG 2WVRA 3EQ2A 2KUBA 3BCCJ 3H1LE 2O01H 3V2QA 2WPVB 5BVZA 2E76B 1G1JA 4PV1D 5KLVE 5F2KA 4N78D 5CCHC 1AYIA 3L36A 4R0MA 2A06G 1LJ2A 1RQUA 4H0LC 3CE7A 2ZVNB 5AVYB 3Q20A 1LTBC 1N7SD 5CCGD 4YTPC 4K35A 1VF5C 3L71D 1YI2P 3BRTB 4QMAA 2YMYA 2FQ1A 1NU1K 4XFZA 1GU4A 1L0ND 1VQNP 1PZQA 1P84H 4U3FE 2P58A 2L22A 1AJYA 2O01N 1LTGC 5KP6B 2L6EA 2Z45A 5TISE 1SQPK 2E74B 3II6A 4D6TG 3L35A 2QJPB 1PP9D 4TLFA 1QL2A 5APTA 4OGQD 1NAFA 2L9FA 2LKIA 1NKNA 4M0IA 5AW5B 3PHLA 4I7ZC 2L91A 2P67A 2KGEA 4HKGA 1LT1A 3G28A 4UB8H 1S2EA 1RQVA 1KILC 2PGDA 2IFMA 4HKZH 3C9IA 2GZIA 3ZDMA 1R5SA 4XRQA 1G2CB 2WPRA 1JMBA 5AVUB 2JP3A 3HE5B 1PEMA 2FXOA 4I6MC 4COPA 3QH9A 1SQQE 3B5NC 2WPSA 2JGPA 2E42A 2QE7H 5KLIC 4Z1MH 2XT1A 2LXCB 1JEKA 2UWJE 3FGAD 5CCGC 5B66H 2K94A 1LNQA 1IO4A 2N5HA 4C7RA 1D7MA 2O3JA 3SSUA 1L4AA 1ZW0A 1PFIA 2W27A 4BPGA 2ZYAA 4XFYA 3P05A 3B5NB 2AF8A 3C8VA 1Q7YQ 2VLPA 3KXDA 1FZCB 3MP7B 3G0VA 1P84E 2M5AB 2FQ2A 3M91A 1Z6MA 1NTKE 1T6AA 2M0BA 3Q3DA 2FXPA 1NTZG 1JY3P 1SP4A 5AVTB 1LWUB 3FX0A 5KP8B 5KLVD 3TNUA 4I7ZB 3WU2H 4U0BA 2KOGA 5CCGA 1KILA 2RMZA 1SQQK 4C7NA 2XZ0D 1KLPA 3A0BH 5CZDB 3CCRP 1JM0A 4IPYA 5JPAA 1BXIA 3CWBE 4C46A 5H2FH 3L71E 3HZQA 5APSA 1QL1A 2GDYA 3R2PA 1FAVA 1M6EX 3E1RA 2VSQA 1SQPG 2E76D 2FYUJ 3W67A 3TSIA 1NTME 2JO1A 2K92A 4BXLA 3DS3A 1VF5D 2FYNB 1OMIA 1EDIA 1L0LJ 1YITP 4RKUJ 2ZVOB 5CCHA 2C0XA 2IBZD 2R32A 1SQXK 3NFQA 5KLVG 2M8LA 4XFJA 3TGUE 5HGNA 2XXMA 1M90Q 1ZRTE 3HD7C 2H43A 3VRLC 1W2EA 1GPJA 1BE3G 4HH2A 1L0LD 5AW4B 1E0HA 5BS2A 1JO5A 1Y8AA 2GZGA 5CBNA 2E75B 2KZIA 1T2KD 1ZN5A 2KIKA 4KT0J 1T2KC 2HODA 2LL8A 3P8MC 3H1HJ 2K0YA 3G26A 2KXPB 1ZR2A 3L70J 1DNYA 3L72G 2ERHA 3CCEP 1L0IA 1DV5A 1KQFB 2RH0A 4UB6E 4WWIA 1JY2N 2J5UA 3HD7B 1R8EA 1H0TB 2I8DA 1SQVG 2XNXA 2O1KA 1S5LH 3KPEA 3SFEC 1Q2NA 1ZMBA 2A06E 3L70D 3VMAA 1NQ4A 2HFED 1SVFA 1NTZJ 1SLQA 1X8YA 3OAKA 1DD4A 1EMVA 1JJ2O 1RE4A 2N9BA 2E1MA 4JF7A 5CMZA 5K5GB 1TU3F 4PJ0H 2BCCJ 1NTMJ 3EFGA 1ZR4A 2PEOA 2R5DA 2AFDA 1W5CE 1SQBK 3M0DC 5EJDA 2E5TA 2JDIH 2C9NY 1NTZK 1KILE 1E5WA 2Y9YA 2Y0CA 1RO0A 1BSHA 3CXHH 1N7SC 4YXDC 1BGYJ 1HBWA 3AE2C 2QRXA 3VYIA 5HGMA 4R4MA 2M8PA 3D6YA 1GMJA 2LMLA 2FVAA 1SQXG 2K1AA 1IUQA 1QRJA 1JTHB 2AXTE 1SFCB 1LTJA 4WB4A 4L73A 2Q1KA 1URQA 5BU8B 1HJBA 3N7NA 1LGHB 3B5ND 2M5RA 3NTNA 2PAJA 1IFDA 1JY3N 1RH5B 1SQVD 2EFJA 3H1LJ 2POHA 1EDLA 2OARA 4TT3H 4JYBA 2AEJA 2FQ0A 4A7PA 3AE8C 1GW3A 3SWFA 1NTKK 2RN0A 3L72D 2Q3EA 2QM8A 1FZCA 2NO8A 2OYHA 2M3EA 2KYVA 1JMMA 3O8ZA 1A02F 3EJBA 2CPSA 1SQQG 1IFMA 5KAFE 1BE3D 3O6QA 4DT0A 4H44D 1RHZB 1PEUA 4N6JA 2DGYA 3MIWA 3MTUE 1L4AB 2WPTA 4PD4I 1ZLLA 2JB0A 3P8CD 4L74A 2BHVA 2PENA 1HGVA 2N98A 1RNIA 4NEOA 3CX5E 1SQPE 1SQPD 5L8RJ 5DJUB 1Y9BA 2KG9A 4NPEA 2E74D 2IX7C 3M0AA 1WT6A 1NKZB 5CCHD 2R3CA 2KG8A 3GW6A 2ZJSE 3BCCD 2KK7A 2QSIA 1MFZA 2K0DX 1FR2A 1YIJP 3JCUH 2JEEA 3CWBD 2M8RA 2GA1A 1VQPP 1GK6A 2WPQA 4PD4H 2JR8A 2WZ7A 4N3YB 2JYGA 1RF1C 4JBZA 2QIWA 2FYUE 4UHPB 4DOJA 3CCJP 4WY4D 4IFDK 5I4TG 4H0LB 2D2CB 2HODB 3HD7D 1OW6A 1IFIA 2YKQA 3ITKA 1L0NK 1USEA 4LC1A 4OGQC 4AYCA 1S9KE 3FWLA 3IR9A 3VP8A 1L0HA 2QJKC 2ZAEB 3H1IE 3AE3C 1IMPA 1SQVE 2KNCB 3TGUG 3H0DA 1OVRA 2QJYC 4UB8E 5CJ0A 1FS0E 4WYMA 1L0NJ 1AVOA 1HQBA 1NTKJ 3L72E 4XROA 1J1DB 1USDA 2GZEA 3M9QA 2WMMA 1T3JA 4JQ0D 3BCCG 5CBOA 2VLNA 1SS1A 5KLVK 2KWLA 1IC2A 2BUOA 1HUCA 1HVVA 2FVFA 2DW3A 1KB9I 1BCCJ 1LTAC 2XU6A 2OTLP 1PPJE 4IL6X 3HYBA 4R4LA 4QNBA 2KLVA 2CPBA 2CQ8A 3L73J 2OYOA 2OQQA 1Q90D 1KTMA 1PP9G 3M06A 1H0TA 3P32A 3U59A 3B4SA 2EIAA 1F80D 1VQ5P 1RF1B 3MGEA 3A0HH 1N7LA 2FY8A 2WSEJ 1NTMK 2RKLA 1IJDB 2MY5A 4L75A 5KP7B 1T8ZA 3OJAB 2GDXA 1GXHA 3D6ZA 2GZJA 1Y47A 2Z44A 7CEIA 1K9MQ 1SQXE 2WSEH 3G21A 1YQ3C 1EIAA 1NTKD 3WU2E 2BCCD 1RE3C 3GHGB 1RY3A 2K2QA 1X0TA 2OYHB 2KG6A 3BRVB 1DX7A 4MN4C 5AVZB 5EW5E 2KS1B 1PEOA 5APYA 3H1IG 4D6TJ 2L0QA 3WUUA 2FADA 2K9JA 2KODA 1KB9E 4IOIH 3OA7A 3AE7C 3E2DA 1KB9D 4YXWH 3L73D 2E5YA 3PLNA 3MHVA 3AECC 1FDIA 2N1TD 1PGQA 2MJZA 2IBZI 1LP1B 2GYKA 2XV6A 4U3FG 1BCCE 3Q5RA 2V4HA 3BVHA 1X22A 1WMKA 4ZKPA 4GR2A 2B87B 1JOCA 3B5NA 2KR5A 3G6EP 3Q5SA 3CWBJ 1HF9A 4H2WC 4F37A 1MZ9A 1VQKP 2HR3A 2VRSA 1HH0A 2W83C 1N7SA 1X79B 5KAIE 3MGNA 1IFNA 3GF3A 2VLOA 2FAEA 2ROQA 2R44A 1HY8A 5CHXA 4H2YC 2OYIC 3CCLP 1M7LA 5AW1B 3V6IA 5KJ7C 1M1KQ 2JWDA 2WSFJ 3L70G 1ZMEC 2IYOA 1N73B 2C0WA 3PTZA 3W68A 2GDWA 3CC2P 1UNKA 4H13D 4COCA 1M1JC 2GM4A 4DCKA 3M0DA 2JU2A 2QVAA 1L0NE 3CI9A 4K3AA 2W6AA 4L76A 5AVWB 2M8NA 5KKZC 2HPCB 1NU1G 5GTHE 1N86A 1RE4C 3L74J 3VMZA 1T3UA 3G4SP 1WRGA 1AQTA 3L75G 1DH3A 2ZT9B 2R3SA 2N5IA 1SQQD 2WQYC 3D70A 5KLVJ 2W8ZA 2PEKA 3H1LG 2BQ1E 3Q5PA 2FYUG 1MZ8A 2G3AA 3SWKA 3FWNA 1T8KA 4GR6A 4PD4E 2IZ0A 1FZAA 3NY7B 1CEIA 1KQLA 2NPSD 2KSJA 1NTKG 3R4YA 3H1IJ 2PFXA 1JY2O 1QGKB 2Z5HA 2PEIA 2KI7B 1DEEG 1KYOI 4U0FA 1ZP0C 3QWOC 1M1JA 2XNDH 3CCQP 1QEXA 1AA0A 4RESB 2FACA 3HD7A 1ACPA 2GZFA 3DTJA 2LIUA 4N78E 2J58A 3GLMA 1KQGB 2ZXEB 4M3LA 2QJKB 2XZ1C 4Y99C 4OGQB 1A43A 1ZNVA 3RG6C 1RF0A 2W90A 3H6PA 2SPZA 3EJEA 1Q81Q 1PPJG 2G8YA 2L5GB 1BE3E 1VQ7P 1GL2B 2CGQA 4BRYB 1J1EB 5HV8A 2KLUA 3G3ZA 2N1TB 4PH1A 4ASVA 1FDOA 1S5LX 1MUUA 3L74D 2KP8A 1NHLA 2A45H 5HGOA 3DS4A 5B5EH 2BCCG 1GTWA 1NTMG 5F2NA 1BGYD 3TGUD 2YKPA 2MD9A 4EDFA 2LKMA 1FC2C 3V2NA 1LT9C 3I56P 1GD2E 3V5BA 1M6NA 1LT9A 1FDMA 2I1JA 3JSVC 3L74G 1L0LE 1QVFO 1EZVD 3DS0A 2N9YB 3P7KA 4PV1B 1QLED 2MVVA 3RK3E 2E43A 1PGPA 3DS5A 2N1TC 1HTLC 3RK2D 2WWWA 2KS1A 1L2PA 2FFDC 1LTJC 2AXCA 4RJTA 1CSBA 2K9JB 3EWKA 2KOPA 1L4AC 1SQBG 2IBZG 2K88A 4H2XC 2LXBA 3PP5A 1GXGA 1KB9H 1LP1A 1S1CX 3KZIE 1VQMP 5APUA 4IL6E 3RK2B 1NGMB 3H1KG 4LLHA 1URQC 1LTSC 3KQGA 3HE4B 2JJLA 5AVXB 3BATA 2OTJP 2LPKA 1J1DC 1RE3A 2IFNA 2NRGA 3M9HA 1L0NG 2PEJA 3KDPB 3VMXA 3CC4P 3RBXA 1EXJA 1N2DC 2HPCA 2XDJA 1H88A 3L71G 1N8RQ 5AW8B 1QVGO 3WUTA 3KYQA 1A02J 1GL2D 1SFCC 3H32B 2QJPC 1VQ6P 2A06D 3L70E 1CI6B 1N73A 1NU1J 4ZNCA 1EDJA 2CG5B 4OWFA 4I1LA 3SFDC 1PV3A 3HUSB
chains in the Genus database with same CATH topology
3CCUP 1QVFO 3HYBA 1YITP 4QNBA 3CCMP 3CXCO 3DS0A 5F2KA 5HGMA 1M74A 2M8PA 1EOQA 2XT1A 3G1GA 3NTEA 1YJNP 2M8LA 1VQKP 1IUQA 1QRJA 1K73Q 5HGNA 3CCSP 3CMEP 1PEQA 2JYLA 2EG5A 3CPWO 3DS5A 3OW2O 2XXMA 1YJ9P 1M90Q 1VQOP 2PEIA 3VRLC 3WBHA 3M1MA 2PEQA 2EIAA 1VQ5P 2EFJA 3MGEA 2LF4A 1A8OA 2OARA 3Q20A 4U0CA 1YIJP 4U0DA 4U0FA 5DCKA 3H4EA 4XFYA 5BS1A 2PEMA 5BS2A 3P05A 1K8AQ 2JO0A 3G71P 4XFXA 3CCQP 3CCLP 1VQPP 3H47A 3DS1A 1NJIQ 3CD6P 3I55P 1Q7YQ 3CC7P 1M1KQ 1YI2P 3DTJA 3G0VA 4XFZA 2JYGA 2P9XA 1YHQP 4PH0A 3CCJP 2Z44A 1VQNP 1K9MQ 2CWOA 5I4TG 2QEXP 3G26A 3CC2P 3G21A 1VQMP 4COCA 1EIAA 4U0EA 1A43A 3RG6C 2ONTA 1KQSO 3CCEP 2L6EA 2Z45A 1VQLP 1Q86Q 1K30A 1Q82Q 4U0BA 3DPHA 2OTJP 3G29A 1Q81Q 1RO2A 5F2OA 2M8NA 2PY8A 1VQ7P 1VQ4P 2PEJA 1PEOA 3CCRP 2QA4P 1PEUA 3CC4P 4U0AA 4IPYA 2DGYA 1ZMBA 5JPAA 3H0DA 3CMAP 2KODA 2Z46A 1D1DA 4M0IA 3G4SP 1N8RQ 3DS2A 3E2DA 1VQ9P 3G1IA 4PH1A 4WYMA 1YJWP 5HGLA 2BHVA 2PENA 3G28A 1JJ2O 3HZQA 1QVGO 2E1MA 4XROA 1VQ8P 1W2BO 1M6EX 2PEOA 3CCVP 1RNIA 1BAJA 1E6JP 5HGOA 3DS4A 4XRQA 2PEKA 2XV6A 1KC8Q 1AUMA 5F2NA 1VQ6P 1PEMA 3B5IA 2BQ1E 2BUOA 1KD1Q 1S72P 4GR2A 3I56P 4COPA 3DS3A 3LRYA 1RO0A 1M6NA 4GR6A 2OTLP 3G6EP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU P;  1YJW P;  1K8A Q;  1QVF O;  1YIT P;  3CCM P;  1JJ2 O;  3CXC O;  3G71 P;  1Q86 Q;  1VQL P;  3CCQ P;  1Q82 Q;  1VQP P;  1QVG O;  1NJI Q;  3CCL P;  3CD6 P;  3I55 P;  1Q7Y Q;  1VQ8 P;  3CC7 P;  1W2B O;  1M1K Q;  1YI2 P;  2OTJ P;  1Q81 Q;  1YJN P;  3CCV P;  1VQK P;  1YHQ P;  1K73 Q;  3CCS P;  1KC8 Q;  3CME P;  3CPW O;  3CCJ P;  3OW2 O;  1VQ7 P;  1VQN P;  1VQ4 P;  1K9M Q;  1YJ9 P;  1M90 Q;  1VQO P;  1VQ6 P;  3CCR P;  2QA4 P;  2QEX P;  3CC4 P;  1KD1 Q;  3CC2 P;  1VQ5 P;  1VQM P;  1S72 P;  3CMA P;  3I56 P;  3G4S P;  1YIJ P;  1N8R Q;  1KQS O;  1VQ9 P;  3CCE P;  2OTL P;  3G6E P; 
#chains in the Genus database with same CATH topology
 3CCU P;  4WY4 B;  1AVY A;  1M74 A;  3Q2Y A;  2E75 D;  2HG5 D;  1BSN A;  2KGC A;  3CCS P;  4PJ0 E;  3MUD C;  4U3F D;  1NU1 D;  1MKM A;  3HRN A;  1NU1 E;  2JBG A;  1JCC A;  3H1J E;  1FZE A;  1AF8 A;  5HVC A;  1G1I A;  3RK3 B;  4WY4 C;  1NJI Q;  2W6J H;  2WT7 A;  1S9K D;  5AW3 B;  3I5C A;  2IBZ E;  1M1J B;  3KZI H;  3H1I D;  1OW8 A;  1BGY E;  1JNM A;  4YPC A;  1JY2 P;  2QEX P;  2AXT H;  5E79 H;  2H89 C;  1FOS F;  2M3B A;  1CW5 A;  1N73 C;  5APV A;  2ONT A;  5KAI H;  1JY3 O;  1K30 A;  3VP9 A;  2E76 C;  1YTZ I;  3CXH I;  1EC5 A;  4LGD E;  4H44 C;  3LW5 J;  4WBA A;  3TGU J;  2Y9Z A;  3FXD A;  4H13 C;  4D6T E;  1UIX A;  1D1D A;  3V4Q A;  1VQ9 P;  3G1I A;  5AW7 B;  1GZL A;  1JTH A;  1SFC A;  2JKV A;  1IFJ A;  1EQ7 A;  3HTK A;  1KYO H;  1URQ D;  4DG9 A;  1URQ B;  1XTC C;  1DIP A;  5GTI E;  3RK2 C;  1OW7 A;  4NPD A;  1KC8 Q;  1ZXG A;  5KJ7 A;  2YNY A;  2NZ2 A;  4CA3 A;  3H1H E;  1AQ5 A;  2H7H A;  1QX8 A;  5EFW B;  1LTT C;  3PRJ A;  2GUS A;  2MR7 A;  5APW A;  3LMO A;  2XKM A;  4ZKU A;  2FFD B;  3CX5 D;  1PEQ A;  2EG5 A;  1R5L A;  2YIU B;  1YQ4 C;  1G2C A;  1GL2 A;  1GK4 A;  2GUV A;  2BCC E;  1OWA A;  4BRY A;  3GHG A;  3HE5 A;  2N1T A;  4PV1 C;  2WTY A;  3VN0 A;  3DS1 A;  3O6Q B;  2OYH C;  3L74 E;  3FXE A;  3T97 B;  1VPC A;  4AUW A;  1NOH A;  3AE4 C;  3GJN A;  2IDB A;  4OH8 B;  2FXM A;  3USS A;  3AED C;  1K05 A;  1NYH A;  4KHX A;  5AW2 B;  4GOD A;  1SQB D;  2Y0D A;  3RL0 B;  4PWV B;  4IFM A;  1L0L G;  2YIU C;  3G9R A;  1DD3 A;  1J1E C;  1U7M A;  3LIE A;  1BDD A;  2BAS A;  1FZC C;  2LR2 A;  2YXR B;  1YBK A;  2K0X A;  1U7J A;  3DS2 A;  1KYO E;  2KOQ A;  5HGL A;  1YYC A;  3CWB G;  1SQB J;  1XTG B;  3A5T A;  5B66 E;  2P7J A;  4GKG A;  1OX3 A;  1BAJ A;  3F5H A;  3SWY A;  1HWT C;  1JB0 J;  1BE3 J;  1OFC X;  4MRT C;  1RF0 C;  1IK7 A;  4U3F J;  3H32 A;  4DZO A;  2MF4 A;  1M56 D;  5KTB A;  4EI2 A;  3H1K E;  2CK3 H;  2E75 C;  4GIF A;  4H13 B;  3AEE C;  1KV4 A;  2JYL A;  1KFN A;  1VQO P;  2QJY B;  1OVU A;  1VHN A;  3AE5 C;  3AEF C;  1PPJ D;  4H0L D;  5APQ A;  3B8E B;  2PEM A;  2JO0 A;  4W80 A;  3VOP A;  3CD6 P;  3I55 P;  3A0H E;  5C39 A;  1OVV A;  1KN7 A;  3AEG C;  2P9X A;  4RO0 A;  3IF4 A;  2KNC A;  2DNW A;  5TJH A;  1VKU A;  2FYN C;  3MUD A;  1MV8 A;  3GKL C;  2H88 C;  1KQS O;  2NPS A;  1Q86 Q;  2ZT9 C;  1Q82 Q;  2HLO A;  3L73 E;  2QNW A;  3TDK A;  1OR5 A;  1K04 A;  3DPH A;  5M1B A;  1P84 D;  1SQX J;  4W7Z A;  3GZL A;  2B9B A;  1UJZ A;  4GOF A;  1L0L K;  3A7O A;  2QA4 P;  3U43 A;  1KIL D;  1S4X A;  1JCD A;  2PRR A;  5KKZ B;  4U0A A;  1BGY G;  3CMA P;  1NTM D;  2WSS H;  2KOS A;  2Z46 A;  2N6Z A;  1J2J B;  2Q6Q A;  3HUS C;  1YJW P;  3RL0 D;  1E79 H;  2Q5U A;  5AVS B;  3H1J G;  5AW6 B;  2XZR A;  1NTZ E;  3GZM A;  1VQ8 P;  2OYI A;  1H89 A;  2WT7 B;  3AE1 C;  1VDF A;  1RF1 A;  3H1L D;  1KD1 Q;  1ZRT D;  2YMK A;  2AFE A;  4WVZ A;  2JQ4 A;  1FU1 A;  1ZOY C;  1FJP A;  2K3R A;  2P10 A;  3CCM P;  1KFM A;  3B71 A;  3U1C A;  1BCC D;  3CPW O;  1YJ9 P;  2C9L Y;  3WBH A;  3L4F A;  2D2C D;  2R5B A;  4U0C A;  4U0D A;  2FVE A;  3H4E A;  1FZG A;  3G71 P;  4XFX A;  1GW4 A;  4U7J A;  3H1H G;  3AE9 C;  1S5L E;  2K9Y A;  5APX A;  2KGA A;  3CX5 I;  3GF7 A;  4IL6 H;  3A3Y B;  1LTJ B;  2JWA A;  3KHU A;  3N4X A;  2WSC J;  4XE5 B;  2FBW C;  2YKO A;  4OVN F;  5GTI H;  1BDC A;  2PNG A;  1RO2 A;  1DEB A;  1NWQ A;  2PY8 A;  2FFD A;  5KAF H;  2M5A A;  3F89 A;  2YO2 A;  1LT9 B;  1SQX D;  2Q3I A;  1EZV E;  2O01 J;  3IAO A;  4EIJ A;  2VLQ A;  4PD4 D;  2E74 C;  4JPZ B;  2OTK E;  1OZH A;  4Y28 J;  4GDO A;  1W2B O;  1AFO A;  1N7S B;  4W7Y A;  3U1A A;  2A45 G;  3K5B A;  3PH0 A;  4BWN A;  3T97 A;  1NO4 A;  2MKV A;  3MD0 A;  4C7N B;  4CPG A;  1PIX A;  1H8A A;  3AE6 C;  1EXI A;  2EHS A;  3CX5 H;  5GTH H;  3LRY A;  2P1J A;  1GDT A;  2HYN A;  3E1I A;  1M8O B;  1FBM A;  3TK1 A;  2AEM A;  3H1J J;  3GG2 A;  1EOQ A;  3G1G A;  1VF5 B;  3LW5 H;  1GL2 C;  2YO3 A;  1SQP J;  2IYP A;  4Y99 B;  2K93 A;  2FKW B;  2W6B A;  5AW9 B;  5TIS H;  1ZV8 A;  3H1J D;  5AVV B;  2KZJ A;  1KYO D;  2YXQ B;  3MZW B;  3ABV C;  1KZU B;  1FZB A;  3H1K J;  3JC2 2;  3V2R A;  2KOO A;  4HB1 A;  4PH0 A;  2V7Q H;  2XV5 A;  2ZYG A;  1X3O A;  4U0E A;  1EZV I;  3TYY A;  3CL3 D;  5AVR B;  3Q1M A;  1FOS E;  4H44 B;  1FE6 A;  4KJM A;  1VQL P;  1CZQ A;  2MVU A;  2NPS B;  3RBZ A;  3H1K D;  2P2U A;  3L73 G;  3L71 J;  5F2O A;  1L4A D;  1CI6 A;  1Z56 A;  4B86 A;  3GMA A;  2JU1 A;  1U57 A;  2AEF A;  4EOT A;  1NAY A;  3A0B E;  4JYC A;  3HUS A;  3L72 J;  2N50 A;  4WY4 A;  2Z5I A;  3D71 A;  1EZV G;  3NXS A;  1PP9 J;  3RK3 C;  1P84 I;  2D2C C;  2J59 M;  4HJG H;  1SQV J;  3AEA C;  4NPF X;  2ZXX A;  2BEQ D;  3RK3 D;  3B4Q A;  4BPH A;  2KW2 A;  3IFM A;  1FJK A;  2KGD A;  5B5E E;  3BCC E;  4ASW A;  1IK9 A;  3NMD A;  4IFF A;  2N6Y A;  3L75 J;  4IZ6 A;  1YJN P;  5DJT B;  1AV1 A;  3WMM 0;  3M1M A;  3JCU E;  3M9B A;  2BEZ F;  2EHT A;  2LF4 A;  1SFC D;  2FYU K;  5DCK A;  5CJ4 A;  5BS1 A;  2AVA A;  3H47 A;  1OXZ A;  2IPP A;  4O9B A;  1NTZ D;  1LWU C;  2MR8 A;  1YHQ P;  2OYI B;  1JUN A;  4ZMD A;  3CLQ A;  1PL5 A;  1OIP A;  4D6T D;  4GT1 A;  2A45 I;  4QKO A;  5H2F E;  3E7K A;  3S9O A;  1IFP A;  2ZT9 D;  4XA4 A;  3HTK B;  1SQQ J;  3EFF K;  2LTE A;  2QM7 A;  3G29 A;  2B88 A;  1PGJ A;  2ZYD A;  2L4B A;  1NVO A;  2H8P D;  1PGO A;  5AW0 B;  3A2A A;  1HGZ A;  1M57 D;  4AQR D;  2KB7 P;  5KLI B;  3BAS A;  5BU5 A;  2WIT A;  1AUM A;  1FZF A;  4GOE A;  4BPF A;  3B5I A;  2Q9I A;  1S72 P;  1HJ0 A;  1KOR A;  3RL0 g;  3UIA A;  3RL0 C;  2LOL A;  2KOR A;  2Q7C A;  2ITA A;  3CXH D;  4DJG A;  3CXC O;  3P8C E;  5AVQ B;  1KIL B;  3EJD A;  3CXH E;  1MFT A;  1EDK A;  3NTE A;  5KJ7 D;  2QG4 A;  3V2P A;  2WSF H;  1K73 Q;  2OGU A;  3CME P;  3RGU A;  3OW2 O;  1S3J A;  1LTI C;  2KSE A;  2PEQ A;  1PP9 E;  2JAZ A;  1A8O A;  3HE4 A;  1SQB E;  3S1K A;  3GHG C;  4UB6 H;  3VTP C;  3TF5 A;  1K8A Q;  2B87 A;  1YTZ T;  2Z4E A;  3WUV A;  3CC7 P;  4HYT B;  1UII A;  2I1K A;  2K37 A;  3L37 A;  2CWO A;  4I2L C;  1LWU A;  3V4W A;  2Y0E A;  3RG2 A;  3TNU B;  3H25 A;  4EYY Q;  2ZFC A;  2O1J A;  2K5X A;  3LID A;  1GU5 A;  4PXH B;  2CNR A;  3S4R A;  2PP6 A;  3IN6 A;  2B89 A;  1KMI Z;  1VQ4 P;  2FYU D;  1NH4 A;  2FYZ A;  2FHS C;  2LIW A;  2WSC H;  5E79 E;  3H1H D;  2V7Q J;  1VL2 A;  3AEB C;  1SQV K;  3L75 E;  2X2B A;  3PJS K;  2NPS C;  3L75 D;  1IMQ A;  2IZ1 A;  3CCV P;  1E6J P;  1IZN B;  3C1L A;  1X9V A;  3VMY A;  1BCC G;  2WVR A;  3EQ2 A;  2KUB A;  3BCC J;  3H1L E;  2O01 H;  3V2Q A;  2WPV B;  5BVZ A;  2E76 B;  1G1J A;  4PV1 D;  5KLV E;  5F2K A;  4N78 D;  5CCH C;  1AYI A;  3L36 A;  4R0M A;  2A06 G;  1LJ2 A;  1RQU A;  4H0L C;  3CE7 A;  2ZVN B;  5AVY B;  3Q20 A;  1LTB C;  1N7S D;  5CCG D;  4YTP C;  4K35 A;  1VF5 C;  3L71 D;  1YI2 P;  3BRT B;  4QMA A;  2YMY A;  2FQ1 A;  1NU1 K;  4XFZ A;  1GU4 A;  1L0N D;  1VQN P;  1PZQ A;  1P84 H;  4U3F E;  2P58 A;  2L22 A;  1AJY A;  2O01 N;  1LTG C;  5KP6 B;  2L6E A;  2Z45 A;  5TIS E;  1SQP K;  2E74 B;  3II6 A;  4D6T G;  3L35 A;  2QJP B;  1PP9 D;  4TLF A;  1QL2 A;  5APT A;  4OGQ D;  1NAF A;  2L9F A;  2LKI A;  1NKN A;  4M0I A;  5AW5 B;  3PHL A;  4I7Z C;  2L91 A;  2P67 A;  2KGE A;  4HKG A;  1LT1 A;  3G28 A;  4UB8 H;  1S2E A;  1RQV A;  1KIL C;  2PGD A;  2IFM A;  4HKZ H;  3C9I A;  2GZI A;  3ZDM A;  1R5S A;  4XRQ A;  1G2C B;  2WPR A;  1JMB A;  5AVU B;  2JP3 A;  3HE5 B;  1PEM A;  2FXO A;  4I6M C;  4COP A;  3QH9 A;  1SQQ E;  3B5N C;  2WPS A;  2JGP A;  2E42 A;  2QE7 H;  5KLI C;  4Z1M H;  2XT1 A;  2LXC B;  1JEK A;  2UWJ E;  3FGA D;  5CCG C;  5B66 H;  2K94 A;  1LNQ A;  1IO4 A;  2N5H A;  4C7R A;  1D7M A;  2O3J A;  3SSU A;  1L4A A;  1ZW0 A;  1PFI A;  2W27 A;  4BPG A;  2ZYA A;  4XFY A;  3P05 A;  3B5N B;  2AF8 A;  3C8V A;  1Q7Y Q;  2VLP A;  3KXD A;  1FZC B;  3MP7 B;  3G0V A;  1P84 E;  2M5A B;  2FQ2 A;  3M91 A;  1Z6M A;  1NTK E;  1T6A A;  2M0B A;  3Q3D A;  2FXP A;  1NTZ G;  1JY3 P;  1SP4 A;  5AVT B;  1LWU B;  3FX0 A;  5KP8 B;  5KLV D;  3TNU A;  4I7Z B;  3WU2 H;  4U0B A;  2KOG A;  5CCG A;  1KIL A;  2RMZ A;  1SQQ K;  4C7N A;  2XZ0 D;  1KLP A;  3A0B H;  5CZD B;  3CCR P;  1JM0 A;  4IPY A;  5JPA A;  1BXI A;  3CWB E;  4C46 A;  5H2F H;  3L71 E;  3HZQ A;  5APS A;  1QL1 A;  2GDY A;  3R2P A;  1FAV A;  1M6E X;  3E1R A;  2VSQ A;  1SQP G;  2E76 D;  2FYU J;  3W67 A;  3TSI A;  1NTM E;  2JO1 A;  2K92 A;  4BXL A;  3DS3 A;  1VF5 D;  2FYN B;  1OMI A;  1EDI A;  1L0L J;  1YIT P;  4RKU J;  2ZVO B;  5CCH A;  2C0X A;  2IBZ D;  2R32 A;  1SQX K;  3NFQ A;  5KLV G;  2M8L A;  4XFJ A;  3TGU E;  5HGN A;  2XXM A;  1M90 Q;  1ZRT E;  3HD7 C;  2H43 A;  3VRL C;  1W2E A;  1GPJ A;  1BE3 G;  4HH2 A;  1L0L D;  5AW4 B;  1E0H A;  5BS2 A;  1JO5 A;  1Y8A A;  2GZG A;  5CBN A;  2E75 B;  2KZI A;  1T2K D;  1ZN5 A;  2KIK A;  4KT0 J;  1T2K C;  2HOD A;  2LL8 A;  3P8M C;  3H1H J;  2K0Y A;  3G26 A;  2KXP B;  1ZR2 A;  3L70 J;  1DNY A;  3L72 G;  2ERH A;  3CCE P;  1L0I A;  1DV5 A;  1KQF B;  2RH0 A;  4UB6 E;  4WWI A;  1JY2 N;  2J5U A;  3HD7 B;  1R8E A;  1H0T B;  2I8D A;  1SQV G;  2XNX A;  2O1K A;  1S5L H;  3KPE A;  3SFE C;  1Q2N A;  1ZMB A;  2A06 E;  3L70 D;  3VMA A;  1NQ4 A;  2HFE D;  1SVF A;  1NTZ J;  1SLQ A;  1X8Y A;  3OAK A;  1DD4 A;  1EMV A;  1JJ2 O;  1RE4 A;  2N9B A;  2E1M A;  4JF7 A;  5CMZ A;  5K5G B;  1TU3 F;  4PJ0 H;  2BCC J;  1NTM J;  3EFG A;  1ZR4 A;  2PEO A;  2R5D A;  2AFD A;  1W5C E;  1SQB K;  3M0D C;  5EJD A;  2E5T A;  2JDI H;  2C9N Y;  1NTZ K;  1KIL E;  1E5W A;  2Y9Y A;  2Y0C A;  1RO0 A;  1BSH A;  3CXH H;  1N7S C;  4YXD C;  1BGY J;  1HBW A;  3AE2 C;  2QRX A;  3VYI A;  5HGM A;  4R4M A;  2M8P A;  3D6Y A;  1GMJ A;  2LML A;  2FVA A;  1SQX G;  2K1A A;  1IUQ A;  1QRJ A;  1JTH B;  2AXT E;  1SFC B;  1LTJ A;  4WB4 A;  4L73 A;  2Q1K A;  1URQ A;  5BU8 B;  1HJB A;  3N7N A;  1LGH B;  3B5N D;  2M5R A;  3NTN A;  2PAJ A;  1IFD A;  1JY3 N;  1RH5 B;  1SQV D;  2EFJ A;  3H1L J;  2POH A;  1EDL A;  2OAR A;  4TT3 H;  4JYB A;  2AEJ A;  2FQ0 A;  4A7P A;  3AE8 C;  1GW3 A;  3SWF A;  1NTK K;  2RN0 A;  3L72 D;  2Q3E A;  2QM8 A;  1FZC A;  2NO8 A;  2OYH A;  2M3E A;  2KYV A;  1JMM A;  3O8Z A;  1A02 F;  3EJB A;  2CPS A;  1SQQ G;  1IFM A;  5KAF E;  1BE3 D;  3O6Q A;  4DT0 A;  4H44 D;  1RHZ B;  1PEU A;  4N6J A;  2DGY A;  3MIW A;  3MTU E;  1L4A B;  2WPT A;  4PD4 I;  1ZLL A;  2JB0 A;  3P8C D;  4L74 A;  2BHV A;  2PEN A;  1HGV A;  2N98 A;  1RNI A;  4NEO A;  3CX5 E;  1SQP E;  1SQP D;  5L8R J;  5DJU B;  1Y9B A;  2KG9 A;  4NPE A;  2E74 D;  2IX7 C;  3M0A A;  1WT6 A;  1NKZ B;  5CCH D;  2R3C A;  2KG8 A;  3GW6 A;  2ZJS E;  3BCC D;  2KK7 A;  2QSI A;  1MFZ A;  2K0D X;  1FR2 A;  1YIJ P;  3JCU H;  2JEE A;  3CWB D;  2M8R A;  2GA1 A;  1VQP P;  1GK6 A;  2WPQ A;  4PD4 H;  2JR8 A;  2WZ7 A;  4N3Y B;  2JYG A;  1RF1 C;  4JBZ A;  2QIW A;  2FYU E;  4UHP B;  4DOJ A;  3CCJ P;  4WY4 D;  4IFD K;  5I4T G;  4H0L B;  2D2C B;  2HOD B;  3HD7 D;  1OW6 A;  1IFI A;  2YKQ A;  3ITK A;  1L0N K;  1USE A;  4LC1 A;  4OGQ C;  4AYC A;  1S9K E;  3FWL A;  3IR9 A;  3VP8 A;  1L0H A;  2QJK C;  2ZAE B;  3H1I E;  3AE3 C;  1IMP A;  1SQV E;  2KNC B;  3TGU G;  3H0D A;  1OVR A;  2QJY C;  4UB8 E;  5CJ0 A;  1FS0 E;  4WYM A;  1L0N J;  1AVO A;  1HQB A;  1NTK J;  3L72 E;  4XRO A;  1J1D B;  1USD A;  2GZE A;  3M9Q A;  2WMM A;  1T3J A;  4JQ0 D;  3BCC G;  5CBO A;  2VLN A;  1SS1 A;  5KLV K;  2KWL A;  1IC2 A;  2BUO A;  1HUC A;  1HVV A;  2FVF A;  2DW3 A;  1KB9 I;  1BCC J;  1LTA C;  2XU6 A;  2OTL P;  1PPJ E;  4IL6 X;  3HYB A;  4R4L A;  4QNB A;  2KLV A;  2CPB A;  2CQ8 A;  3L73 J;  2OYO A;  2OQQ A;  1Q90 D;  1KTM A;  1PP9 G;  3M06 A;  1H0T A;  3P32 A;  3U59 A;  3B4S A;  2EIA A;  1F80 D;  1VQ5 P;  1RF1 B;  3MGE A;  3A0H H;  1N7L A;  2FY8 A;  2WSE J;  1NTM K;  2RKL A;  1IJD B;  2MY5 A;  4L75 A;  5KP7 B;  1T8Z A;  3OJA B;  2GDX A;  1GXH A;  3D6Z A;  2GZJ A;  1Y47 A;  2Z44 A;  7CEI A;  1K9M Q;  1SQX E;  2WSE H;  3G21 A;  1YQ3 C;  1EIA A;  1NTK D;  3WU2 E;  2BCC D;  1RE3 C;  3GHG B;  1RY3 A;  2K2Q A;  1X0T A;  2OYH B;  2KG6 A;  3BRV B;  1DX7 A;  4MN4 C;  5AVZ B;  5EW5 E;  2KS1 B;  1PEO A;  5APY A;  3H1I G;  4D6T J;  2L0Q A;  3WUU A;  2FAD A;  2K9J A;  2KOD A;  1KB9 E;  4IOI H;  3OA7 A;  3AE7 C;  3E2D A;  1KB9 D;  4YXW H;  3L73 D;  2E5Y A;  3PLN A;  3MHV A;  3AEC C;  1FDI A;  2N1T D;  1PGQ A;  2MJZ A;  2IBZ I;  1LP1 B;  2GYK A;  2XV6 A;  4U3F G;  1BCC E;  3Q5R A;  2V4H A;  3BVH A;  1X22 A;  1WMK A;  4ZKP A;  4GR2 A;  2B87 B;  1JOC A;  3B5N A;  2KR5 A;  3G6E P;  3Q5S A;  3CWB J;  1HF9 A;  4H2W C;  4F37 A;  1MZ9 A;  1VQK P;  2HR3 A;  2VRS A;  1HH0 A;  2W83 C;  1N7S A;  1X79 B;  5KAI E;  3MGN A;  1IFN A;  3GF3 A;  2VLO A;  2FAE A;  2ROQ A;  2R44 A;  1HY8 A;  5CHX A;  4H2Y C;  2OYI C;  3CCL P;  1M7L A;  5AW1 B;  3V6I A;  5KJ7 C;  1M1K Q;  2JWD A;  2WSF J;  3L70 G;  1ZME C;  2IYO A;  1N73 B;  2C0W A;  3PTZ A;  3W68 A;  2GDW A;  3CC2 P;  1UNK A;  4H13 D;  4COC A;  1M1J C;  2GM4 A;  4DCK A;  3M0D A;  2JU2 A;  2QVA A;  1L0N E;  3CI9 A;  4K3A A;  2W6A A;  4L76 A;  5AVW B;  2M8N A;  5KKZ C;  2HPC B;  1NU1 G;  5GTH E;  1N86 A;  1RE4 C;  3L74 J;  3VMZ A;  1T3U A;  3G4S P;  1WRG A;  1AQT A;  3L75 G;  1DH3 A;  2ZT9 B;  2R3S A;  2N5I A;  1SQQ D;  2WQY C;  3D70 A;  5KLV J;  2W8Z A;  2PEK A;  3H1L G;  2BQ1 E;  3Q5P A;  2FYU G;  1MZ8 A;  2G3A A;  3SWK A;  3FWN A;  1T8K A;  4GR6 A;  4PD4 E;  2IZ0 A;  1FZA A;  3NY7 B;  1CEI A;  1KQL A;  2NPS D;  2KSJ A;  1NTK G;  3R4Y A;  3H1I J;  2PFX A;  1JY2 O;  1QGK B;  2Z5H A;  2PEI A;  2KI7 B;  1DEE G;  1KYO I;  4U0F A;  1ZP0 C;  3QWO C;  1M1J A;  2XND H;  3CCQ P;  1QEX A;  1AA0 A;  4RES B;  2FAC A;  3HD7 A;  1ACP A;  2GZF A;  3DTJ A;  2LIU A;  4N78 E;  2J58 A;  3GLM A;  1KQG B;  2ZXE B;  4M3L A;  2QJK B;  2XZ1 C;  4Y99 C;  4OGQ B;  1A43 A;  1ZNV A;  3RG6 C;  1RF0 A;  2W90 A;  3H6P A;  2SPZ A;  3EJE A;  1Q81 Q;  1PPJ G;  2G8Y A;  2L5G B;  1BE3 E;  1VQ7 P;  1GL2 B;  2CGQ A;  4BRY B;  1J1E B;  5HV8 A;  2KLU A;  3G3Z A;  2N1T B;  4PH1 A;  4ASV A;  1FDO A;  1S5L X;  1MUU A;  3L74 D;  2KP8 A;  1NHL A;  2A45 H;  5HGO A;  3DS4 A;  5B5E H;  2BCC G;  1GTW A;  1NTM G;  5F2N A;  1BGY D;  3TGU D;  2YKP A;  2MD9 A;  4EDF A;  2LKM A;  1FC2 C;  3V2N A;  1LT9 C;  3I56 P;  1GD2 E;  3V5B A;  1M6N A;  1LT9 A;  1FDM A;  2I1J A;  3JSV C;  3L74 G;  1L0L E;  1QVF O;  1EZV D;  3DS0 A;  2N9Y B;  3P7K A;  4PV1 B;  1QLE D;  2MVV A;  3RK3 E;  2E43 A;  1PGP A;  3DS5 A;  2N1T C;  1HTL C;  3RK2 D;  2WWW A;  2KS1 A;  1L2P A;  2FFD C;  1LTJ C;  2AXC A;  4RJT A;  1CSB A;  2K9J B;  3EWK A;  2KOP A;  1L4A C;  1SQB G;  2IBZ G;  2K88 A;  4H2X C;  2LXB A;  3PP5 A;  1GXG A;  1KB9 H;  1LP1 A;  1S1C X;  3KZI E;  1VQM P;  5APU A;  4IL6 E;  3RK2 B;  1NGM B;  3H1K G;  4LLH A;  1URQ C;  1LTS C;  3KQG A;  3HE4 B;  2JJL A;  5AVX B;  3BAT A;  2OTJ P;  2LPK A;  1J1D C;  1RE3 A;  2IFN A;  2NRG A;  3M9H A;  1L0N G;  2PEJ A;  3KDP B;  3VMX A;  3CC4 P;  3RBX A;  1EXJ A;  1N2D C;  2HPC A;  2XDJ A;  1H88 A;  3L71 G;  1N8R Q;  5AW8 B;  1QVG O;  3WUT A;  3KYQ A;  1A02 J;  1GL2 D;  1SFC C;  3H32 B;  2QJP C;  1VQ6 P;  2A06 D;  3L70 E;  1CI6 B;  1N73 A;  1NU1 J;  4ZNC A;  1EDJ A;  2CG5 B;  4OWF A;  4I1L A;  3SFD C;  1PV3 A;  3HUS B; 
#chains in the Genus database with same CATH homology
 3CCU P;  1QVF O;  3HYB A;  1YIT P;  4QNB A;  3CCM P;  3CXC O;  3DS0 A;  5F2K A;  5HGM A;  1M74 A;  2M8P A;  1EOQ A;  2XT1 A;  3G1G A;  3NTE A;  1YJN P;  2M8L A;  1VQK P;  1IUQ A;  1QRJ A;  1K73 Q;  5HGN A;  3CCS P;  3CME P;  1PEQ A;  2JYL A;  2EG5 A;  3CPW O;  3DS5 A;  3OW2 O;  2XXM A;  1YJ9 P;  1M90 Q;  1VQO P;  2PEI A;  3VRL C;  3WBH A;  3M1M A;  2PEQ A;  2EIA A;  1VQ5 P;  2EFJ A;  3MGE A;  2LF4 A;  1A8O A;  2OAR A;  3Q20 A;  4U0C A;  1YIJ P;  4U0D A;  4U0F A;  5DCK A;  3H4E A;  4XFY A;  5BS1 A;  2PEM A;  5BS2 A;  3P05 A;  1K8A Q;  2JO0 A;  3G71 P;  4XFX A;  3CCQ P;  3CCL P;  1VQP P;  3H47 A;  3DS1 A;  1NJI Q;  3CD6 P;  3I55 P;  1Q7Y Q;  3CC7 P;  1M1K Q;  1YI2 P;  3DTJ A;  3G0V A;  4XFZ A;  2JYG A;  2P9X A;  1YHQ P;  4PH0 A;  3CCJ P;  2Z44 A;  1VQN P;  1K9M Q;  2CWO A;  5I4T G;  2QEX P;  3G26 A;  3CC2 P;  3G21 A;  1VQM P;  4COC A;  1EIA A;  4U0E A;  1A43 A;  3RG6 C;  2ONT A;  1KQS O;  3CCE P;  2L6E A;  2Z45 A;  1VQL P;  1Q86 Q;  1K30 A;  1Q82 Q;  4U0B A;  3DPH A;  2OTJ P;  3G29 A;  1Q81 Q;  1RO2 A;  5F2O A;  2M8N A;  2PY8 A;  1VQ7 P;  1VQ4 P;  2PEJ A;  1PEO A;  3CCR P;  2QA4 P;  1PEU A;  3CC4 P;  4U0A A;  4IPY A;  2DGY A;  1ZMB A;  5JPA A;  3H0D A;  3CMA P;  2KOD A;  2Z46 A;  1D1D A;  4M0I A;  3G4S P;  1N8R Q;  3DS2 A;  3E2D A;  1VQ9 P;  3G1I A;  4PH1 A;  4WYM A;  1YJW P;  5HGL A;  2BHV A;  2PEN A;  3G28 A;  1JJ2 O;  3HZQ A;  1QVG O;  2E1M A;  4XRO A;  1VQ8 P;  1W2B O;  1M6E X;  2PEO A;  3CCV P;  1RNI A;  1BAJ A;  1E6J P;  5HGO A;  3DS4 A;  4XRQ A;  2PEK A;  2XV6 A;  1KC8 Q;  1AUM A;  5F2N A;  1VQ6 P;  1PEM A;  3B5I A;  2BQ1 E;  2BUO A;  1KD1 Q;  1S72 P;  4GR2 A;  3I56 P;  4COP A;  3DS3 A;  3LRY A;  1RO0 A;  1M6N A;  4GR6 A;  2OTL P;  3G6E P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...