1VQOP

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 47
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1vqoP03
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1vqoP01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1vqoP02
1VQKP 3CCJP 3CCVP 3CCQP 1NJIQ 3CCEP 1S72P 3I56P 1VQPP 1M90Q 3CC4P 3CD6P 1VQ5P 3CMAP 1JJ2O 3CCUP 1KC8Q 3CMEP 1YJ9P 1VQ8P 1VQ9P 1K73Q 1YJNP 1Q82Q 1YITP 1W2BO 3G4SP 1K9MQ 3CPWO 1KQSO 2QEXP 1QVFO 1VQ6P 1Q86Q 2OTJP 1VQNP 3OW2O 1VQOP 1YI2P 1VQLP 3G71P 3I55P 2QA4P 1YJWP 3CC7P 1YHQP 1N8RQ 3G6EP 1YIJP 1Q81Q 1VQMP 1K8AQ 3CC2P 1M1KQ 3CXCO 3CCMP 3CCLP 1QVGO 1VQ4P 2OTLP 1VQ7P 1Q7YQ 3CCRP 1KD1Q 3CCSP
chains in the Genus database with same CATH superfamily
3WUTA 2LXBA 1GL2A 5EW5E 1G2CB 1LTGC 5KAFE 4LC1A 2K0DX 1Z56A 1OW6A 2R5BA 1A43A 2KZJA 4UB6H 3L75D 3G0VA 2IZ0A 4WWIA 5CCHD 4U3FJ 2D2CD 5AVZB 2QJPC 3H1KD 1NU1G 3DPHA 3D70A 1LWUA 4U0FA 1VQ8P 1JB0J 3W67A 3WU2H 2Q3EA 2KP8A 2YKQA 3H1LE 3G26A 5K5GB 3DTJA 5BVZA 1X8YA 1SQPJ 1AQ5A 3H1KJ 4YPCA 3L72D 3B71A 2ZYAA 5CZDB 3UIAA 2A45G 4IFFA 2MY5A 2R32A 3N7NA 5GTIE 2JB0A 2A06G 2MKVA 3HTKA 2Y9ZA 2JGPA 1AFOA 2IX7C 1SQVD 2POHA 3A2AA 4OGQB 3L71G 1PPJD 2WWWA 3TK1A 1NTKG 2N6ZA 3VYIA 5HGLA 2KLUA 2XNDH 2MVUA 2EHTA 4AQRD 2GDWA 3I55P 1OR5A 1HH0A 2XZ1C 1KYOD 1N7SA 1FDMA 2ERHA 1SQXE 1JUNA 2JKVA 2K0YA 1KD1Q 1T6AA 3JC22 3TYYA 4OGQD 4Y99B 2N1TC 2Z5HA 1KZUB 2KS1A 4DG9A 1AF8A 1EDJA 2FYUD 4N78E 4H44B 3AEGC 3T97A 3Q5SA 2R3SA 5KAIE 2GZFA 5AW1B 3CX5I 1NWQA 2FAEA 1E0HA 1L4AC 1LT9A 2E42A 4R4MA 5CCGA 4XRQA 5TJHA 1IK9A 1QEXA 3JCUE 2P67A 2PEMA 3A0HE 3E1IA 1NU1K 1RNIA 3H4EA 1PIXA 1P84I 1M1JA 2WPVB 3B5NC 3USSA 2Z4EA 2KOOA 3MZWB 3L70G 2A06D 2HFED 2P2UA 1DIPA 1RE4C 3NXSA 4I2LC 2OYHC 1K05A 2CPBA 2K2QA 3G21A 2IPPA 3IN6A 1BCCJ 2PGDA 2E76C 1GDTA 5BS1A 5AVRB 4I1LA 3DS2A 2JAZA 2OTJP 1S9KD 2L91A 5AVVB 2FYNC 4BWNA 1BCCD 1JY3P 1N2DC 5AVQB 2KSJA 1W2EA 1HQBA 4U0EA 1IFJA 1NTZE 2KODA 1OFCX 3HUSA 4JQ0D 2M8PA 1EZVG 1ZOYC 3H1IG 2QA4P 3H1IE 3G6EP 1CZQA 4EIJA 1RF0C 1FDOA 2W6AA 3MGNA 2QM7A 2RH0A 1RE4A 3WUVA 3PP5A 3MHVA 2KS1B 2ZT9D 5B5EH 3L74J 3H32A 2BCCG 5BU5A 1JY3N 1AUMA 3TDKA 3VMZA 5KLIC 2IDBA 4COPA 5GTHH 5APQA 2KK7A 1BXIA 2OYIB 1QLED 2XU6A 5BS2A 4I6MC 1JCDA 1FJPA 1SQVE 5KLVE 1SQXG 2P7JA 4QMAA 1ZRTE 1KB9I 1MV8A 4R0MA 1Q86Q 5KTBA 2FYUG 1W5CE 2X2BA 5I4TG 1EIAA 2PP6A 5C39A 3DS5A 2L5GB 1UJZA 5H2FH 1Q7YQ 1JTHB 3SFEC 2CGQA 1VQKP 2Y9YA 4GDOA 1OVRA 1XTCC 3CC4P 1KYOE 2YNYA 3L71D 1DV5A 2ZXXA 3GHGA 2N6YA 2LPKA 2JR8A 1RF1C 4PH0A 1NTMD 4W80A 3DS0A 4MN4C 2WSCJ 2Q5UA 1JMBA 2FXOA 1HWTC 1OMIA 3M0DA 2OYIC 2HODA 3AECC 2JO0A 3RL0C 1SS1A 2OYHA 1DH3A 5KLIB 3NMDA 2K94A 3QH9A 1LWUB 1MZ8A 1VQLP 1H89A 3LMOA 4C7NA 1HUCA 1VL2A 2FFDC 4IL6H 2XT1A 1GPJA 3KDPB 2GZIA 3RL0g 3VOPA 3EFFK 3AE3C 1NU1D 2PRRA 3IFMA 1IC2A 3H1HE 1PV3A 4AUWA 3NFQA 2FQ1A 4XROA 3D6ZA 1JCCA 2V7QH 5AW6B 1NGMB 2WSSH 1FZFA 3JSVC 1RQVA 1BGYJ 5CCGD 2KGCA 2A45H 2E74C 3EWKA 5APTA 2LIWA 1URQC 2L6EA 1JY3O 1LWUC 3CCJP 1NJIQ 4ZKUA 2E75D 5AVWB 3L35A 1J1DC 3C1LA 3RL0B 3P7KA 2FYNB 3DS3A 3M0DC 2J5UA 5APUA 1M8OB 3OW2O 5CCGC 3VMXA 2JU2A 5KAFH 3CWBJ 1KORA 2PY8A 1QVGO 3CE7A 5AVYB 2M8LA 4GKGA 2MF4A 3EJDA 1U7MA 2BCCD 3V2PA 2Z5IA 3RGUA 2R44A 4D6TJ 2E75B 3RL0D 2FVFA 2B89A 2VLPA 1NTZD 2XZ0D 5HGMA 1T8ZA 2LTEA 3PHLA 1LTBC 2N50A 1U7JA 5CJ0A 1KILA 2QVAA 2LIUA 3IF4A 4N3YB 2K9JB 1NTMG 3K5BA 3V6IA 2N1TD 1GK4A 1U57A 2Y0DA 1M74A 2MR7A 2WQYC 1DNYA 2FFDB 2KB7P 3B8EB 1BCCG 3L74E 2KNCA 1E5WA 1L4AB 3PRJA 4U7JA 2KOGA 3Q20A 1LTSC 1VQPP 1G1JA 3CD6P 2K93A 4Z1MH 3VRLC 1YITP 2QJYC 2M3EA 4IZ6A 5KLVK 1Q90D 5GTIH 5KLVD 2N1TB 1WMKA 1GXHA 2LXCB 1HY8A 4ASVA 2PEIA 1R5SA 3E7KA 2GYKA 4GT1A 2GM4A 3L75E 2Q7CA 5DCKA 2WPRA 1SQBE 1LNQA 4WVZA 3RK2B 1VQ5P 1IJDB 1SQQG 4QNBA 1L2PA 1Q82Q 3H1KE 1KQSO 1SP4A 2JYLA 3CXHI 2VLNA 3G1GA 2BHVA 3AEBC 3GG2A 1BE3D 2HPCB 2FXMA 2XXMA 1T2KD 3F89A 3MUDC 1EMVA 1PEMA 1JY2N 2GDYA 3P8MC 2IBZE 3HE4B 1GU4A 1E79H 4HH2A 1R8EA 3CPWO 3M1MA 3N4XA 4U0CA 2E5YA 2R5DA 3G28A 4OH8B 2L4BA 1JEKA 3OJAB 2QSIA 3L73J 2DW3A 4U0BA 1SQBJ 4RKUJ 1L0NK 4CA3A 3OAKA 1LTJA 4KJMA 3CWBD 4RO0A 2HYNA 1PPJE 3VTPC 1VKUA 3FWLA 5AW4B 1FR2A 1N73B 1NU1E 1PGJA 1YIJP 3AE5C 2E75C 4XFZA 2Z46A 4WY4C 3M9HA 3TGUE 3EQ2A 1S72P 4H2YC 1JOCA 4NPDA 3DS1A 1LT9C 1CW5A 3DS4A 1RO0A 3CXHD 4DOJA 1VQOP 1GTWA 4WB4A 4U0DA 4HJGH 2H43A 4N78D 1P84E 5AVSB 1PGQA 3AE2C 2N1TA 2G3AA 2VLQA 1T3UA 2M3BA 3RBXA 5CMZA 2KWLA 1EDLA 3GZLA 2ZT9B 1Y8AA 1DEBA 5APXA 2IFMA 3G71P 1OW8A 1AJYA 1DX7A 1WT6A 1N8RQ 4ZNCA 1WRGA 1CI6B 1ZV8A 3A0HH 3CXHH 2FQ2A 3HRNA 4EOTA 5B66E 1H8AA 1EOQA 2ZFCA 1L0LJ 3GLMA 1NTZG 2B9BA 5CJ4A 1RE3C 3HYBA 1ZMBA 3C9IA 2A06E 1R5LA 5GTHE 4ZMDA 1X0TA 1VPCA 2WT7A 3HD7C 4ZKPA 2IZ1A 1SQQD 2KGAA 1PZQA 4C7RA 2BUOA 4XFYA 4QKOA 2FYUK 4RESB 5KLVJ 1YJNP 4TLFA 3D71A 3AEFC 2QE7H 1PPJG 4WY4D 2LKMA 2ZXEB 5APWA 1MZ9A 4H0LB 1SLQA 3BCCG 3P32A 4Y99C 5KLVG 2Z45A 2AEJA 2KGDA 4WBAA 3B5NB 5HV8A 3CC2P 2KG8A 1T2KC 3QWOC 1SQXJ 1NKZB 3NTEA 1VF5B 3CWBG 5KKZC 1FBMA 3CMEP 2FBWC 2I8DA 1L0LE 2L22A 5CBNA 2O01H 1A8OA 4OGQC 1QL1A 2FXPA 2ROQA 4NPFX 2IBZD 1FZCA 3G9RA 1FZGA 3H1LG 3A3YB 3L70J 3L72J 5KP6B 2JDIH 2QG4A 3S1KA 4C7NB 4TT3H 1KN7A 1MFZA 4H44C 2LL8A 5KKZB 2KG9A 2KOPA 2B87A 2QEXP 1YI2P 1HTLC 1X9VA 3CWBE 1E6JP 3JCUH 4NPEA 3VMAA 1HJ0A 2OTLP 2YXQB 1LP1A 3U59A 1QRJA 1H0TA 1VDFA 1FAVA 4LLHA 2JEEA 2E43A 2WSFH 1BGYD 1FJKA 1M56D 3TGUD 1N73C 2XV5A 1KFNA 3L71E 2DNWA 4PD4D 4NEOA 1NTME 1KQLA 2I1KA 1HGZA 3CXHE 2FFDA 1M7LA 4L74A 4IL6X 3L72G 3BCCD 4GOEA 2AXCA 5KJ7A 5DJTB 2N9BA 4XFXA 4DT0A 1EZVI 4BPHA 3MUDA 2Y0EA 2Q1KA 4PWVB 1KB9D 2H88C 1JY2O 5BU8B 1L0ND 1NTMK 2CQ8A 1AVOA 1SQVG 2KLVA 5APVA 1LTAC 3OA7A 3PLNA 4OWFA 1L4AD 4UHPB 4KT0J 2N5IA 3FXDA 2KOQA 2WMMA 2P1JA 1N86A 4L75A 5AVUB 3BVHA 3H1HD 1Q81Q 4I7ZB 2IBZG 3CXCO 1L0NG 3GZMA 1AYIA 2EG5A 1VHNA 2J59M 1IFNA 1N73A 2NPSD 3P8CE 5CBOA 1RH5B 1JMMA 2FVEA 2N9YB 3RK2D 5CCHA 1SQQE 2H8PD 3B4QA 2WSCH 2ONTA 2BASA 1ZW0A 1BAJA 2IYPA 3H25A 4GR2A 5APSA 2O1KA 1KILE 1NYHA 3U1CA 2GZGA 3BRVB 1ZN5A 3AEAC 2E74B 3HE4A 2NPSB 4DZOA 1ZR4A 2AEFA 2O01N 2YO2A 2A45I 1VF5C 2V7QJ 3AEEC 1L0LG 3H1JJ 2OARA 3CX5E 3L74G 1RY3A 1CSBA 1DD3A 3CCUP 2MD9A 3FX0A 3KYQA 4JF7A 3PH0A 3FGAD 5APYA 1F80D 3GF3A 1PP9D 2E74D 3Q5RA 1FE6A 2OTKE 2MVVA 2EHSA 2NZ2A 1OVUA 2K5XA 1J1EC 2AF8A 1M1JC 4K3AA 3L73E 3L37A 3L74D 1S5LH 1NTZK 2FHSC 1T3JA 1GMJA 4M3LA 2GZEA 4XFJA 1L0HA 3G4SP 5AW3B 2Z44A 5AW9B 1SQXK 2M8RA 3WBHA 1GL2C 1LT9B 1FZCC 4UB8E 1EXJA 1FZEA 3KZIH 3VMYA 1QL2A 3T97B 1NH4A 1UNKA 4H2XC 1YTZT 4N6JA 3RK2C 1SQBD 3GMAA 2K9JA 2BEZF 1FOSF 1BGYG 1M57D 2C9LY 3B4SA 1LTIC 1BGYE 2CNRA 1KFMA 2XKMA 2JU1A 3IAOA 2NRGA 3V4WA 2B88A 3CCSP 1KILB 3H1JE 1Y9BA 3FXEA 1UIIA 1BE3E 3HUSC 4PD4E 1URQD 4PJ0E 4DJGA 3AEDC 1IO4A 4OVNF 3A0BH 3SFDC 2KNCB 3RK3D 1PGPA 5JPAA 3BCCE 3R4YA 5M1BA 3V5BA 1OIPA 2G8YA 2WVRA 2V4HA 2ZVNB 1JNMA 4GIFA 1NU1J 1HVVA 2C9NY 1L0NE 3L73G 5KP8B 2N98A 2OGUA 3B5IA 5DJUB 3RG2A 2K0XA 4WY4B 3EFGA 4H0LD 3L4FA 3WUUA 2AXTE 4MRTC 1PL5A 4EYYQ 2R3CA 2WPQA 3HE5A 1X79B 1FZCB 4A7PA 3P8CD 3O6QB 5AVTB 2JJLA 1JO5A 1NAYA 3B5ND 2P10A 2BEQD 2IBZI 1SFCA 1P84D 2ZYDA 1FS0E 1KC8Q 4KHXA 1VF5D 1J1DB 2YMYA 2PFXA 2OYHB 1MUUA 2JYGA 2D2CC 5HGNA 3Q3DA 3CCQP 2KXPB 1IFMA 1GU5A 3L75J 1KILC 2M5AA 2QM8A 3CX5D 2KR5A 3TNUA 1L0NJ 4D6TD 1EXIA 1HF9A 1QX8A 1L0IA 3GJNA 1N7LA 1OXZA 1S3JA 1NTZJ 2EFJA 1M1KQ 2FACA 2FY8A 4PD4I 2W83C 3CCEP 2K37A 2FYZA 2GDXA 1JTHA 2XNXA 4K35A 1MKMA 2O3JA 3P05A 1GW4A 3L73D 4O9BA 4H0LC 2Q3IA 3AE9C 2QJYB 2Y0CA 3II6A 2PENA 1FZBA 1FZAA 1IZNB 1EC5A 2IFNA 3LW5J 2RKLA 1RHZB 4JYCA 4DCKA 2CPSA 1IMPA 1J2JB 1NHLA 1RQUA 3SWFA 1S2EA 2QIWA 5B5EE 2QJKC 2QRXA 3BASA 1VQMP 1K30A 1CI6A 1SQPD 2WZ7A 2LOLA 2ZYGA 1S4XA 4ASWA 2E1MA 4BRYB 4RJTA 1PFIA 3TNUB 2HG5D 1KLPA 3LW5H 5EFWB 2OYIA 3AE6C 1NKNA 3GKLC 3H1JD 1L0LD 3V2RA 1L0LK 1SQBG 3FWNA 1YYCA 3H6PA 2NPSC 1LP1B 3H32B 2JWDA 3RK3E 3AE8C 3EJBA 4YXWH 3KPEA 1CEIA 1HGVA 5E79E 2DGYA 2FADA 1OZHA 2OYOA 1M6EX 3LIDA 4PXHB 1Q2NA 1VQ6P 2H89C 3H1LJ 1IFDA 1KYOH 2KG6A 3HD7A 1YJWP 2FVAA 4JYBA 2YKPA 1ZMEC 1YQ4C 2K88A 3H1HJ 2ZVOB 5H2FE 2GUSA 2KW2A 1BE3G 1G1IA 1RF0A 5HGOA 2KOSA 1KMIZ 3L71J 1IK7A 7CEIA 3H1KG 1SQPK 1PP9J 4JBZA 1USDA 2KSEA 2PEJA 2HR3A 3VP9A 1BDDA 1Y47A 1FOSE 2PEKA 3GF7A 2E76D 3ZDMA 3I56P 3ITKA 1SFCB 3RK3C 3IR9A 1VQ9P 2JWAA 2HPCA 5F2OA 4GOFA 2YIUC 5TISH 1URQA 3CC7P 3WMM0 3PTZA 4COCA 4L73A 5F2NA 3TGUJ 2E5TA 4W7YA 1D7MA 1KB9E 2ITAA 2XZRA 3TF5A 3H0DA 3A0BE 5F2KA 2W6BA 2LR2A 2MR8A 1OWAA 1FU1A 3H1JG 2H7HA 3R2PA 1NOHA 3PJSK 4IL6E 3A7OA 3KZIE 4B86A 4PV1B 1ACPA 2QJPB 1H88A 1N7SD 4GR6A 1SQVK 2AFDA 1AV1A 1KV4A 5E79H 1BSNA 3SSUA 3L72E 1PP9G 1S5LE 4WYMA 4U0AA 1EDKA 2RMZA 1ZNVA 1PEOA 5L8RJ 1DD4A 1J1EB 2LF4A 1BE3J 2MJZA 3RBZA 1JJ2O 3CLQA 3S4RA 2JO1A 3BRTB 1KILD 2CWOA 5AW7B 1URQB 4IFMA 1IFPA 2LKIA 1H0TB 2WSEJ 1NTKJ 1SFCC 2JP3A 3RK3B 2KGEA 1OW7A 1A02J 3NY7B 2JQ4A 2FQ0A 3Q5PA 3EJEA 1YBKA 2B87B 2Q6QA 3MD0A 1KQFB 2PAJA 1NTMJ 3Q2YA 4PH1A 2O1JA 5AW5B 1SQXD 3H1IJ 1IUQA 4Y28J 1D1DA 4XE5B 1PP9E 2WITA 3I5CA 5KAIH 3V2QA 2PEOA 1IFIA 3CX5H 3F5HA 4UB6E 2WSEH 2EIAA 3G3ZA 1EZVE 4D6TG 2FYUE 1KYOI 3HZQA 1SQBK 1K9MQ 1QVFO 3G29A 1GL2B 4PJ0H 1LTJB 1N7SC 2NPSA 1NAFA 1K8AQ 3L36A 1VQ4P 1RF1B 2M8NA 5TISE 3V2NA 3L70D 5B66H 3H47A 4I7ZC 5CCHC 1ZP0C 1AVYA 1SQQJ 2CK3H 4PD4H 5AVXB 3GW6A 1SQVJ 1GD2E 1GL2D 1IMQA 5EJDA 3GHGC 1G2CA 1PEQA 4BRYA 1S1CX 1EQ7A 2KIKA 1X3OA 1A02F 3NTNA 1USEA 5AW2B 3E2DA 3MGEA 2WPTA 3LIEA 2NO8A 3C8VA 1ZXGA 2PNGA 5KJ7D 3O8ZA 1SVFA 2W27A 2ZJSE 5AW8B 1PEUA 3CCMP 2IYOA 3MTUE 4EDFA 2KYVA 1HJBA 3CMAP 3A5TA 1S9KE 3M91A 2JBGA 2AXTH 4H2WC 3WU2E 1BCCE 3M9BA 5CHXA 2K3RA 1L4AA 5HVCA 4H13B 1M6NA 1OVVA 3H1HG 4YXDC 2I1JA 4U3FD 3W68A 1NTKD 4H13C 4U3FG 1FDIA 3CI9A 4H44D 1KTMA 3H1ID 2GUVA 3MIWA 3M9QA 2GZJA 1K04A 3TSIA 1DEEG 1X22A 1RO2A 3M0AA 1S5LX 4HKZH 4H13D 2K1AA 2AFEA 1NTKK 1NQ4A 2YXRB 1GW3A 1AA0A 3AE1C 2YKOA 2XDJA 4HYTB 2FYUJ 3CCRP 2P58A 4CPGA 1ZRTD 2K92A 2L0QA 5AW0B 4AYCA 3U43A 3O6QA 3HUSB 4W7ZA 2Q9IA 2M5AB 3M06A 2VLOA 3L75G 2KZIA 3BATA 1EDIA 2WTYA 3Q1MA 3HE5B 3KQGA 2KUBA 2GA1A 1GZLA 1RF1A 2BQ1E 3VP8A 4D6TE 3HD7D 3H1LD 2C0WA 1KQGB 1BDCA 3BCCJ 2M0BA 1MFTA 1PGOA 2O01J 2UWJE 1LTJC 1VQNP 3VN0A 2AEMA 2LMLA 4IFDK 2RN0A 1EZVD 4M0IA 2BCCJ 3S9OA 2VSQA 1GXGA 1LGHB 3AE4C 3D6YA 2XV6A 1Z6MA 2SPZA 4IPYA 3HD7B 4WY4A 2E76B 1K73Q 2FKWB 1UIXA 1SFCD 3L70E 3MP7B 3B5NA 1M1JB 2HODB 1TU3F 3CCLP 2N5HA 4GODA 2YMKA 4EI2A 2W6JH 1ZR2A 2VRSA 1KB9H 1SQPE 1M90Q 2QNWA 1YJ9P 4L76A 3GHGB 2WSFJ 3KXDA 5KJ7C 1OX3A 2QJKB 4HKGA 5KP7B 4JPZB 1LT1A 4R4LA 1T8KA 1P84H 1SQQK 3CCVP 3RG6C 1LJ2A 4PV1D 1LTTC 2C0XA 4HB1A 2HLOA 4LGDE 1BSHA 3U1AA 1N7SB 2WT7B 4BPFA 3CL3D 3SWYA 1YHQP 2P9XA 3KHUA 2BCCE 1JY2P 1FC2C 4C46A 3AE7C 3LRYA 2J58A 4PV1C 2W8ZA 3V4QA 4IOIH 1YQ3C 2AVAA 3SWKA 4U3FE 4BXLA 3TGUG 1NTKE 2PEQA 1RE3A 1AQTA 3HTKB 2OQQA 1GK6A 1NVOA 1HBWA 1ZLLA 2L9FA 2YO3A 2K9YA 4XA4A 4YTPC 4BPGA 2CG5B 1NO4A 1XTGB 1W2BO 2YIUB 2W90A 1SQPG 2ZT9C 3ABVC 1JM0A 3E1RA 2D2CB 1QGKB 2ZAEB 4F37A 4UB8H 3G1IA 2KORA 1YTZI 2WPSA 1VQ7P 2KI7B 2M5RA
chains in the Genus database with same CATH topology
1QRJA 3H47A 4U0EA 2BUOA 2JO0A 1M90Q 4XFYA 2DGYA 1YJ9P 2KODA 4GR6A 1YJNP 1M6EX 2M8PA 1VQ6P 1M74A 1VQLP 5JPAA 2QA4P 1YJWP 1A43A 3G6EP 1YIJP 3G0VA 2EFJA 1M1KQ 4WYMA 2XT1A 4U0AA 4XFZA 2Z46A 1PEQA 3CCRP 1PEOA 2OARA 3CCVP 3CCEP 5HGOA 2LF4A 1S72P 3Q20A 3RG6C 1VQPP 3CD6P 3DPHA 4XRQA 3DS1A 1JJ2O 3CCUP 3E2DA 3MGEA 4U0FA 1VQ8P 3VRLC 2CWOA 3P05A 1YITP 4XFXA 3DS4A 2Z45A 1AUMA 1RO0A 2PEJA 3G26A 4XROA 1VQOP 2PENA 3DTJA 1YHQP 4U0DA 2PEMA 2P9XA 3CC2P 1PEUA 2BQ1E 2PEIA 3CCMP 3B5IA 4COPA 1RNIA 3H4EA 2PEKA 2L6EA 3NTEA 3CCJP 5DCKA 1NJIQ 3LRYA 3I56P 5BS2A 1VQ5P 3CMAP 3CMEP 1VQ9P 4QNBA 4U0BA 3DS3A 1Q82Q 3G4SP 1KQSO 2Z44A 5F2OA 1Q86Q 1A8OA 4PH1A 3OW2O 1VQNP 2JYLA 3WBHA 3G71P 5I4TG 3CC7P 1EIAA 2PEQA 1IUQA 1N8RQ 4COCA 3DS5A 1Q81Q 4M0IA 1K30A 1VQMP 1D1DA 2PY8A 3CXCO 1QVGO 3G1GA 3G21A 2BHVA 1M6NA 5F2NA 1Q7YQ 2XXMA 2EG5A 2PEOA 1VQKP 2XV6A 2M8LA 2E1MA 4IPYA 1PEMA 2EIAA 3CC4P 5HGLA 5BS1A 1EOQA 1KC8Q 3H0DA 1K73Q 1W2BO 3HZQA 3DS2A 5F2KA 1K9MQ 3G29A 3CPWO 2QEXP 1QVFO 2OTJP 3M1MA 3HYBA 1ZMBA 1YI2P 4PH0A 2JYGA 4U0CA 3I55P 5HGNA 1E6JP 3G28A 3DS0A 2ONTA 1K8AQ 1RO2A 3G1IA 5HGMA 3CCLP 2OTLP 1VQ4P 1BAJA 2M8NA 1VQ7P 4GR2A 3CCQP 1KD1Q 3CCSP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK P;  3CCJ P;  3CCV P;  3CCQ P;  1NJI Q;  3CCE P;  1S72 P;  3I56 P;  1VQP P;  1M90 Q;  3CC4 P;  3CD6 P;  1VQ5 P;  3CMA P;  1JJ2 O;  3CCU P;  1KC8 Q;  3CME P;  1YJ9 P;  1VQ8 P;  1VQ9 P;  1K73 Q;  1YJN P;  1Q82 Q;  1YIT P;  1W2B O;  3G4S P;  1K9M Q;  3CPW O;  1KQS O;  2QEX P;  1QVF O;  1VQ6 P;  1Q86 Q;  2OTJ P;  1VQN P;  3OW2 O;  1VQO P;  1YI2 P;  1VQL P;  3G71 P;  3I55 P;  2QA4 P;  1YJW P;  3CC7 P;  1YHQ P;  1N8R Q;  3G6E P;  1YIJ P;  1Q81 Q;  1VQM P;  1K8A Q;  3CC2 P;  1M1K Q;  3CXC O;  3CCM P;  3CCL P;  1QVG O;  1VQ4 P;  2OTL P;  1VQ7 P;  1Q7Y Q;  3CCR P;  1KD1 Q;  3CCS P; 
#chains in the Genus database with same CATH topology
 3WUT A;  2LXB A;  1GL2 A;  5EW5 E;  1G2C B;  1LTG C;  5KAF E;  4LC1 A;  2K0D X;  1Z56 A;  1OW6 A;  2R5B A;  1A43 A;  2KZJ A;  4UB6 H;  3L75 D;  3G0V A;  2IZ0 A;  4WWI A;  5CCH D;  4U3F J;  2D2C D;  5AVZ B;  2QJP C;  3H1K D;  1NU1 G;  3DPH A;  3D70 A;  1LWU A;  4U0F A;  1VQ8 P;  1JB0 J;  3W67 A;  3WU2 H;  2Q3E A;  2KP8 A;  2YKQ A;  3H1L E;  3G26 A;  5K5G B;  3DTJ A;  5BVZ A;  1X8Y A;  1SQP J;  1AQ5 A;  3H1K J;  4YPC A;  3L72 D;  3B71 A;  2ZYA A;  5CZD B;  3UIA A;  2A45 G;  4IFF A;  2MY5 A;  2R32 A;  3N7N A;  5GTI E;  2JB0 A;  2A06 G;  2MKV A;  3HTK A;  2Y9Z A;  2JGP A;  1AFO A;  2IX7 C;  1SQV D;  2POH A;  3A2A A;  4OGQ B;  3L71 G;  1PPJ D;  2WWW A;  3TK1 A;  1NTK G;  2N6Z A;  3VYI A;  5HGL A;  2KLU A;  2XND H;  2MVU A;  2EHT A;  4AQR D;  2GDW A;  3I55 P;  1OR5 A;  1HH0 A;  2XZ1 C;  1KYO D;  1N7S A;  1FDM A;  2ERH A;  1SQX E;  1JUN A;  2JKV A;  2K0Y A;  1KD1 Q;  1T6A A;  3JC2 2;  3TYY A;  4OGQ D;  4Y99 B;  2N1T C;  2Z5H A;  1KZU B;  2KS1 A;  4DG9 A;  1AF8 A;  1EDJ A;  2FYU D;  4N78 E;  4H44 B;  3AEG C;  3T97 A;  3Q5S A;  2R3S A;  5KAI E;  2GZF A;  5AW1 B;  3CX5 I;  1NWQ A;  2FAE A;  1E0H A;  1L4A C;  1LT9 A;  2E42 A;  4R4M A;  5CCG A;  4XRQ A;  5TJH A;  1IK9 A;  1QEX A;  3JCU E;  2P67 A;  2PEM A;  3A0H E;  3E1I A;  1NU1 K;  1RNI A;  3H4E A;  1PIX A;  1P84 I;  1M1J A;  2WPV B;  3B5N C;  3USS A;  2Z4E A;  2KOO A;  3MZW B;  3L70 G;  2A06 D;  2HFE D;  2P2U A;  1DIP A;  1RE4 C;  3NXS A;  4I2L C;  2OYH C;  1K05 A;  2CPB A;  2K2Q A;  3G21 A;  2IPP A;  3IN6 A;  1BCC J;  2PGD A;  2E76 C;  1GDT A;  5BS1 A;  5AVR B;  4I1L A;  3DS2 A;  2JAZ A;  2OTJ P;  1S9K D;  2L91 A;  5AVV B;  2FYN C;  4BWN A;  1BCC D;  1JY3 P;  1N2D C;  5AVQ B;  2KSJ A;  1W2E A;  1HQB A;  4U0E A;  1IFJ A;  1NTZ E;  2KOD A;  1OFC X;  3HUS A;  4JQ0 D;  2M8P A;  1EZV G;  1ZOY C;  3H1I G;  2QA4 P;  3H1I E;  3G6E P;  1CZQ A;  4EIJ A;  1RF0 C;  1FDO A;  2W6A A;  3MGN A;  2QM7 A;  2RH0 A;  1RE4 A;  3WUV A;  3PP5 A;  3MHV A;  2KS1 B;  2ZT9 D;  5B5E H;  3L74 J;  3H32 A;  2BCC G;  5BU5 A;  1JY3 N;  1AUM A;  3TDK A;  3VMZ A;  5KLI C;  2IDB A;  4COP A;  5GTH H;  5APQ A;  2KK7 A;  1BXI A;  2OYI B;  1QLE D;  2XU6 A;  5BS2 A;  4I6M C;  1JCD A;  1FJP A;  1SQV E;  5KLV E;  1SQX G;  2P7J A;  4QMA A;  1ZRT E;  1KB9 I;  1MV8 A;  4R0M A;  1Q86 Q;  5KTB A;  2FYU G;  1W5C E;  2X2B A;  5I4T G;  1EIA A;  2PP6 A;  5C39 A;  3DS5 A;  2L5G B;  1UJZ A;  5H2F H;  1Q7Y Q;  1JTH B;  3SFE C;  2CGQ A;  1VQK P;  2Y9Y A;  4GDO A;  1OVR A;  1XTC C;  3CC4 P;  1KYO E;  2YNY A;  3L71 D;  1DV5 A;  2ZXX A;  3GHG A;  2N6Y A;  2LPK A;  2JR8 A;  1RF1 C;  4PH0 A;  1NTM D;  4W80 A;  3DS0 A;  4MN4 C;  2WSC J;  2Q5U A;  1JMB A;  2FXO A;  1HWT C;  1OMI A;  3M0D A;  2OYI C;  2HOD A;  3AEC C;  2JO0 A;  3RL0 C;  1SS1 A;  2OYH A;  1DH3 A;  5KLI B;  3NMD A;  2K94 A;  3QH9 A;  1LWU B;  1MZ8 A;  1VQL P;  1H89 A;  3LMO A;  4C7N A;  1HUC A;  1VL2 A;  2FFD C;  4IL6 H;  2XT1 A;  1GPJ A;  3KDP B;  2GZI A;  3RL0 g;  3VOP A;  3EFF K;  3AE3 C;  1NU1 D;  2PRR A;  3IFM A;  1IC2 A;  3H1H E;  1PV3 A;  4AUW A;  3NFQ A;  2FQ1 A;  4XRO A;  3D6Z A;  1JCC A;  2V7Q H;  5AW6 B;  1NGM B;  2WSS H;  1FZF A;  3JSV C;  1RQV A;  1BGY J;  5CCG D;  2KGC A;  2A45 H;  2E74 C;  3EWK A;  5APT A;  2LIW A;  1URQ C;  2L6E A;  1JY3 O;  1LWU C;  3CCJ P;  1NJI Q;  4ZKU A;  2E75 D;  5AVW B;  3L35 A;  1J1D C;  3C1L A;  3RL0 B;  3P7K A;  2FYN B;  3DS3 A;  3M0D C;  2J5U A;  5APU A;  1M8O B;  3OW2 O;  5CCG C;  3VMX A;  2JU2 A;  5KAF H;  3CWB J;  1KOR A;  2PY8 A;  1QVG O;  3CE7 A;  5AVY B;  2M8L A;  4GKG A;  2MF4 A;  3EJD A;  1U7M A;  2BCC D;  3V2P A;  2Z5I A;  3RGU A;  2R44 A;  4D6T J;  2E75 B;  3RL0 D;  2FVF A;  2B89 A;  2VLP A;  1NTZ D;  2XZ0 D;  5HGM A;  1T8Z A;  2LTE A;  3PHL A;  1LTB C;  2N50 A;  1U7J A;  5CJ0 A;  1KIL A;  2QVA A;  2LIU A;  3IF4 A;  4N3Y B;  2K9J B;  1NTM G;  3K5B A;  3V6I A;  2N1T D;  1GK4 A;  1U57 A;  2Y0D A;  1M74 A;  2MR7 A;  2WQY C;  1DNY A;  2FFD B;  2KB7 P;  3B8E B;  1BCC G;  3L74 E;  2KNC A;  1E5W A;  1L4A B;  3PRJ A;  4U7J A;  2KOG A;  3Q20 A;  1LTS C;  1VQP P;  1G1J A;  3CD6 P;  2K93 A;  4Z1M H;  3VRL C;  1YIT P;  2QJY C;  2M3E A;  4IZ6 A;  5KLV K;  1Q90 D;  5GTI H;  5KLV D;  2N1T B;  1WMK A;  1GXH A;  2LXC B;  1HY8 A;  4ASV A;  2PEI A;  1R5S A;  3E7K A;  2GYK A;  4GT1 A;  2GM4 A;  3L75 E;  2Q7C A;  5DCK A;  2WPR A;  1SQB E;  1LNQ A;  4WVZ A;  3RK2 B;  1VQ5 P;  1IJD B;  1SQQ G;  4QNB A;  1L2P A;  1Q82 Q;  3H1K E;  1KQS O;  1SP4 A;  2JYL A;  3CXH I;  2VLN A;  3G1G A;  2BHV A;  3AEB C;  3GG2 A;  1BE3 D;  2HPC B;  2FXM A;  2XXM A;  1T2K D;  3F89 A;  3MUD C;  1EMV A;  1PEM A;  1JY2 N;  2GDY A;  3P8M C;  2IBZ E;  3HE4 B;  1GU4 A;  1E79 H;  4HH2 A;  1R8E A;  3CPW O;  3M1M A;  3N4X A;  4U0C A;  2E5Y A;  2R5D A;  3G28 A;  4OH8 B;  2L4B A;  1JEK A;  3OJA B;  2QSI A;  3L73 J;  2DW3 A;  4U0B A;  1SQB J;  4RKU J;  1L0N K;  4CA3 A;  3OAK A;  1LTJ A;  4KJM A;  3CWB D;  4RO0 A;  2HYN A;  1PPJ E;  3VTP C;  1VKU A;  3FWL A;  5AW4 B;  1FR2 A;  1N73 B;  1NU1 E;  1PGJ A;  1YIJ P;  3AE5 C;  2E75 C;  4XFZ A;  2Z46 A;  4WY4 C;  3M9H A;  3TGU E;  3EQ2 A;  1S72 P;  4H2Y C;  1JOC A;  4NPD A;  3DS1 A;  1LT9 C;  1CW5 A;  3DS4 A;  1RO0 A;  3CXH D;  4DOJ A;  1VQO P;  1GTW A;  4WB4 A;  4U0D A;  4HJG H;  2H43 A;  4N78 D;  1P84 E;  5AVS B;  1PGQ A;  3AE2 C;  2N1T A;  2G3A A;  2VLQ A;  1T3U A;  2M3B A;  3RBX A;  5CMZ A;  2KWL A;  1EDL A;  3GZL A;  2ZT9 B;  1Y8A A;  1DEB A;  5APX A;  2IFM A;  3G71 P;  1OW8 A;  1AJY A;  1DX7 A;  1WT6 A;  1N8R Q;  4ZNC A;  1WRG A;  1CI6 B;  1ZV8 A;  3A0H H;  3CXH H;  2FQ2 A;  3HRN A;  4EOT A;  5B66 E;  1H8A A;  1EOQ A;  2ZFC A;  1L0L J;  3GLM A;  1NTZ G;  2B9B A;  5CJ4 A;  1RE3 C;  3HYB A;  1ZMB A;  3C9I A;  2A06 E;  1R5L A;  5GTH E;  4ZMD A;  1X0T A;  1VPC A;  2WT7 A;  3HD7 C;  4ZKP A;  2IZ1 A;  1SQQ D;  2KGA A;  1PZQ A;  4C7R A;  2BUO A;  4XFY A;  4QKO A;  2FYU K;  4RES B;  5KLV J;  1YJN P;  4TLF A;  3D71 A;  3AEF C;  2QE7 H;  1PPJ G;  4WY4 D;  2LKM A;  2ZXE B;  5APW A;  1MZ9 A;  4H0L B;  1SLQ A;  3BCC G;  3P32 A;  4Y99 C;  5KLV G;  2Z45 A;  2AEJ A;  2KGD A;  4WBA A;  3B5N B;  5HV8 A;  3CC2 P;  2KG8 A;  1T2K C;  3QWO C;  1SQX J;  1NKZ B;  3NTE A;  1VF5 B;  3CWB G;  5KKZ C;  1FBM A;  3CME P;  2FBW C;  2I8D A;  1L0L E;  2L22 A;  5CBN A;  2O01 H;  1A8O A;  4OGQ C;  1QL1 A;  2FXP A;  2ROQ A;  4NPF X;  2IBZ D;  1FZC A;  3G9R A;  1FZG A;  3H1L G;  3A3Y B;  3L70 J;  3L72 J;  5KP6 B;  2JDI H;  2QG4 A;  3S1K A;  4C7N B;  4TT3 H;  1KN7 A;  1MFZ A;  4H44 C;  2LL8 A;  5KKZ B;  2KG9 A;  2KOP A;  2B87 A;  2QEX P;  1YI2 P;  1HTL C;  1X9V A;  3CWB E;  1E6J P;  3JCU H;  4NPE A;  3VMA A;  1HJ0 A;  2OTL P;  2YXQ B;  1LP1 A;  3U59 A;  1QRJ A;  1H0T A;  1VDF A;  1FAV A;  4LLH A;  2JEE A;  2E43 A;  2WSF H;  1BGY D;  1FJK A;  1M56 D;  3TGU D;  1N73 C;  2XV5 A;  1KFN A;  3L71 E;  2DNW A;  4PD4 D;  4NEO A;  1NTM E;  1KQL A;  2I1K A;  1HGZ A;  3CXH E;  2FFD A;  1M7L A;  4L74 A;  4IL6 X;  3L72 G;  3BCC D;  4GOE A;  2AXC A;  5KJ7 A;  5DJT B;  2N9B A;  4XFX A;  4DT0 A;  1EZV I;  4BPH A;  3MUD A;  2Y0E A;  2Q1K A;  4PWV B;  1KB9 D;  2H88 C;  1JY2 O;  5BU8 B;  1L0N D;  1NTM K;  2CQ8 A;  1AVO A;  1SQV G;  2KLV A;  5APV A;  1LTA C;  3OA7 A;  3PLN A;  4OWF A;  1L4A D;  4UHP B;  4KT0 J;  2N5I A;  3FXD A;  2KOQ A;  2WMM A;  2P1J A;  1N86 A;  4L75 A;  5AVU B;  3BVH A;  3H1H D;  1Q81 Q;  4I7Z B;  2IBZ G;  3CXC O;  1L0N G;  3GZM A;  1AYI A;  2EG5 A;  1VHN A;  2J59 M;  1IFN A;  1N73 A;  2NPS D;  3P8C E;  5CBO A;  1RH5 B;  1JMM A;  2FVE A;  2N9Y B;  3RK2 D;  5CCH A;  1SQQ E;  2H8P D;  3B4Q A;  2WSC H;  2ONT A;  2BAS A;  1ZW0 A;  1BAJ A;  2IYP A;  3H25 A;  4GR2 A;  5APS A;  2O1K A;  1KIL E;  1NYH A;  3U1C A;  2GZG A;  3BRV B;  1ZN5 A;  3AEA C;  2E74 B;  3HE4 A;  2NPS B;  4DZO A;  1ZR4 A;  2AEF A;  2O01 N;  2YO2 A;  2A45 I;  1VF5 C;  2V7Q J;  3AEE C;  1L0L G;  3H1J J;  2OAR A;  3CX5 E;  3L74 G;  1RY3 A;  1CSB A;  1DD3 A;  3CCU P;  2MD9 A;  3FX0 A;  3KYQ A;  4JF7 A;  3PH0 A;  3FGA D;  5APY A;  1F80 D;  3GF3 A;  1PP9 D;  2E74 D;  3Q5R A;  1FE6 A;  2OTK E;  2MVV A;  2EHS A;  2NZ2 A;  1OVU A;  2K5X A;  1J1E C;  2AF8 A;  1M1J C;  4K3A A;  3L73 E;  3L37 A;  3L74 D;  1S5L H;  1NTZ K;  2FHS C;  1T3J A;  1GMJ A;  4M3L A;  2GZE A;  4XFJ A;  1L0H A;  3G4S P;  5AW3 B;  2Z44 A;  5AW9 B;  1SQX K;  2M8R A;  3WBH A;  1GL2 C;  1LT9 B;  1FZC C;  4UB8 E;  1EXJ A;  1FZE A;  3KZI H;  3VMY A;  1QL2 A;  3T97 B;  1NH4 A;  1UNK A;  4H2X C;  1YTZ T;  4N6J A;  3RK2 C;  1SQB D;  3GMA A;  2K9J A;  2BEZ F;  1FOS F;  1BGY G;  1M57 D;  2C9L Y;  3B4S A;  1LTI C;  1BGY E;  2CNR A;  1KFM A;  2XKM A;  2JU1 A;  3IAO A;  2NRG A;  3V4W A;  2B88 A;  3CCS P;  1KIL B;  3H1J E;  1Y9B A;  3FXE A;  1UII A;  1BE3 E;  3HUS C;  4PD4 E;  1URQ D;  4PJ0 E;  4DJG A;  3AED C;  1IO4 A;  4OVN F;  3A0B H;  3SFD C;  2KNC B;  3RK3 D;  1PGP A;  5JPA A;  3BCC E;  3R4Y A;  5M1B A;  3V5B A;  1OIP A;  2G8Y A;  2WVR A;  2V4H A;  2ZVN B;  1JNM A;  4GIF A;  1NU1 J;  1HVV A;  2C9N Y;  1L0N E;  3L73 G;  5KP8 B;  2N98 A;  2OGU A;  3B5I A;  5DJU B;  3RG2 A;  2K0X A;  4WY4 B;  3EFG A;  4H0L D;  3L4F A;  3WUU A;  2AXT E;  4MRT C;  1PL5 A;  4EYY Q;  2R3C A;  2WPQ A;  3HE5 A;  1X79 B;  1FZC B;  4A7P A;  3P8C D;  3O6Q B;  5AVT B;  2JJL A;  1JO5 A;  1NAY A;  3B5N D;  2P10 A;  2BEQ D;  2IBZ I;  1SFC A;  1P84 D;  2ZYD A;  1FS0 E;  1KC8 Q;  4KHX A;  1VF5 D;  1J1D B;  2YMY A;  2PFX A;  2OYH B;  1MUU A;  2JYG A;  2D2C C;  5HGN A;  3Q3D A;  3CCQ P;  2KXP B;  1IFM A;  1GU5 A;  3L75 J;  1KIL C;  2M5A A;  2QM8 A;  3CX5 D;  2KR5 A;  3TNU A;  1L0N J;  4D6T D;  1EXI A;  1HF9 A;  1QX8 A;  1L0I A;  3GJN A;  1N7L A;  1OXZ A;  1S3J A;  1NTZ J;  2EFJ A;  1M1K Q;  2FAC A;  2FY8 A;  4PD4 I;  2W83 C;  3CCE P;  2K37 A;  2FYZ A;  2GDX A;  1JTH A;  2XNX A;  4K35 A;  1MKM A;  2O3J A;  3P05 A;  1GW4 A;  3L73 D;  4O9B A;  4H0L C;  2Q3I A;  3AE9 C;  2QJY B;  2Y0C A;  3II6 A;  2PEN A;  1FZB A;  1FZA A;  1IZN B;  1EC5 A;  2IFN A;  3LW5 J;  2RKL A;  1RHZ B;  4JYC A;  4DCK A;  2CPS A;  1IMP A;  1J2J B;  1NHL A;  1RQU A;  3SWF A;  1S2E A;  2QIW A;  5B5E E;  2QJK C;  2QRX A;  3BAS A;  1VQM P;  1K30 A;  1CI6 A;  1SQP D;  2WZ7 A;  2LOL A;  2ZYG A;  1S4X A;  4ASW A;  2E1M A;  4BRY B;  4RJT A;  1PFI A;  3TNU B;  2HG5 D;  1KLP A;  3LW5 H;  5EFW B;  2OYI A;  3AE6 C;  1NKN A;  3GKL C;  3H1J D;  1L0L D;  3V2R A;  1L0L K;  1SQB G;  3FWN A;  1YYC A;  3H6P A;  2NPS C;  1LP1 B;  3H32 B;  2JWD A;  3RK3 E;  3AE8 C;  3EJB A;  4YXW H;  3KPE A;  1CEI A;  1HGV A;  5E79 E;  2DGY A;  2FAD A;  1OZH A;  2OYO A;  1M6E X;  3LID A;  4PXH B;  1Q2N A;  1VQ6 P;  2H89 C;  3H1L J;  1IFD A;  1KYO H;  2KG6 A;  3HD7 A;  1YJW P;  2FVA A;  4JYB A;  2YKP A;  1ZME C;  1YQ4 C;  2K88 A;  3H1H J;  2ZVO B;  5H2F E;  2GUS A;  2KW2 A;  1BE3 G;  1G1I A;  1RF0 A;  5HGO A;  2KOS A;  1KMI Z;  3L71 J;  1IK7 A;  7CEI A;  3H1K G;  1SQP K;  1PP9 J;  4JBZ A;  1USD A;  2KSE A;  2PEJ A;  2HR3 A;  3VP9 A;  1BDD A;  1Y47 A;  1FOS E;  2PEK A;  3GF7 A;  2E76 D;  3ZDM A;  3I56 P;  3ITK A;  1SFC B;  3RK3 C;  3IR9 A;  1VQ9 P;  2JWA A;  2HPC A;  5F2O A;  4GOF A;  2YIU C;  5TIS H;  1URQ A;  3CC7 P;  3WMM 0;  3PTZ A;  4COC A;  4L73 A;  5F2N A;  3TGU J;  2E5T A;  4W7Y A;  1D7M A;  1KB9 E;  2ITA A;  2XZR A;  3TF5 A;  3H0D A;  3A0B E;  5F2K A;  2W6B A;  2LR2 A;  2MR8 A;  1OWA A;  1FU1 A;  3H1J G;  2H7H A;  3R2P A;  1NOH A;  3PJS K;  4IL6 E;  3A7O A;  3KZI E;  4B86 A;  4PV1 B;  1ACP A;  2QJP B;  1H88 A;  1N7S D;  4GR6 A;  1SQV K;  2AFD A;  1AV1 A;  1KV4 A;  5E79 H;  1BSN A;  3SSU A;  3L72 E;  1PP9 G;  1S5L E;  4WYM A;  4U0A A;  1EDK A;  2RMZ A;  1ZNV A;  1PEO A;  5L8R J;  1DD4 A;  1J1E B;  2LF4 A;  1BE3 J;  2MJZ A;  3RBZ A;  1JJ2 O;  3CLQ A;  3S4R A;  2JO1 A;  3BRT B;  1KIL D;  2CWO A;  5AW7 B;  1URQ B;  4IFM A;  1IFP A;  2LKI A;  1H0T B;  2WSE J;  1NTK J;  1SFC C;  2JP3 A;  3RK3 B;  2KGE A;  1OW7 A;  1A02 J;  3NY7 B;  2JQ4 A;  2FQ0 A;  3Q5P A;  3EJE A;  1YBK A;  2B87 B;  2Q6Q A;  3MD0 A;  1KQF B;  2PAJ A;  1NTM J;  3Q2Y A;  4PH1 A;  2O1J A;  5AW5 B;  1SQX D;  3H1I J;  1IUQ A;  4Y28 J;  1D1D A;  4XE5 B;  1PP9 E;  2WIT A;  3I5C A;  5KAI H;  3V2Q A;  2PEO A;  1IFI A;  3CX5 H;  3F5H A;  4UB6 E;  2WSE H;  2EIA A;  3G3Z A;  1EZV E;  4D6T G;  2FYU E;  1KYO I;  3HZQ A;  1SQB K;  1K9M Q;  1QVF O;  3G29 A;  1GL2 B;  4PJ0 H;  1LTJ B;  1N7S C;  2NPS A;  1NAF A;  1K8A Q;  3L36 A;  1VQ4 P;  1RF1 B;  2M8N A;  5TIS E;  3V2N A;  3L70 D;  5B66 H;  3H47 A;  4I7Z C;  5CCH C;  1ZP0 C;  1AVY A;  1SQQ J;  2CK3 H;  4PD4 H;  5AVX B;  3GW6 A;  1SQV J;  1GD2 E;  1GL2 D;  1IMQ A;  5EJD A;  3GHG C;  1G2C A;  1PEQ A;  4BRY A;  1S1C X;  1EQ7 A;  2KIK A;  1X3O A;  1A02 F;  3NTN A;  1USE A;  5AW2 B;  3E2D A;  3MGE A;  2WPT A;  3LIE A;  2NO8 A;  3C8V A;  1ZXG A;  2PNG A;  5KJ7 D;  3O8Z A;  1SVF A;  2W27 A;  2ZJS E;  5AW8 B;  1PEU A;  3CCM P;  2IYO A;  3MTU E;  4EDF A;  2KYV A;  1HJB A;  3CMA P;  3A5T A;  1S9K E;  3M91 A;  2JBG A;  2AXT H;  4H2W C;  3WU2 E;  1BCC E;  3M9B A;  5CHX A;  2K3R A;  1L4A A;  5HVC A;  4H13 B;  1M6N A;  1OVV A;  3H1H G;  4YXD C;  2I1J A;  4U3F D;  3W68 A;  1NTK D;  4H13 C;  4U3F G;  1FDI A;  3CI9 A;  4H44 D;  1KTM A;  3H1I D;  2GUV A;  3MIW A;  3M9Q A;  2GZJ A;  1K04 A;  3TSI A;  1DEE G;  1X22 A;  1RO2 A;  3M0A A;  1S5L X;  4HKZ H;  4H13 D;  2K1A A;  2AFE A;  1NTK K;  1NQ4 A;  2YXR B;  1GW3 A;  1AA0 A;  3AE1 C;  2YKO A;  2XDJ A;  4HYT B;  2FYU J;  3CCR P;  2P58 A;  4CPG A;  1ZRT D;  2K92 A;  2L0Q A;  5AW0 B;  4AYC A;  3U43 A;  3O6Q A;  3HUS B;  4W7Z A;  2Q9I A;  2M5A B;  3M06 A;  2VLO A;  3L75 G;  2KZI A;  3BAT A;  1EDI A;  2WTY A;  3Q1M A;  3HE5 B;  3KQG A;  2KUB A;  2GA1 A;  1GZL A;  1RF1 A;  2BQ1 E;  3VP8 A;  4D6T E;  3HD7 D;  3H1L D;  2C0W A;  1KQG B;  1BDC A;  3BCC J;  2M0B A;  1MFT A;  1PGO A;  2O01 J;  2UWJ E;  1LTJ C;  1VQN P;  3VN0 A;  2AEM A;  2LML A;  4IFD K;  2RN0 A;  1EZV D;  4M0I A;  2BCC J;  3S9O A;  2VSQ A;  1GXG A;  1LGH B;  3AE4 C;  3D6Y A;  2XV6 A;  1Z6M A;  2SPZ A;  4IPY A;  3HD7 B;  4WY4 A;  2E76 B;  1K73 Q;  2FKW B;  1UIX A;  1SFC D;  3L70 E;  3MP7 B;  3B5N A;  1M1J B;  2HOD B;  1TU3 F;  3CCL P;  2N5H A;  4GOD A;  2YMK A;  4EI2 A;  2W6J H;  1ZR2 A;  2VRS A;  1KB9 H;  1SQP E;  1M90 Q;  2QNW A;  1YJ9 P;  4L76 A;  3GHG B;  2WSF J;  3KXD A;  5KJ7 C;  1OX3 A;  2QJK B;  4HKG A;  5KP7 B;  4JPZ B;  1LT1 A;  4R4L A;  1T8K A;  1P84 H;  1SQQ K;  3CCV P;  3RG6 C;  1LJ2 A;  4PV1 D;  1LTT C;  2C0X A;  4HB1 A;  2HLO A;  4LGD E;  1BSH A;  3U1A A;  1N7S B;  2WT7 B;  4BPF A;  3CL3 D;  3SWY A;  1YHQ P;  2P9X A;  3KHU A;  2BCC E;  1JY2 P;  1FC2 C;  4C46 A;  3AE7 C;  3LRY A;  2J58 A;  4PV1 C;  2W8Z A;  3V4Q A;  4IOI H;  1YQ3 C;  2AVA A;  3SWK A;  4U3F E;  4BXL A;  3TGU G;  1NTK E;  2PEQ A;  1RE3 A;  1AQT A;  3HTK B;  2OQQ A;  1GK6 A;  1NVO A;  1HBW A;  1ZLL A;  2L9F A;  2YO3 A;  2K9Y A;  4XA4 A;  4YTP C;  4BPG A;  2CG5 B;  1NO4 A;  1XTG B;  1W2B O;  2YIU B;  2W90 A;  1SQP G;  2ZT9 C;  3ABV C;  1JM0 A;  3E1R A;  2D2C B;  1QGK B;  2ZAE B;  4F37 A;  4UB8 H;  3G1I A;  2KOR A;  1YTZ I;  2WPS A;  1VQ7 P;  2KI7 B;  2M5R A; 
#chains in the Genus database with same CATH homology
 1QRJ A;  3H47 A;  4U0E A;  2BUO A;  2JO0 A;  1M90 Q;  4XFY A;  2DGY A;  1YJ9 P;  2KOD A;  4GR6 A;  1YJN P;  1M6E X;  2M8P A;  1VQ6 P;  1M74 A;  1VQL P;  5JPA A;  2QA4 P;  1YJW P;  1A43 A;  3G6E P;  1YIJ P;  3G0V A;  2EFJ A;  1M1K Q;  4WYM A;  2XT1 A;  4U0A A;  4XFZ A;  2Z46 A;  1PEQ A;  3CCR P;  1PEO A;  2OAR A;  3CCV P;  3CCE P;  5HGO A;  2LF4 A;  1S72 P;  3Q20 A;  3RG6 C;  1VQP P;  3CD6 P;  3DPH A;  4XRQ A;  3DS1 A;  1JJ2 O;  3CCU P;  3E2D A;  3MGE A;  4U0F A;  1VQ8 P;  3VRL C;  2CWO A;  3P05 A;  1YIT P;  4XFX A;  3DS4 A;  2Z45 A;  1AUM A;  1RO0 A;  2PEJ A;  3G26 A;  4XRO A;  1VQO P;  2PEN A;  3DTJ A;  1YHQ P;  4U0D A;  2PEM A;  2P9X A;  3CC2 P;  1PEU A;  2BQ1 E;  2PEI A;  3CCM P;  3B5I A;  4COP A;  1RNI A;  3H4E A;  2PEK A;  2L6E A;  3NTE A;  3CCJ P;  5DCK A;  1NJI Q;  3LRY A;  3I56 P;  5BS2 A;  1VQ5 P;  3CMA P;  3CME P;  1VQ9 P;  4QNB A;  4U0B A;  3DS3 A;  1Q82 Q;  3G4S P;  1KQS O;  2Z44 A;  5F2O A;  1Q86 Q;  1A8O A;  4PH1 A;  3OW2 O;  1VQN P;  2JYL A;  3WBH A;  3G71 P;  5I4T G;  3CC7 P;  1EIA A;  2PEQ A;  1IUQ A;  1N8R Q;  4COC A;  3DS5 A;  1Q81 Q;  4M0I A;  1K30 A;  1VQM P;  1D1D A;  2PY8 A;  3CXC O;  1QVG O;  3G1G A;  3G21 A;  2BHV A;  1M6N A;  5F2N A;  1Q7Y Q;  2XXM A;  2EG5 A;  2PEO A;  1VQK P;  2XV6 A;  2M8L A;  2E1M A;  4IPY A;  1PEM A;  2EIA A;  3CC4 P;  5HGL A;  5BS1 A;  1EOQ A;  1KC8 Q;  3H0D A;  1K73 Q;  1W2B O;  3HZQ A;  3DS2 A;  5F2K A;  1K9M Q;  3G29 A;  3CPW O;  2QEX P;  1QVF O;  2OTJ P;  3M1M A;  3HYB A;  1ZMB A;  1YI2 P;  4PH0 A;  2JYG A;  4U0C A;  3I55 P;  5HGN A;  1E6J P;  3G28 A;  3DS0 A;  2ONT A;  1K8A Q;  1RO2 A;  3G1I A;  5HGM A;  3CCL P;  2OTL P;  1VQ4 P;  1BAJ A;  2M8N A;  1VQ7 P;  4GR2 A;  3CCQ P;  1KD1 Q;  3CCS P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...