1NJIQ

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1njiQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1njiQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1njiQ03
1VQMP 1S72P 1K9MQ 2OTJP 3CCLP 1Q7YQ 3I55P 1Q82Q 2OTLP 3CCMP 3G4SP 1QVFO 3CXCO 3CPWO 3G6EP 1W2BO 1YJ9P 3CCUP 1YHQP 1VQ9P 3CD6P 1K73Q 1M90Q 1KQSO 1JJ2O 3CCEP 1VQ6P 3I56P 2QEXP 1K8AQ 3CC4P 1NJIQ 3CC7P 1M1KQ 1VQNP 1QVGO 1VQ7P 1YJNP 3CCQP 3CCRP 1Q81Q 3CMEP 3CCJP 3CCSP 3OW2O 1VQKP 1VQPP 1VQ5P 1KC8Q 2QA4P 1VQ4P 1VQ8P 3CC2P 1Q86Q 1KD1Q 3CMAP 1YI2P 1VQLP 3CCVP 1YIJP 3G71P 1YITP 1VQOP 1YJWP 1N8RQ
chains in the Genus database with same CATH superfamily
2JDIH 3CE7A 1KLPA 1NAYA 2IPPA 1SFCC 2N5HA 2CQ8A 5AW0B 5APYA 1SQBK 2KG8A 3BRTB 3KZIE 1DH3A 3DS3A 2OYIA 1ZRTE 5H2FH 1RE4A 4ASWA 2M3BA 1D7MA 3TDKA 2JO0A 2B9BA 3F5HA 2BEQD 4L74A 3L71J 1VQKP 2IDBA 3OW2O 2QA4P 3BASA 4JQ0D 2WPQA 3HD7A 1A43A 2POHA 1BCCD 1DD4A 2KS1A 3CCMP 1PEUA 2R3CA 1URQD 3GF3A 3PHLA 2QM7A 4L73A 3G29A 5HGLA 3H32A 2ZXEB 3HTKA 2NPSD 5KJ7C 4EIJA 1P84I 3CCVP 5BS1A 3WMM0 3CX5E 1E5WA 3DS2A 2PEKA 1ZRTD 4IPYA 2CK3H 5HVCA 3E2DA 2QNWA 3V4QA 4MN4C 1SQQJ 5AVQB 3NTEA 5CCHA 3A5TA 1FDIA 4I7ZB 3L37A 3BVHA 5AVTB 4I1LA 3PJSK 2LMLA 4GKGA 2EG5A 4TT3H 1HTLC 2E75D 2W6AA 3H1HE 1YJWP 2CPBA 1NU1G 2C0XA 1EZVD 2QVAA 3L71G 1SQXJ 3HYBA 1SFCD 3M1MA 2KOPA 3VMAA 2Y0CA 1YTZT 5GTIE 2BQ1E 2AFEA 3NTNA 2QE7H 4IL6X 1VQMP 2XNXA 2NRGA 4K35A 2AFDA 2JEEA 3MUDA 2G8YA 4DZOA 3T97A 3GG2A 1Q2NA 2OGUA 2K5XA 2WQYC 4KJMA 2H8PD 4RKUJ 3AE8C 2FYUK 1SQQG 2KZIA 1EDLA 3H1HD 1JB0J 3G4SP 1HJBA 3G6EP 1KYOE 2MKVA 1CI6A 3MTUE 1PP9J 5AVUB 1HY8A 5DCKA 1RF1B 3DS4A 5KJ7D 1SQXG 5F2NA 4PWVB 2Z45A 2B87B 5AVXB 2FYNB 2YKPA 1EDJA 4PXHB 2KXPB 2ZT9C 3AEEC 4PH1A 3M0DA 3P8MC 3VMXA 2KOSA 1OW7A 3O6QA 1RY3A 1LTSC 2OYIC 4L76A 2XT1A 2P1JA 1CZQA 2E76C 1RE4C 1GW4A 3V6IA 2GUVA 1KQSO 2DW3A 1KYOD 3FGAD 3MD0A 2LXCB 4NEOA 3FXDA 1NTMK 2L91A 4D6TE 2N1TA 3HRNA 4MRTC 3CX5I 1ZW0A 4K3AA 1DEBA 4QMAA 2M8PA 4WY4A 3HD7C 1PEQA 3BCCE 2FACA 1PP9G 2PEQA 4IFMA 4EOTA 1NTZJ 1KILB 2M8LA 4F37A 1XTCC 2HPCB 2I8DA 3CL3D 1FAVA 1SQBE 3TK1A 1VKUA 1DV5A 1FZCA 3WUTA 3RL0C 1A02F 2FQ1A 1A02J 1FZBA 2KOGA 3ITKA 2V7QH 1FZAA 5CCHC 1M1KQ 3IN6A 3VYIA 1LNQA 1CEIA 2YIUC 4D6TD 5H2FE 1RE3A 2GDWA 2C9LY 1R5SA 5CMZA 1S72P 2OTJP 2GZIA 3BCCD 3RGUA 2N5IA 1PV3A 2ZT9D 1T3UA 1SQVK 2V4HA 3P05A 3V2RA 1NTZG 4JYCA 3U1AA 1SQBD 2PEOA 3H0DA 1JY3O 2E76D 3GHGA 3H1KE 3WU2H 1DEEG 1G2CA 1QRJA 3MUDC 1IFMA 1ZMBA 1N73A 1FOSF 1IMQA 2WTYA 2DNWA 3GLMA 4JYBA 2YNYA 3M9BA 2JYGA 3Q20A 1GW3A 5C39A 3HD7D 4OGQC 1N8RQ 1IK9A 1T8ZA 3L74E 1E6JP 2BCCE 2ZFCA 2FXPA 2J58A 4YXDC 5EW5E 4IFFA 1JM0A 3H1LE 5APXA 3II6A 1ZNVA 4C7NB 1OW8A 1EIAA 1E0HA 2N98A 1LT9B 3R4YA 1VHNA 2YKQA 3DS1A 4A7PA 3G1GA 1A8OA 1LWUB 4HKZH 2W90A 2P58A 4DJGA 3RL0D 1UJZA 3I55P 3O8ZA 1AJYA 2D2CB 3H1KD 1FZFA 1KQGB 4YXWH 1OMIA 2IYOA 5CCHD 3CLQA 5AVYB 3M0DC 2JR8A 1Q81Q 1X0TA 4B86A 2KGAA 1BCCG 4COPA 2FYUE 1YQ3C 3AECC 2E74B 1JY2O 2QG4A 2BCCD 2VRSA 1SQPK 1VQ6P 3H1LD 2L22A 2O1KA 1M57D 2N1TC 1NOHA 3CMAP 2HR3A 1LTJB 4WY4C 3W67A 2E43A 5BU5A 5TJHA 2W27A 3CPWO 2OYHB 2FQ0A 2HODA 1W2BO 3QH9A 1GXGA 3H1HJ 2M5AA 2VLQA 2KUBA 4PV1B 3TSIA 3EJBA 4XFJA 5JPAA 3LRYA 1KN7A 3G1IA 1ZN5A 3AE1C 3B4QA 1S2EA 3DS5A 4OGQD 1FZCC 2FYUD 2K9YA 2XZRA 2WT7A 2GDYA 3EFGA 2O01N 4H44C 2UWJE 2Z4EA 1N7SB 3MP7B 3P32A 2Y9ZA 4DCKA 2ZVOB 4L75A 1RE3C 2N6ZA 2WSFH 4IOIH 1EQ7A 1LJ2A 4OVNF 3G3ZA 7CEIA 4JBZA 1OIPA 1M90Q 2K9JA 2Y9YA 3GZMA 1T2KC 3L36A 2FXOA 1JTHB 1S5LX 5F2OA 3H1HG 2FAEA 2FYZA 2MR7A 1NYHA 3GHGC 2ZXXA 3OA7A 1H88A 1JMMA 2JQ4A 1N73C 2HLOA 1EXJA 3HE4A 2N1TD 4RESB 1HF9A 4XA4A 4RJTA 1KB9H 2EIAA 4WY4D 4H0LC 1EMVA 2AEFA 2W8ZA 5DJTB 2O3JA 3CXCO 4NPFX 4Y28J 5HGMA 4HKGA 3RK2B 1L2PA 1J1DC 3NY7B 2BEZF 1SQVE 1L0LE 3RL0g 1VQPP 3V2QA 3Q2YA 1SLQA 1E79H 1LP1B 3H6PA 2YXQB 3AE3C 3DTJA 4WWIA 2MVUA 3H1JE 3P8CE 4WVZA 3L73E 2E74C 4D6TJ 4BRYB 4XFYA 3MGEA 4GIFA 2FKWB 1SP4A 4GR6A 3BCCJ 2ZYAA 4H44D 3V5BA 3RBXA 1YYCA 1L0NK 5CHXA 1KFNA 3CC7P 1U7JA 3Q1MA 4U3FE 3WU2E 1SQBJ 2P67A 3BRVB 5HGNA 3KQGA 1T2KD 1SQVD 1KC8Q 1L0LD 3AE2C 1FBMA 4XE5B 1PEOA 1NU1K 1UNKA 4W80A 2FY8A 2KLUA 2YO2A 5GTHH 1IO4A 1PZQA 3JCUH 3P8CD 2H7HA 1BE3E 2BUOA 2R44A 2XKMA 1VQ9P 2B89A 3C1LA 1M1JB 3M9QA 2QJKB 4D6TG 1M6NA 2QJYB 4H0LD 3BCCG 2O1JA 1NTKE 2I1JA 4ASVA 1VF5B 4U3FD 3H47A 3D70A 1SQPE 3LMOA 2LPKA 1H89A 1PGJA 3H1KJ 4ZKPA 2Q9IA 1SQBG 1W2EA 2QJPC 2H89C 2MF4A 1AA0A 1YIJP 2JJLA 2M8NA 3EJEA 3VRLC 2E74D 3OAKA 1PGQA 3E1RA 2K37A 1BE3D 1K73Q 2WZ7A 3FWNA 5E79H 2KORA 4KT0J 4DOJA 3ZDMA 3L74J 2BCCJ 5AW9B 5KLIC 3KDPB 3CXHH 1JEKA 3RK3B 3H1LJ 1D1DA 2KI7B 3CC4P 3CX5D 1NTKD 2EFJA 3RG2A 1JUNA 2XDJA 1YBKA 3C8VA 3CI9A 1J1EC 2CG5B 2WPSA 1AQ5A 1RF1A 1GZLA 2OTKE 1IFDA 2Z5HA 2B87A 3WUVA 1Q82Q 2OTLP 3AE9C 2LIWA 1PGOA 4IL6H 3H1KG 1AUMA 5F2KA 2FYUJ 3H4EA 1PEMA 3VMZA 5KAFH 2IBZE 1GPJA 1OVUA 2R5BA 3KYQA 1QL1A 2KOOA 3L74G 2BCCG 3CD6P 3NMDA 1IMPA 2XV5A 3H1LG 1X8YA 3LW5H 4U0AA 5AW3B 4ZNCA 2M5RA 1IFNA 5AVRB 3USSA 5KP6B 2I1KA 3D71A 4DT0A 3FWLA 2XXMA 3GW6A 3UIAA 1YHQP 2JAZA 1KILA 1HJ0A 2QEXP 4R4LA 1AFOA 3WUUA 3CCRP 2ITAA 2HPCA 1KB9E 2FVAA 3U1CA 1ZR2A 1QVGO 3GF7A 2FYUG 4H13B 3KXDA 3L72E 3IF4A 4BPHA 1QVFO 2KWLA 1GL2B 3VP8A 5B5EH 1LTAC 1DIPA 3Q3DA 1NTZK 2NZ2A 3EWKA 1QEXA 5KAIE 3V4WA 1QGKB 2MVVA 1FJKA 4I7ZC 1CSBA 5BS2A 1G1JA 2SPZA 1GMJA 3MIWA 2JU1A 1L0NE 2Z44A 2R32A 3GMAA 1Y8AA 1U7MA 2R5DA 1K30A 2KR5A 1YJ9P 3CCUP 3PP5A 1NWQA 1R8EA 1JO5A 5L8RJ 2JWDA 2K92A 1JOCA 1KB9D 2IZ0A 1S3JA 2P9XA 3F89A 1Z6MA 2FVFA 1NU1E 4EDFA 3AEAC 1ZMEC 2M0BA 2W83C 3GJNA 4UHPB 1JJ2O 3NFQA 2KIKA 2Q6QA 1OVRA 2A45H 5AW5B 3R2PA 2LKMA 3TGUE 3CCQP 3JSVC 3L70E 3G26A 4NPDA 3NXSA 2KG6A 2V7QJ 5EFWB 5GTHE 2ZAEB 1L0ND 3JCUE 4TLFA 3SWKA 1SQVJ 1FJPA 1L0LJ 3LIDA 2VLOA 4U0DA 4LC1A 3GKLC 2K0XA 1MUUA 1HGZA 4C7NA 1JMBA 2IBZI 4GT1A 3H1JJ 2ROQA 3G21A 1S9KE 1LT9A 1OVVA 3L73J 2XZ0D 1RF1C 2WSEH 3M06A 1LWUA 4U0EA 2HFED 2E42A 4GOEA 4BXLA 3A3YB 2E5YA 1KQFB 1Y9BA 4NPEA 4OWFA 2FYNC 2E1MA 1IFJA 2GUSA 2J59M 3G0VA 5APWA 2YXRB 1H0TB 3L35A 4U3FJ 2ERHA 5APUA 1WRGA 2KK7A 1HGVA 1VQ5P 4YTPC 3TGUD 4ZMDA 1BDDA 1UIXA 3L70D 1VL2A 2N9BA 1ZV8A 1URQB 1Y47A 5E79E 5KLVK 2GZJA 1KB9I 3CXHE 1OWAA 1SQVG 3A0BH 2NPSB 1BE3J 1L0LG 1S9KD 3VTPC 1EXIA 1LTJA 3IFMA 3L73G 4WB4A 3L74D 2OYHA 1RO2A 2K1AA 1KILC 5KKZB 3V2PA 4GOFA 2QIWA 4YPCA 4XROA 1NTKJ 4EYYQ 4QNBA 2WVRA 2B88A 2L5GB 1H8AA 2E75B 5KP8B 2KLVA 1LTGC 1HH0A 1ZR4A 1HBWA 1U57A 1JY3P 1OFCX 4IL6E 4U3FG 2AXTH 3B8EB 2WSSH 4XRQA 2MY5A 3VP9A 2IFMA 5KAFE 5CJ4A 1NQ4A 4HYTB 2OYOA 3CXHD 3CWBE 1N7SA 2WSCH 3B5NB 1AVOA 1IC2A 2GA1A 3AE4C 2PGDA 1EC5A 2K2QA 1L0HA 1BE3G 2R3SA 1KILE 2W6JH 3G9RA 1QL2A 1UIIA 2WPVB 3HE5B 1YJNP 4Y99B 2CWOA 3CC2P 2H43A 1NTME 1VQLP 1JTHA 2O01H 3P7KA 3DS0A 1NTKG 2EHTA 3M0AA 3JC22 1HWTC 4UB8H 3CCEP 3PTZA 2KODA 3A0HH 1K8AQ 5AVWB 3VOPA 2J5UA 5CZDB 1KZUB 2K94A 1Q86Q 1J2JB 3CWBD 1HUCA 2XV6A 2PFXA 1AV1A 1JY2P 3SWYA 5B5EE 3MZWB 4WBAA 4R0MA 2CPSA 1R5LA 1MFZA 1AVYA 3IR9A 3RG6C 1ZP0C 4OH8B 1KILD 2WSFJ 2A06E 5CCGA 4U7JA 1NJIQ 3TYYA 1AYIA 1K04A 3TNUA 1LT9C 1LGHB 1LP1A 1LWUC 2KSJA 4JF7A 1NTMD 1JCCA 2K0YA 1S5LH 2GM4A 1ACPA 5APQA 4BRYA 2D2CC 1FR2A 3S9OA 1FZGA 2GYKA 2GZFA 3CXHI 2QSIA 4ZKUA 1BXIA 4BPGA 3TNUB 3D6YA 1N86A 3H25A 2RKLA 4R4MA 1KTMA 3EFFK 2LL8A 3G71P 3N7NA 2EHSA 3KPEA 2ZYGA 5I4TG 1NAFA 4BPFA 2A06D 3L72J 1KFMA 2XNDH 1BDCA 2RMZA 1BCCE 1GK4A 4PD4H 1Q90D 1T3JA 5APSA 4W7YA 1BSNA 2FBWC 5KTBA 2FFDB 1LTJC 3EJDA 2VLNA 2LKIA 4IFDK 2OQQA 4JPZB 2LF4A 2OYHC 4W7ZA 3W68A 1L0NJ 2GDXA 1HVVA 3B4SA 1M1JA 1VQNP 1G1IA 4UB6H 1IFPA 1NO4A 1MZ9A 4PV1C 3CCJP 4H2YC 3PH0A 1M7LA 1PPJE 4BWNA 3B5NC 2L0QA 4LLHA 1GXHA 1IJDB 4LGDE 3H1JD 2ZT9B 3L73D 4DG9A 3H1IE 1IFIA 5KLVE 2KOQA 1NU1J 4PH0A 4Y99C 2C0WA 2PRRA 3L75E 2OYIB 4H2WC 1N7SC 3G28A 4I2LC 1USDA 1PFIA 2FADA 1VQOP 2E76B 4H2XC 2ONTA 1EZVE 1K9MQ 2K0DX 3TGUJ 1FC2C 2Q3EA 3L72G 2KB7P 3L70J 2D2CD 4CA3A 3VN0A 2K3RA 2JP3A 4PJ0H 3A0BE 1M74A 2KP8A 1SQQK 1VQ4P 2PEJA 2FVEA 1NVOA 5AW2B 2AEJA 1DD3A 3HD7B 5AW6B 2QM8A 1PPJD 1L0NG 2IX7C 2Z46A 1GTWA 3AEBC 1TU3F 2KS1B 1DX7A 1EOQA 2W6BA 2KW2A 1EDIA 2M3EA 3H1ID 2CGQA 1SQXK 3H32B 4U0BA 2JWAA 2PAJA 5KLVD 3LIEA 3HTKB 1BGYE 1RO0A 2LR2A 2PENA 3L75D 5DJUB 1X22A 3U59A 1EDKA 1GK6A 3RL0B 2AXTE 3N4XA 3FXEA 2PP6A 3RK2C 2WPTA 4HJGH 2GZEA 5CCGC 2YIUB 1SQPD 4PV1D 3TGUG 1NHLA 3L70G 5CJ0A 3B5ND 2KGCA 1S4XA 3Q5PA 2YKOA 2ZVNB 1NGMB 3CCLP 2WMMA 2LIUA 2A45I 1DNYA 1ZOYC 1USEA 4C7RA 1NKNA 4M0IA 3AE6C 3GZLA 4GODA 1N7SD 2KGDA 4RO0A 2VSQA 1BGYD 2P7JA 3V2NA 2PEIA 4KHXA 3IAOA 2FFDC 4UB8E 3SFDC 3S4RA 4EI2A 5EJDA 3PRJA 5BU8B 3A0HE 2LXBA 3T97B 1OR5A 3AE5C 2Q5UA 1RF0A 4OGQB 4Z1MH 2ZJSE 1F80D 2DGYA 2H88C 1GU5A 3AEFC 1GL2A 3CWBJ 1CI6B 1KQLA 2PY8A 2BHVA 1YTZI 3Q5SA 4U0CA 1WT6A 1L4AA 4GR2A 1M1JC 2LOLA 3K5BA 2ZYDA 1VQ8P 2QJKC 5APTA 1EZVI 2IBZD 3LW5J 3KHUA 1S5LE 2AXCA 2QJYC 3HUSA 2IZ1A 1P84H 5CBNA 1VF5C 1LT1A 1NTMJ 3RK2D 1GU4A 1AQTA 3L4FA 5CCGD 1L4AB 5B66H 3O6QB 2K93A 2KGEA 3AEGC 1FDOA 2Z5IA 3SWFA 1S1CX 3HUSB 2FXMA 3PLNA 2WITA 5TISH 3AEDC 2N1TB 4HH2A 2N9YB 3I5CA 4PD4E 3CWBG 2PNGA 4WY4B 1ZLLA 2JKVA 3RK3C 3VMYA 1Q7YQ 3L71E 2IFNA 2FQ2A 1IK7A 3L72D 3D6ZA 1OZHA 5HGOA 4UB6E 1FU1A 2MJZA 2QRXA 2IYPA 2JBGA 1XTGB 1FS0E 4I6MC 3SFEC 1NTMG 1FZCB 1RH5B 3BATA 4N6JA 1BAJA 5KP7B 1LTBC 1X79B 2Q1KA 3E7KA 5AW4B 2X2BA 3C9IA 1FE6A 1N2DC 3A7OA 2K88A 1QLED 1L0LK 4H44B 3E1IA 5AW7B 1H0TA 3S1KA 1AF8A 2BASA 3RK3E 3KZIH 1SQQE 3WBHA 4PD4D 1KYOI 2CNRA 5K5GB 1NU1D 2LTEA 1URQA 1VF5D 3L71D 1BCCJ 5AVZB 2JO1A 2Y0DA 4HB1A 4PJ0E 2PEMA 2A06G 3DPHA 1VDFA 1SQXE 2MD9A 2NPSA 4CPGA 1PL5A 4GDOA 3A2AA 3ABVC 3GHGB 2N50A 2MR8A 4XFZA 1MV8A 5HV8A 1JY3N 2WSEJ 1G2CB 1FZEA 1RNIA 1N73B 1X9VA 2P2UA 2JYLA 3AE7C 1KV4A 2RN0A 2JB0A 3H1IJ 1CW5A 3RK3D 1RF0C 1SQQD 4H0LB 2KSEA 1BSHA 2E5TA 3CX5H 2GZGA 5KLVJ 4O9BA 3H1JG 2FHSC 4H13C 1SFCA 1GL2C 1NH4A 3L75J 1J1DB 1KORA 2AEMA 2A45G 4N3YB 3MHVA 1HQBA 2KG9A 1W5CE 1L4AC 1OXZA 3B5IA 1SQXD 1NTKK 1M6EX 2M8RA 3B5NA 3TF5A 4U0FA 2YMKA 1PP9E 1SQPJ 1OX3A 3Q5RA 3HUSC 1QX8A 1JCDA 2L6EA 1T8KA 2KNCA 1SFCB 4AQRD 1MKMA 3I56P 1IZNB 2WPRA 2KZJA 4PD4I 3HE5A 5GTIH 3SSUA 1JNMA 1PPJG 3HZQA 2HYNA 1GDTA 2KNCB 1JY2N 1T6AA 2WWWA 1BGYJ 3QWOC 4C46A 3H1IG 1M56D 2P10A 5KLVG 2Y0EA 3CMEP 3U43A 3CCSP 5KJ7A 2L4BA 2HG5D 1YI2P 2KYVA 3L75G 5AVSB 1RHZB 1LTTC 5AVVB 1PIXA 1EZVG 1MZ8A 1PP9D 2RH0A 3FX0A 2HODB 2WSCJ 1WMKA 1KYOH 3EQ2A 2M5AB 2YO3A 3B71A 4N78E 1N7LA 1NKZB 1RQUA 1SQPG 1VQ7P 1NTZE 1M8OB 1VPCA 2AF8A 1Z56A 5M1BA 1RQVA 1X3OA 1P84E 3M9HA 4H13D 1GL2D 1ZXGA 2YMYA 2WT7B 2O01J 2NO8A 1FDMA 4QKOA 5B66E 5AW1B 5BVZA 2AVAA 1L4AD 1OW6A 2QJPB 4COCA 1LTIC 1BGYG 5CBOA 4XFXA 1GD2E 2XZ1C 1KMIZ 2JU2A 1YQ4C 3M91A 5TISE 3MGNA 4AYCA 1K05A 2JGPA 2L9FA 2K9JB 1URQC 5AW8B 1SVFA 4N78D 5KLIB 4WYMA 4AUWA 2G3AA 2XU6A 4IZ6A 3RBZA 1NTZD 1MFTA 2NPSC 1PGPA 1YITP 2Q7CA 1IUQA 2N6YA 2FFDA 1P84D 2VLPA 1J1EB 1L0IA 2OARA 5KKZC 5KAIH 3HE4B 1SS1A 2C9NY 1KD1Q 5APVA 2IBZG 4M3LA 2Q3IA 3OJAB 2E75C 1FOSE
chains in the Genus database with same CATH topology
4XFZA 3CCLP 3H47A 3CXCO 3CPWO 1W2BO 3HYBA 3M1MA 3CD6P 3RG6C 1KQSO 1QRJA 5HGMA 1RNIA 1RO2A 1JJ2O 1ZMBA 1NJIQ 4M0IA 2JYLA 4XROA 4U0AA 1VQ7P 5JPAA 3CCQP 4QNBA 4PH0A 2BQ1E 1VQPP 3G26A 3LRYA 3DS3A 2JYGA 3Q20A 3G1IA 3DTJA 1YIJP 3G28A 2M8PA 1VQOP 3DS5A 2PEIA 2ONTA 1N8RQ 1PEQA 2M8NA 1VQMP 1K9MQ 3VRLC 1E6JP 1Q7YQ 2PEQA 2XXMA 4U0DA 1YHQP 2M8LA 2JO0A 4XRQA 1K73Q 4XFYA 2QEXP 5HGOA 3MGEA 1EIAA 4GR6A 1M74A 3G21A 3CCRP 3DS1A 4COCA 1VQKP 3OW2O 3G1GA 1VQ4P 1A8OA 2QA4P 3B5IA 2PEJA 4U0EA 1YJWP 1M6EX 4XFXA 3G71P 1D1DA 1A43A 4U0FA 1QVGO 3CC4P 3CC7P 2DGYA 1BAJA 2Z46A 3I55P 2L6EA 1EOQA 3CCMP 3G4SP 1QVFO 1PEUA 2EFJA 2E1MA 3G6EP 1M90Q 2PY8A 2BHVA 3G0VA 5I4TG 3I56P 4U0CA 3G29A 1M1KQ 4WYMA 5HGLA 4U0BA 4GR2A 5DCKA 5HGNA 1YJNP 1Q81Q 2CWOA 5BS2A 1VQ5P 1KC8Q 1VQ8P 3DS4A 3CC2P 1VQLP 3CCVP 1RO0A 1PEOA 3WBHA 5BS1A 2PENA 1YITP 2Z44A 5F2NA 3HZQA 3DS2A 2PEKA 5F2OA 2Z45A 1IUQA 4COPA 1S72P 2OTJP 4IPYA 3DS0A 1Q82Q 2OTLP 2BUOA 1K30A 3E2DA 1YJ9P 3CCUP 1VQ9P 2LF4A 3CCEP 1VQ6P 2KODA 3P05A 2PEMA 3NTEA 1K8AQ 4PH1A 1AUMA 5F2KA 2OARA 3H4EA 1VQNP 1PEMA 3CMEP 3DPHA 3CCJP 3CCSP 1Q86Q 1KD1Q 3CMAP 1YI2P 2EG5A 1M6NA 2P9XA 2XV6A 2EIAA 2PEOA 3H0DA 2XT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM P;  1S72 P;  1K9M Q;  2OTJ P;  3CCL P;  1Q7Y Q;  3I55 P;  1Q82 Q;  2OTL P;  3CCM P;  3G4S P;  1QVF O;  3CXC O;  3CPW O;  3G6E P;  1W2B O;  1YJ9 P;  3CCU P;  1YHQ P;  1VQ9 P;  3CD6 P;  1K73 Q;  1M90 Q;  1KQS O;  1JJ2 O;  3CCE P;  1VQ6 P;  3I56 P;  2QEX P;  1K8A Q;  3CC4 P;  1NJI Q;  3CC7 P;  1M1K Q;  1VQN P;  1QVG O;  1VQ7 P;  1YJN P;  3CCQ P;  3CCR P;  1Q81 Q;  3CME P;  3CCJ P;  3CCS P;  3OW2 O;  1VQK P;  1VQP P;  1VQ5 P;  1KC8 Q;  2QA4 P;  1VQ4 P;  1VQ8 P;  3CC2 P;  1Q86 Q;  1KD1 Q;  3CMA P;  1YI2 P;  1VQL P;  3CCV P;  1YIJ P;  3G71 P;  1YIT P;  1VQO P;  1YJW P;  1N8R Q; 
#chains in the Genus database with same CATH topology
 2JDI H;  3CE7 A;  1KLP A;  1NAY A;  2IPP A;  1SFC C;  2N5H A;  2CQ8 A;  5AW0 B;  5APY A;  1SQB K;  2KG8 A;  3BRT B;  3KZI E;  1DH3 A;  3DS3 A;  2OYI A;  1ZRT E;  5H2F H;  1RE4 A;  4ASW A;  2M3B A;  1D7M A;  3TDK A;  2JO0 A;  2B9B A;  3F5H A;  2BEQ D;  4L74 A;  3L71 J;  1VQK P;  2IDB A;  3OW2 O;  2QA4 P;  3BAS A;  4JQ0 D;  2WPQ A;  3HD7 A;  1A43 A;  2POH A;  1BCC D;  1DD4 A;  2KS1 A;  3CCM P;  1PEU A;  2R3C A;  1URQ D;  3GF3 A;  3PHL A;  2QM7 A;  4L73 A;  3G29 A;  5HGL A;  3H32 A;  2ZXE B;  3HTK A;  2NPS D;  5KJ7 C;  4EIJ A;  1P84 I;  3CCV P;  5BS1 A;  3WMM 0;  3CX5 E;  1E5W A;  3DS2 A;  2PEK A;  1ZRT D;  4IPY A;  2CK3 H;  5HVC A;  3E2D A;  2QNW A;  3V4Q A;  4MN4 C;  1SQQ J;  5AVQ B;  3NTE A;  5CCH A;  3A5T A;  1FDI A;  4I7Z B;  3L37 A;  3BVH A;  5AVT B;  4I1L A;  3PJS K;  2LML A;  4GKG A;  2EG5 A;  4TT3 H;  1HTL C;  2E75 D;  2W6A A;  3H1H E;  1YJW P;  2CPB A;  1NU1 G;  2C0X A;  1EZV D;  2QVA A;  3L71 G;  1SQX J;  3HYB A;  1SFC D;  3M1M A;  2KOP A;  3VMA A;  2Y0C A;  1YTZ T;  5GTI E;  2BQ1 E;  2AFE A;  3NTN A;  2QE7 H;  4IL6 X;  1VQM P;  2XNX A;  2NRG A;  4K35 A;  2AFD A;  2JEE A;  3MUD A;  2G8Y A;  4DZO A;  3T97 A;  3GG2 A;  1Q2N A;  2OGU A;  2K5X A;  2WQY C;  4KJM A;  2H8P D;  4RKU J;  3AE8 C;  2FYU K;  1SQQ G;  2KZI A;  1EDL A;  3H1H D;  1JB0 J;  3G4S P;  1HJB A;  3G6E P;  1KYO E;  2MKV A;  1CI6 A;  3MTU E;  1PP9 J;  5AVU B;  1HY8 A;  5DCK A;  1RF1 B;  3DS4 A;  5KJ7 D;  1SQX G;  5F2N A;  4PWV B;  2Z45 A;  2B87 B;  5AVX B;  2FYN B;  2YKP A;  1EDJ A;  4PXH B;  2KXP B;  2ZT9 C;  3AEE C;  4PH1 A;  3M0D A;  3P8M C;  3VMX A;  2KOS A;  1OW7 A;  3O6Q A;  1RY3 A;  1LTS C;  2OYI C;  4L76 A;  2XT1 A;  2P1J A;  1CZQ A;  2E76 C;  1RE4 C;  1GW4 A;  3V6I A;  2GUV A;  1KQS O;  2DW3 A;  1KYO D;  3FGA D;  3MD0 A;  2LXC B;  4NEO A;  3FXD A;  1NTM K;  2L91 A;  4D6T E;  2N1T A;  3HRN A;  4MRT C;  3CX5 I;  1ZW0 A;  4K3A A;  1DEB A;  4QMA A;  2M8P A;  4WY4 A;  3HD7 C;  1PEQ A;  3BCC E;  2FAC A;  1PP9 G;  2PEQ A;  4IFM A;  4EOT A;  1NTZ J;  1KIL B;  2M8L A;  4F37 A;  1XTC C;  2HPC B;  2I8D A;  3CL3 D;  1FAV A;  1SQB E;  3TK1 A;  1VKU A;  1DV5 A;  1FZC A;  3WUT A;  3RL0 C;  1A02 F;  2FQ1 A;  1A02 J;  1FZB A;  2KOG A;  3ITK A;  2V7Q H;  1FZA A;  5CCH C;  1M1K Q;  3IN6 A;  3VYI A;  1LNQ A;  1CEI A;  2YIU C;  4D6T D;  5H2F E;  1RE3 A;  2GDW A;  2C9L Y;  1R5S A;  5CMZ A;  1S72 P;  2OTJ P;  2GZI A;  3BCC D;  3RGU A;  2N5I A;  1PV3 A;  2ZT9 D;  1T3U A;  1SQV K;  2V4H A;  3P05 A;  3V2R A;  1NTZ G;  4JYC A;  3U1A A;  1SQB D;  2PEO A;  3H0D A;  1JY3 O;  2E76 D;  3GHG A;  3H1K E;  3WU2 H;  1DEE G;  1G2C A;  1QRJ A;  3MUD C;  1IFM A;  1ZMB A;  1N73 A;  1FOS F;  1IMQ A;  2WTY A;  2DNW A;  3GLM A;  4JYB A;  2YNY A;  3M9B A;  2JYG A;  3Q20 A;  1GW3 A;  5C39 A;  3HD7 D;  4OGQ C;  1N8R Q;  1IK9 A;  1T8Z A;  3L74 E;  1E6J P;  2BCC E;  2ZFC A;  2FXP A;  2J58 A;  4YXD C;  5EW5 E;  4IFF A;  1JM0 A;  3H1L E;  5APX A;  3II6 A;  1ZNV A;  4C7N B;  1OW8 A;  1EIA A;  1E0H A;  2N98 A;  1LT9 B;  3R4Y A;  1VHN A;  2YKQ A;  3DS1 A;  4A7P A;  3G1G A;  1A8O A;  1LWU B;  4HKZ H;  2W90 A;  2P58 A;  4DJG A;  3RL0 D;  1UJZ A;  3I55 P;  3O8Z A;  1AJY A;  2D2C B;  3H1K D;  1FZF A;  1KQG B;  4YXW H;  1OMI A;  2IYO A;  5CCH D;  3CLQ A;  5AVY B;  3M0D C;  2JR8 A;  1Q81 Q;  1X0T A;  4B86 A;  2KGA A;  1BCC G;  4COP A;  2FYU E;  1YQ3 C;  3AEC C;  2E74 B;  1JY2 O;  2QG4 A;  2BCC D;  2VRS A;  1SQP K;  1VQ6 P;  3H1L D;  2L22 A;  2O1K A;  1M57 D;  2N1T C;  1NOH A;  3CMA P;  2HR3 A;  1LTJ B;  4WY4 C;  3W67 A;  2E43 A;  5BU5 A;  5TJH A;  2W27 A;  3CPW O;  2OYH B;  2FQ0 A;  2HOD A;  1W2B O;  3QH9 A;  1GXG A;  3H1H J;  2M5A A;  2VLQ A;  2KUB A;  4PV1 B;  3TSI A;  3EJB A;  4XFJ A;  5JPA A;  3LRY A;  1KN7 A;  3G1I A;  1ZN5 A;  3AE1 C;  3B4Q A;  1S2E A;  3DS5 A;  4OGQ D;  1FZC C;  2FYU D;  2K9Y A;  2XZR A;  2WT7 A;  2GDY A;  3EFG A;  2O01 N;  4H44 C;  2UWJ E;  2Z4E A;  1N7S B;  3MP7 B;  3P32 A;  2Y9Z A;  4DCK A;  2ZVO B;  4L75 A;  1RE3 C;  2N6Z A;  2WSF H;  4IOI H;  1EQ7 A;  1LJ2 A;  4OVN F;  3G3Z A;  7CEI A;  4JBZ A;  1OIP A;  1M90 Q;  2K9J A;  2Y9Y A;  3GZM A;  1T2K C;  3L36 A;  2FXO A;  1JTH B;  1S5L X;  5F2O A;  3H1H G;  2FAE A;  2FYZ A;  2MR7 A;  1NYH A;  3GHG C;  2ZXX A;  3OA7 A;  1H88 A;  1JMM A;  2JQ4 A;  1N73 C;  2HLO A;  1EXJ A;  3HE4 A;  2N1T D;  4RES B;  1HF9 A;  4XA4 A;  4RJT A;  1KB9 H;  2EIA A;  4WY4 D;  4H0L C;  1EMV A;  2AEF A;  2W8Z A;  5DJT B;  2O3J A;  3CXC O;  4NPF X;  4Y28 J;  5HGM A;  4HKG A;  3RK2 B;  1L2P A;  1J1D C;  3NY7 B;  2BEZ F;  1SQV E;  1L0L E;  3RL0 g;  1VQP P;  3V2Q A;  3Q2Y A;  1SLQ A;  1E79 H;  1LP1 B;  3H6P A;  2YXQ B;  3AE3 C;  3DTJ A;  4WWI A;  2MVU A;  3H1J E;  3P8C E;  4WVZ A;  3L73 E;  2E74 C;  4D6T J;  4BRY B;  4XFY A;  3MGE A;  4GIF A;  2FKW B;  1SP4 A;  4GR6 A;  3BCC J;  2ZYA A;  4H44 D;  3V5B A;  3RBX A;  1YYC A;  1L0N K;  5CHX A;  1KFN A;  3CC7 P;  1U7J A;  3Q1M A;  4U3F E;  3WU2 E;  1SQB J;  2P67 A;  3BRV B;  5HGN A;  3KQG A;  1T2K D;  1SQV D;  1KC8 Q;  1L0L D;  3AE2 C;  1FBM A;  4XE5 B;  1PEO A;  1NU1 K;  1UNK A;  4W80 A;  2FY8 A;  2KLU A;  2YO2 A;  5GTH H;  1IO4 A;  1PZQ A;  3JCU H;  3P8C D;  2H7H A;  1BE3 E;  2BUO A;  2R44 A;  2XKM A;  1VQ9 P;  2B89 A;  3C1L A;  1M1J B;  3M9Q A;  2QJK B;  4D6T G;  1M6N A;  2QJY B;  4H0L D;  3BCC G;  2O1J A;  1NTK E;  2I1J A;  4ASV A;  1VF5 B;  4U3F D;  3H47 A;  3D70 A;  1SQP E;  3LMO A;  2LPK A;  1H89 A;  1PGJ A;  3H1K J;  4ZKP A;  2Q9I A;  1SQB G;  1W2E A;  2QJP C;  2H89 C;  2MF4 A;  1AA0 A;  1YIJ P;  2JJL A;  2M8N A;  3EJE A;  3VRL C;  2E74 D;  3OAK A;  1PGQ A;  3E1R A;  2K37 A;  1BE3 D;  1K73 Q;  2WZ7 A;  3FWN A;  5E79 H;  2KOR A;  4KT0 J;  4DOJ A;  3ZDM A;  3L74 J;  2BCC J;  5AW9 B;  5KLI C;  3KDP B;  3CXH H;  1JEK A;  3RK3 B;  3H1L J;  1D1D A;  2KI7 B;  3CC4 P;  3CX5 D;  1NTK D;  2EFJ A;  3RG2 A;  1JUN A;  2XDJ A;  1YBK A;  3C8V A;  3CI9 A;  1J1E C;  2CG5 B;  2WPS A;  1AQ5 A;  1RF1 A;  1GZL A;  2OTK E;  1IFD A;  2Z5H A;  2B87 A;  3WUV A;  1Q82 Q;  2OTL P;  3AE9 C;  2LIW A;  1PGO A;  4IL6 H;  3H1K G;  1AUM A;  5F2K A;  2FYU J;  3H4E A;  1PEM A;  3VMZ A;  5KAF H;  2IBZ E;  1GPJ A;  1OVU A;  2R5B A;  3KYQ A;  1QL1 A;  2KOO A;  3L74 G;  2BCC G;  3CD6 P;  3NMD A;  1IMP A;  2XV5 A;  3H1L G;  1X8Y A;  3LW5 H;  4U0A A;  5AW3 B;  4ZNC A;  2M5R A;  1IFN A;  5AVR B;  3USS A;  5KP6 B;  2I1K A;  3D71 A;  4DT0 A;  3FWL A;  2XXM A;  3GW6 A;  3UIA A;  1YHQ P;  2JAZ A;  1KIL A;  1HJ0 A;  2QEX P;  4R4L A;  1AFO A;  3WUU A;  3CCR P;  2ITA A;  2HPC A;  1KB9 E;  2FVA A;  3U1C A;  1ZR2 A;  1QVG O;  3GF7 A;  2FYU G;  4H13 B;  3KXD A;  3L72 E;  3IF4 A;  4BPH A;  1QVF O;  2KWL A;  1GL2 B;  3VP8 A;  5B5E H;  1LTA C;  1DIP A;  3Q3D A;  1NTZ K;  2NZ2 A;  3EWK A;  1QEX A;  5KAI E;  3V4W A;  1QGK B;  2MVV A;  1FJK A;  4I7Z C;  1CSB A;  5BS2 A;  1G1J A;  2SPZ A;  1GMJ A;  3MIW A;  2JU1 A;  1L0N E;  2Z44 A;  2R32 A;  3GMA A;  1Y8A A;  1U7M A;  2R5D A;  1K30 A;  2KR5 A;  1YJ9 P;  3CCU P;  3PP5 A;  1NWQ A;  1R8E A;  1JO5 A;  5L8R J;  2JWD A;  2K92 A;  1JOC A;  1KB9 D;  2IZ0 A;  1S3J A;  2P9X A;  3F89 A;  1Z6M A;  2FVF A;  1NU1 E;  4EDF A;  3AEA C;  1ZME C;  2M0B A;  2W83 C;  3GJN A;  4UHP B;  1JJ2 O;  3NFQ A;  2KIK A;  2Q6Q A;  1OVR A;  2A45 H;  5AW5 B;  3R2P A;  2LKM A;  3TGU E;  3CCQ P;  3JSV C;  3L70 E;  3G26 A;  4NPD A;  3NXS A;  2KG6 A;  2V7Q J;  5EFW B;  5GTH E;  2ZAE B;  1L0N D;  3JCU E;  4TLF A;  3SWK A;  1SQV J;  1FJP A;  1L0L J;  3LID A;  2VLO A;  4U0D A;  4LC1 A;  3GKL C;  2K0X A;  1MUU A;  1HGZ A;  4C7N A;  1JMB A;  2IBZ I;  4GT1 A;  3H1J J;  2ROQ A;  3G21 A;  1S9K E;  1LT9 A;  1OVV A;  3L73 J;  2XZ0 D;  1RF1 C;  2WSE H;  3M06 A;  1LWU A;  4U0E A;  2HFE D;  2E42 A;  4GOE A;  4BXL A;  3A3Y B;  2E5Y A;  1KQF B;  1Y9B A;  4NPE A;  4OWF A;  2FYN C;  2E1M A;  1IFJ A;  2GUS A;  2J59 M;  3G0V A;  5APW A;  2YXR B;  1H0T B;  3L35 A;  4U3F J;  2ERH A;  5APU A;  1WRG A;  2KK7 A;  1HGV A;  1VQ5 P;  4YTP C;  3TGU D;  4ZMD A;  1BDD A;  1UIX A;  3L70 D;  1VL2 A;  2N9B A;  1ZV8 A;  1URQ B;  1Y47 A;  5E79 E;  5KLV K;  2GZJ A;  1KB9 I;  3CXH E;  1OWA A;  1SQV G;  3A0B H;  2NPS B;  1BE3 J;  1L0L G;  1S9K D;  3VTP C;  1EXI A;  1LTJ A;  3IFM A;  3L73 G;  4WB4 A;  3L74 D;  2OYH A;  1RO2 A;  2K1A A;  1KIL C;  5KKZ B;  3V2P A;  4GOF A;  2QIW A;  4YPC A;  4XRO A;  1NTK J;  4EYY Q;  4QNB A;  2WVR A;  2B88 A;  2L5G B;  1H8A A;  2E75 B;  5KP8 B;  2KLV A;  1LTG C;  1HH0 A;  1ZR4 A;  1HBW A;  1U57 A;  1JY3 P;  1OFC X;  4IL6 E;  4U3F G;  2AXT H;  3B8E B;  2WSS H;  4XRQ A;  2MY5 A;  3VP9 A;  2IFM A;  5KAF E;  5CJ4 A;  1NQ4 A;  4HYT B;  2OYO A;  3CXH D;  3CWB E;  1N7S A;  2WSC H;  3B5N B;  1AVO A;  1IC2 A;  2GA1 A;  3AE4 C;  2PGD A;  1EC5 A;  2K2Q A;  1L0H A;  1BE3 G;  2R3S A;  1KIL E;  2W6J H;  3G9R A;  1QL2 A;  1UII A;  2WPV B;  3HE5 B;  1YJN P;  4Y99 B;  2CWO A;  3CC2 P;  2H43 A;  1NTM E;  1VQL P;  1JTH A;  2O01 H;  3P7K A;  3DS0 A;  1NTK G;  2EHT A;  3M0A A;  3JC2 2;  1HWT C;  4UB8 H;  3CCE P;  3PTZ A;  2KOD A;  3A0H H;  1K8A Q;  5AVW B;  3VOP A;  2J5U A;  5CZD B;  1KZU B;  2K94 A;  1Q86 Q;  1J2J B;  3CWB D;  1HUC A;  2XV6 A;  2PFX A;  1AV1 A;  1JY2 P;  3SWY A;  5B5E E;  3MZW B;  4WBA A;  4R0M A;  2CPS A;  1R5L A;  1MFZ A;  1AVY A;  3IR9 A;  3RG6 C;  1ZP0 C;  4OH8 B;  1KIL D;  2WSF J;  2A06 E;  5CCG A;  4U7J A;  1NJI Q;  3TYY A;  1AYI A;  1K04 A;  3TNU A;  1LT9 C;  1LGH B;  1LP1 A;  1LWU C;  2KSJ A;  4JF7 A;  1NTM D;  1JCC A;  2K0Y A;  1S5L H;  2GM4 A;  1ACP A;  5APQ A;  4BRY A;  2D2C C;  1FR2 A;  3S9O A;  1FZG A;  2GYK A;  2GZF A;  3CXH I;  2QSI A;  4ZKU A;  1BXI A;  4BPG A;  3TNU B;  3D6Y A;  1N86 A;  3H25 A;  2RKL A;  4R4M A;  1KTM A;  3EFF K;  2LL8 A;  3G71 P;  3N7N A;  2EHS A;  3KPE A;  2ZYG A;  5I4T G;  1NAF A;  4BPF A;  2A06 D;  3L72 J;  1KFM A;  2XND H;  1BDC A;  2RMZ A;  1BCC E;  1GK4 A;  4PD4 H;  1Q90 D;  1T3J A;  5APS A;  4W7Y A;  1BSN A;  2FBW C;  5KTB A;  2FFD B;  1LTJ C;  3EJD A;  2VLN A;  2LKI A;  4IFD K;  2OQQ A;  4JPZ B;  2LF4 A;  2OYH C;  4W7Z A;  3W68 A;  1L0N J;  2GDX A;  1HVV A;  3B4S A;  1M1J A;  1VQN P;  1G1I A;  4UB6 H;  1IFP A;  1NO4 A;  1MZ9 A;  4PV1 C;  3CCJ P;  4H2Y C;  3PH0 A;  1M7L A;  1PPJ E;  4BWN A;  3B5N C;  2L0Q A;  4LLH A;  1GXH A;  1IJD B;  4LGD E;  3H1J D;  2ZT9 B;  3L73 D;  4DG9 A;  3H1I E;  1IFI A;  5KLV E;  2KOQ A;  1NU1 J;  4PH0 A;  4Y99 C;  2C0W A;  2PRR A;  3L75 E;  2OYI B;  4H2W C;  1N7S C;  3G28 A;  4I2L C;  1USD A;  1PFI A;  2FAD A;  1VQO P;  2E76 B;  4H2X C;  2ONT A;  1EZV E;  1K9M Q;  2K0D X;  3TGU J;  1FC2 C;  2Q3E A;  3L72 G;  2KB7 P;  3L70 J;  2D2C D;  4CA3 A;  3VN0 A;  2K3R A;  2JP3 A;  4PJ0 H;  3A0B E;  1M74 A;  2KP8 A;  1SQQ K;  1VQ4 P;  2PEJ A;  2FVE A;  1NVO A;  5AW2 B;  2AEJ A;  1DD3 A;  3HD7 B;  5AW6 B;  2QM8 A;  1PPJ D;  1L0N G;  2IX7 C;  2Z46 A;  1GTW A;  3AEB C;  1TU3 F;  2KS1 B;  1DX7 A;  1EOQ A;  2W6B A;  2KW2 A;  1EDI A;  2M3E A;  3H1I D;  2CGQ A;  1SQX K;  3H32 B;  4U0B A;  2JWA A;  2PAJ A;  5KLV D;  3LIE A;  3HTK B;  1BGY E;  1RO0 A;  2LR2 A;  2PEN A;  3L75 D;  5DJU B;  1X22 A;  3U59 A;  1EDK A;  1GK6 A;  3RL0 B;  2AXT E;  3N4X A;  3FXE A;  2PP6 A;  3RK2 C;  2WPT A;  4HJG H;  2GZE A;  5CCG C;  2YIU B;  1SQP D;  4PV1 D;  3TGU G;  1NHL A;  3L70 G;  5CJ0 A;  3B5N D;  2KGC A;  1S4X A;  3Q5P A;  2YKO A;  2ZVN B;  1NGM B;  3CCL P;  2WMM A;  2LIU A;  2A45 I;  1DNY A;  1ZOY C;  1USE A;  4C7R A;  1NKN A;  4M0I A;  3AE6 C;  3GZL A;  4GOD A;  1N7S D;  2KGD A;  4RO0 A;  2VSQ A;  1BGY D;  2P7J A;  3V2N A;  2PEI A;  4KHX A;  3IAO A;  2FFD C;  4UB8 E;  3SFD C;  3S4R A;  4EI2 A;  5EJD A;  3PRJ A;  5BU8 B;  3A0H E;  2LXB A;  3T97 B;  1OR5 A;  3AE5 C;  2Q5U A;  1RF0 A;  4OGQ B;  4Z1M H;  2ZJS E;  1F80 D;  2DGY A;  2H88 C;  1GU5 A;  3AEF C;  1GL2 A;  3CWB J;  1CI6 B;  1KQL A;  2PY8 A;  2BHV A;  1YTZ I;  3Q5S A;  4U0C A;  1WT6 A;  1L4A A;  4GR2 A;  1M1J C;  2LOL A;  3K5B A;  2ZYD A;  1VQ8 P;  2QJK C;  5APT A;  1EZV I;  2IBZ D;  3LW5 J;  3KHU A;  1S5L E;  2AXC A;  2QJY C;  3HUS A;  2IZ1 A;  1P84 H;  5CBN A;  1VF5 C;  1LT1 A;  1NTM J;  3RK2 D;  1GU4 A;  1AQT A;  3L4F A;  5CCG D;  1L4A B;  5B66 H;  3O6Q B;  2K93 A;  2KGE A;  3AEG C;  1FDO A;  2Z5I A;  3SWF A;  1S1C X;  3HUS B;  2FXM A;  3PLN A;  2WIT A;  5TIS H;  3AED C;  2N1T B;  4HH2 A;  2N9Y B;  3I5C A;  4PD4 E;  3CWB G;  2PNG A;  4WY4 B;  1ZLL A;  2JKV A;  3RK3 C;  3VMY A;  1Q7Y Q;  3L71 E;  2IFN A;  2FQ2 A;  1IK7 A;  3L72 D;  3D6Z A;  1OZH A;  5HGO A;  4UB6 E;  1FU1 A;  2MJZ A;  2QRX A;  2IYP A;  2JBG A;  1XTG B;  1FS0 E;  4I6M C;  3SFE C;  1NTM G;  1FZC B;  1RH5 B;  3BAT A;  4N6J A;  1BAJ A;  5KP7 B;  1LTB C;  1X79 B;  2Q1K A;  3E7K A;  5AW4 B;  2X2B A;  3C9I A;  1FE6 A;  1N2D C;  3A7O A;  2K88 A;  1QLE D;  1L0L K;  4H44 B;  3E1I A;  5AW7 B;  1H0T A;  3S1K A;  1AF8 A;  2BAS A;  3RK3 E;  3KZI H;  1SQQ E;  3WBH A;  4PD4 D;  1KYO I;  2CNR A;  5K5G B;  1NU1 D;  2LTE A;  1URQ A;  1VF5 D;  3L71 D;  1BCC J;  5AVZ B;  2JO1 A;  2Y0D A;  4HB1 A;  4PJ0 E;  2PEM A;  2A06 G;  3DPH A;  1VDF A;  1SQX E;  2MD9 A;  2NPS A;  4CPG A;  1PL5 A;  4GDO A;  3A2A A;  3ABV C;  3GHG B;  2N50 A;  2MR8 A;  4XFZ A;  1MV8 A;  5HV8 A;  1JY3 N;  2WSE J;  1G2C B;  1FZE A;  1RNI A;  1N73 B;  1X9V A;  2P2U A;  2JYL A;  3AE7 C;  1KV4 A;  2RN0 A;  2JB0 A;  3H1I J;  1CW5 A;  3RK3 D;  1RF0 C;  1SQQ D;  4H0L B;  2KSE A;  1BSH A;  2E5T A;  3CX5 H;  2GZG A;  5KLV J;  4O9B A;  3H1J G;  2FHS C;  4H13 C;  1SFC A;  1GL2 C;  1NH4 A;  3L75 J;  1J1D B;  1KOR A;  2AEM A;  2A45 G;  4N3Y B;  3MHV A;  1HQB A;  2KG9 A;  1W5C E;  1L4A C;  1OXZ A;  3B5I A;  1SQX D;  1NTK K;  1M6E X;  2M8R A;  3B5N A;  3TF5 A;  4U0F A;  2YMK A;  1PP9 E;  1SQP J;  1OX3 A;  3Q5R A;  3HUS C;  1QX8 A;  1JCD A;  2L6E A;  1T8K A;  2KNC A;  1SFC B;  4AQR D;  1MKM A;  3I56 P;  1IZN B;  2WPR A;  2KZJ A;  4PD4 I;  3HE5 A;  5GTI H;  3SSU A;  1JNM A;  1PPJ G;  3HZQ A;  2HYN A;  1GDT A;  2KNC B;  1JY2 N;  1T6A A;  2WWW A;  1BGY J;  3QWO C;  4C46 A;  3H1I G;  1M56 D;  2P10 A;  5KLV G;  2Y0E A;  3CME P;  3U43 A;  3CCS P;  5KJ7 A;  2L4B A;  2HG5 D;  1YI2 P;  2KYV A;  3L75 G;  5AVS B;  1RHZ B;  1LTT C;  5AVV B;  1PIX A;  1EZV G;  1MZ8 A;  1PP9 D;  2RH0 A;  3FX0 A;  2HOD B;  2WSC J;  1WMK A;  1KYO H;  3EQ2 A;  2M5A B;  2YO3 A;  3B71 A;  4N78 E;  1N7L A;  1NKZ B;  1RQU A;  1SQP G;  1VQ7 P;  1NTZ E;  1M8O B;  1VPC A;  2AF8 A;  1Z56 A;  5M1B A;  1RQV A;  1X3O A;  1P84 E;  3M9H A;  4H13 D;  1GL2 D;  1ZXG A;  2YMY A;  2WT7 B;  2O01 J;  2NO8 A;  1FDM A;  4QKO A;  5B66 E;  5AW1 B;  5BVZ A;  2AVA A;  1L4A D;  1OW6 A;  2QJP B;  4COC A;  1LTI C;  1BGY G;  5CBO A;  4XFX A;  1GD2 E;  2XZ1 C;  1KMI Z;  2JU2 A;  1YQ4 C;  3M91 A;  5TIS E;  3MGN A;  4AYC A;  1K05 A;  2JGP A;  2L9F A;  2K9J B;  1URQ C;  5AW8 B;  1SVF A;  4N78 D;  5KLI B;  4WYM A;  4AUW A;  2G3A A;  2XU6 A;  4IZ6 A;  3RBZ A;  1NTZ D;  1MFT A;  2NPS C;  1PGP A;  1YIT P;  2Q7C A;  1IUQ A;  2N6Y A;  2FFD A;  1P84 D;  2VLP A;  1J1E B;  1L0I A;  2OAR A;  5KKZ C;  5KAI H;  3HE4 B;  1SS1 A;  2C9N Y;  1KD1 Q;  5APV A;  2IBZ G;  4M3L A;  2Q3I A;  3OJA B;  2E75 C;  1FOS E; 
#chains in the Genus database with same CATH homology
 4XFZ A;  3CCL P;  3H47 A;  3CXC O;  3CPW O;  1W2B O;  3HYB A;  3M1M A;  3CD6 P;  3RG6 C;  1KQS O;  1QRJ A;  5HGM A;  1RNI A;  1RO2 A;  1JJ2 O;  1ZMB A;  1NJI Q;  4M0I A;  2JYL A;  4XRO A;  4U0A A;  1VQ7 P;  5JPA A;  3CCQ P;  4QNB A;  4PH0 A;  2BQ1 E;  1VQP P;  3G26 A;  3LRY A;  3DS3 A;  2JYG A;  3Q20 A;  3G1I A;  3DTJ A;  1YIJ P;  3G28 A;  2M8P A;  1VQO P;  3DS5 A;  2PEI A;  2ONT A;  1N8R Q;  1PEQ A;  2M8N A;  1VQM P;  1K9M Q;  3VRL C;  1E6J P;  1Q7Y Q;  2PEQ A;  2XXM A;  4U0D A;  1YHQ P;  2M8L A;  2JO0 A;  4XRQ A;  1K73 Q;  4XFY A;  2QEX P;  5HGO A;  3MGE A;  1EIA A;  4GR6 A;  1M74 A;  3G21 A;  3CCR P;  3DS1 A;  4COC A;  1VQK P;  3OW2 O;  3G1G A;  1VQ4 P;  1A8O A;  2QA4 P;  3B5I A;  2PEJ A;  4U0E A;  1YJW P;  1M6E X;  4XFX A;  3G71 P;  1D1D A;  1A43 A;  4U0F A;  1QVG O;  3CC4 P;  3CC7 P;  2DGY A;  1BAJ A;  2Z46 A;  3I55 P;  2L6E A;  1EOQ A;  3CCM P;  3G4S P;  1QVF O;  1PEU A;  2EFJ A;  2E1M A;  3G6E P;  1M90 Q;  2PY8 A;  2BHV A;  3G0V A;  5I4T G;  3I56 P;  4U0C A;  3G29 A;  1M1K Q;  4WYM A;  5HGL A;  4U0B A;  4GR2 A;  5DCK A;  5HGN A;  1YJN P;  1Q81 Q;  2CWO A;  5BS2 A;  1VQ5 P;  1KC8 Q;  1VQ8 P;  3DS4 A;  3CC2 P;  1VQL P;  3CCV P;  1RO0 A;  1PEO A;  3WBH A;  5BS1 A;  2PEN A;  1YIT P;  2Z44 A;  5F2N A;  3HZQ A;  3DS2 A;  2PEK A;  5F2O A;  2Z45 A;  1IUQ A;  4COP A;  1S72 P;  2OTJ P;  4IPY A;  3DS0 A;  1Q82 Q;  2OTL P;  2BUO A;  1K30 A;  3E2D A;  1YJ9 P;  3CCU P;  1VQ9 P;  2LF4 A;  3CCE P;  1VQ6 P;  2KOD A;  3P05 A;  2PEM A;  3NTE A;  1K8A Q;  4PH1 A;  1AUM A;  5F2K A;  2OAR A;  3H4E A;  1VQN P;  1PEM A;  3CME P;  3DPH A;  3CCJ P;  3CCS P;  1Q86 Q;  1KD1 Q;  3CMA P;  1YI2 P;  2EG5 A;  1M6N A;  2P9X A;  2XV6 A;  2EIA A;  2PEO A;  3H0D A;  2XT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...