1NJIQ

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1njiQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1njiQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1njiQ03
1VQLP 1VQNP 1VQ8P 3I56P 3OW2O 1KC8Q 1S72P 1VQ4P 3CXCO 1K73Q 3CMEP 1YJNP 2QEXP 3CCSP 1VQ7P 3CPWO 3CD6P 2OTLP 1YHQP 1YIJP 3CC4P 3CMAP 3CCRP 1VQPP 1YJ9P 1QVFO 3CCEP 1VQ6P 3CCUP 1YI2P 1NJIQ 1K9MQ 1VQMP 1N8RQ 1K8AQ 1M90Q 1Q82Q 1VQKP 3I55P 1VQOP 1Q86Q 3CCJP 1VQ5P 1YJWP 3CC2P 3CC7P 3G71P 3G6EP 1KD1Q 3G4SP 1QVGO 1YITP 1W2BO 1Q7YQ 3CCVP 2QA4P 3CCQP 1VQ9P 1KQSO 3CCLP 1Q81Q 3CCMP 1JJ2O 2OTJP 1M1KQ
chains in the Genus database with same CATH superfamily
2XZ0D 2W27A 1DH3A 3L73D 3KXDA 5TJHA 2GM4A 1FZBA 2B89A 1JY2O 1PZQA 1S5LE 4KHXA 1HJBA 2M5AB 2AEMA 2XZRA 5AVTB 3D70A 1CW5A 1YHQP 3SWYA 2PEJA 1NTMG 4HJGH 3H1JE 3RK3D 1ZR4A 3CX5I 1N8RQ 3SFEC 1DX7A 1J1EC 1EZVI 3W67A 2QE7H 5APVA 4N6JA 3HTKA 1EZVG 3EFFK 1JCDA 1VQ9P 1IUQA 5GTIH 4M0IA 2OYIB 3LW5J 5CHXA 1GTWA 2CPBA 3KZIH 3F5HA 2AFDA 5B66H 1XTGB 2M3BA 3PJSK 3H1LJ 1BE3J 4DT0A 4U3FG 2XZ1C 2R5BA 5KLIC 3UIAA 1MZ9A 2FAEA 1L0LE 1OFCX 1Q2NA 1U57A 2O01H 2V7QH 4U0CA 2K9YA 2CNRA 3TGUG 3A7OA 2IBZG 1VQ7P 3PH0A 1FZEA 4Y99B 5APTA 1OX3A 2L4BA 5AVSB 1PIXA 1RF0A 2H8PD 2YIUB 1VQ5P 1BE3G 3DS1A 2OYHA 3OAKA 2BCCE 2E75B 1VQ4P 2LMLA 1FOSE 2OTLP 2L9FA 5AW0B 3M06A 1PPJG 3HD7C 2P2UA 1RF1C 2Y9ZA 1QL2A 1ZLLA 3H1IJ 1NU1G 2RN0A 2BUOA 2Z46A 4PV1D 4HYTB 1R5LA 2O01J 2RMZA 1N7LA 4U0FA 3AEFC 4WY4C 4IFFA 2I1KA 3GG2A 4ASVA 2GYKA 1VQOP 2ZVOB 3TNUB 3P8CE 2PY8A 1PEQA 3HD7B 2WZ7A 3B5NB 3CL3D 2N1TD 2KOPA 1NU1K 5CJ0A 5AVQB 3A5TA 1M1JA 2WSCJ 3EJEA 1K9MQ 4F37A 5KLVE 2PEMA 3B8EB 3H32B 3RG6C 3AEDC 5KJ7A 4PJ0E 1PV3A 2R3CA 3CC2P 1T2KC 5CCHA 2HODB 2K0DX 4PD4E 1YTZT 1HH0A 1RF1B 1M1KQ 1SQVG 1A43A 1CSBA 3L70J 4EIJA 1IZNB 3HE5A 3B4QA 5TISE 3S1KA 1EOQA 1NTZD 1HGVA 4LGDE 2KOGA 2JO0A 3MTUE 1VQMP 2BCCJ 4U0DA 4U3FJ 4XRQA 2JB0A 5B5EE 3G71P 2FYZA 3A0HE 1Q90D 1BE3D 5F2OA 2FFDA 1VQLP 1OW8A 3RK2B 2AXTE 1IMPA 2KODA 2NRGA 5DJTB 4XFJA 3L73E 4H0LD 4RJTA 3P7KA 3PRJA 4IL6E 1DNYA 1KYOI 2WPRA 1SQQK 1N7SD 2A45I 3U1CA 2E76C 4H13B 1LTGC 1RE3A 1BGYJ 2NPSC 2W6AA 2FQ0A 1FC2C 3H1JG 1IFNA 1RY3A 2I1JA 2FYUE 1NH4A 4HB1A 2XKMA 3HUSB 4GT1A 2IBZD 1XTCC 3Q5SA 1N73A 5GTIE 4COPA 4XFXA 2E74D 1QL1A 1RO0A 1JOCA 2XNDH 4UB6E 1AV1A 3R4YA 2JYGA 2PENA 1M90Q 5AW5B 4OGQD 2C9NY 1N73B 2W90A 2MVVA 1PGPA 2YMYA 2P1JA 1VL2A 3JC22 3IAOA 1OZHA 2QIWA 2MJZA 1SS1A 1S3JA 1AQ5A 1FU1A 1VQPP 1N86A 5C39A 1NJIQ 1NWQA 2KORA 1IFDA 1S2EA 3C1LA 1QVGO 1HTLC 3AEBC 4H2YC 2Y0EA 5AVXB 3G0VA 5CCGA 1X3OA 5APXA 2HPCA 1LWUB 3JCUE 4IPYA 1EQ7A 2VLQA 3L70D 1KYOD 1LTJC 1VQKP 2O3JA 2GDWA 4CA3A 3H1HG 1L2PA 1PEMA 4WB4A 2Z45A 1SLQA 3GKLC 1DD4A 1SQPD 4D6TD 1SQVK 4U7JA 4L74A 1HBWA 3M0DA 1LTBC 2N1TC 1LT9B 1FZCB 4JF7A 1L4AA 4UB6H 3P8CD 2KWLA 2Q9IA 4JYCA 1SQBE 1RQUA 1FDOA 3NMDA 3H1KE 3V5BA 4PV1C 1HQBA 4WWIA 4D6TG 1IFIA 1EC5A 3VMYA 1IO4A 3AE4C 1BGYD 1NYHA 4BPHA 2IPPA 1FS0E 3AECC 2ZXEB 3F89A 1CEIA 2N9BA 1NTKG 3FX0A 2MR8A 1P84E 5CBNA 2B87A 2FYUG 1SQQD 3VP8A 1SQBD 3JCUH 1URQC 2IYOA 3M0AA 3WUVA 4ZNCA 5KAIH 1KFNA 3G9RA 1PPJE 2KUBA 3M91A 2QG4A 4YXDC 3DS2A 1GXGA 4W80A 1E0HA 1GK4A 4EYYQ 4IL6X 2E5YA 2JWDA 4I7ZB 3V2RA 1L0LJ 3BATA 4A7PA 3RK3B 3H25A 3MUDA 1ZW0A 3AEEC 1USEA 1FE6A 3OJAB 4HKZH 3H1JJ 4PD4H 3WU2E 4MN4C 4L76A 2W6JH 2IZ1A 1SQQE 1JTHB 4RO0A 3EWKA 1PL5A 3RK2D 4DG9A 1HWTC 2M3EA 3H1KJ 1LTAC 1F80D 1RNIA 4IFMA 4R4MA 1J2JB 1WRGA 4H2WC 1LTIC 3CLQA 4ASWA 2KNCA 1LP1B 1LJ2A 4UHPB 5EFWB 2K94A 3CXHI 1VPCA 2L0QA 2LTEA 2FVEA 3CCRP 1FAVA 2PEOA 1SQPJ 3HE4A 3CXHH 3AE2C 2K9JA 1N7SA 4C7NB 2D2CB 5APSA 2I8DA 4QNBA 3CCLP 2KLVA 4BRYA 2CQ8A 5BVZA 2K5XA 3G1GA 3VYIA 3GF7A 1G2CA 3BVHA 5HGOA 1JMMA 2K92A 2OARA 3RK3C 2RH0A 3EQ2A 1E5WA 5M1BA 1RQVA 2MKVA 4R4LA 1FDMA 4W7ZA 2MY5A 2VLNA 1SQVD 3CX5D 1NTKJ 2N5HA 1NTZK 2JGPA 1JY3O 3DTJA 4H44C 1RF0C 3A0HH 5KKZB 2Q6QA 2OQQA 2ONTA 2LIWA 2JJLA 4WYMA 1U7JA 1KQGB 1RE4C 2KS1B 3GF3A 4U0BA 3L70E 3Q1MA 1SVFA 4Y28J 3VMZA 2QNWA 2BCCD 3LIDA 5HVCA 1SQBG 3VTPC 4GR6A 5AW8B 1G1JA 2WSFH 2QJYC 2HFED 2IFNA 1G2CB 2K1AA 3AE8C 3RL0C 1VF5D 4BXLA 2QM8A 4ZMDA 4U0AA 1PP9D 2LOLA 2YXQB 3IFMA 3TGUJ 2AF8A 3CE7A 1OVVA 2PEQA 1N7SB 4C7NA 2QJPB 2N50A 2KGCA 1SQBK 1BCCJ 4EOTA 2PP6A 3CC4P 2ZVNB 2ZAEB 2ZYGA 1S1CX 5K5GB 3CC7P 1BGYE 5CCGC 2IDBA 3L75E 2YKPA 2ROQA 1GZLA 2KB7P 1GL2A 1LWUA 4QKOA 1P84I 2O1JA 2E74C 3CMEP 3Q3DA 2EIAA 3L71J 2YKQA 1ZRTE 1OW7A 3H6PA 1U7MA 4R0MA 2FYNB 2E42A 1Q82Q 3G6EP 2PAJA 1FZGA 2ZYDA 5AVYB 1LNQA 5F2KA 2E1MA 3L36A 4BPFA 1IFJA 3M9BA 5HGMA 5AVVB 2HLOA 3WBHA 2QEXP 1OIPA 3TDKA 1JM0A 3H4EA 5APWA 1S5LX 1DV5A 4PH1A 1M6EX 1HJ0A 2ZFCA 2POHA 2N9YB 1VKUA 1M6NA 3QH9A 3CCQP 2KOQA 1M56D 1X79B 5APQA 1JMBA 4YTPC 2P58A 4JYBA 2Q7CA 3E1IA 2BHVA 1K04A 3CPWO 1L0NE 3D6YA 3AEAC 2ZT9D 2NO8A 2HYNA 5L8RJ 3HUSA 2WSEH 3P05A 2BEQD 5CMZA 1BAJA 2O1KA 1Y8AA 5B66E 1H8AA 2GDYA 1SQPK 3E1RA 2FYNC 1GK6A 1AA0A 3NTNA 2WVRA 4IOIH 3EJBA 3MIWA 4XFYA 2QJPC 2K0XA 1RH5B 5E79E 3G1IA 2K9JB 2ZYAA 1PFIA 2W6BA 2B9BA 1K30A 3A0BH 1WMKA 4B86A 2GUVA 2Q5UA 1H0TB 1L0ND 3H0DA 1KFMA 1LP1A 1SQQG 3AE3C 2N98A 1EXIA 4MRTC 3AE6C 2ITAA 1BDDA 1USDA 1PEUA 1JB0J 3Q20A 2KSEA 2WQYC 5AW2B 2V4HA 1SQVE 1MFZA 1FZAA 1GU5A 1LT1A 3MGEA 1J1EB 4OVNF 5B5EH 1EXJA 4GODA 1AVOA 2P10A 2QJYB 2WSFJ 1NAYA 1Q86Q 2HODA 3V2PA 4WVZA 1SQQJ 1KD1Q 2YKOA 1W2BO 1Y47A 3V2QA 5BS1A 1VQNP 3SFDC 1GMJA 2WTYA 2YXRB 2WSSH 3HZQA 3N4XA 1NQ4A 2OTKE 2WT7A 3CCUP 3H47A 2AEJA 1T3UA 2KXPB 4COCA 2M5AA 4WBAA 3TNUA 1OWAA 2OYIC 1GW4A 2B87B 1L0HA 1SQPE 4ZKPA 1NVOA 4GOFA 3L74J 2EHSA 1OVUA 1H88A 1T6AA 1Y9BA 1EIAA 3H1IE 2YMKA 1BDCA 1M8OB 3L70G 3CX5H 2JU2A 1P84H 2D2CC 3MP7B 2OYHC 3H1KD 2K0YA 5HGLA 5AVWB 1AFOA 2L5GB 1ZR2A 1ACPA 3CXHD 4PJ0H 4IZ6A 5E79H 3N7NA 4U3FD 4WY4D 1UJZA 2CK3H 2GUSA 4PWVB 3M1MA 1GPJA 1W5CE 2KZIA 3GZLA 4IFDK 3BASA 5KLVJ 4WY4B 1NU1J 3RBZA 3L72D 4YPCA 2K88A 2Z4EA 3CI9A 2C9LY 2KNCB 2M8PA 4M3LA 4PH0A 1GL2D 4L73A 1T2KD 1IK7A 1VDFA 4KJMA 1NHLA 1PPJD 3JSVC 1JY2P 1EZVE 2JO1A 1KN7A 1X8YA 1DD3A 2QVAA 1KTMA 2L22A 1JY3N 2M8NA 2Z44A 3L74E 1L0LG 1A02F 2XT1A 1L0NK 3HTKB 1URQD 5CCGD 2W83C 4PXHB 2FKWB 2R32A 4W7YA 1DIPA 5AW1B 2WSEJ 1M1JB 2KLUA 5BS2A 2JYLA 2FXOA 4OGQC 1KMIZ 2O01N 1ZN5A 3VMAA 3HRNA 1K8AQ 2KS1A 2ZT9B 5KLVG 1NTMK 3CCVP 1YYCA 2AFEA 1DEBA 1S5LH 2SPZA 1KB9D 4D6TJ 1SFCD 1KILB 5AVZB 2JR8A 1QEXA 3ITKA 2XU6A 2GZEA 3L74D 3CMAP 2OGUA 1ZOYC 2R5DA 3LW5H 2LKIA 2CG5B 1GDTA 2X2BA 1NTKE 3AE5C 5AW4B 2G8YA 3FXDA 4BRYB 1IMQA 1IFPA 3L75G 3L35A 2FYUD 2A06D 3H1HE 3HE4B 3EFGA 3CWBG 4CPGA 3BRVB 1LT9A 2VLOA 2LL8A 4IL6H 3KHUA 4H44B 2FXPA 2A06G 3HD7D 2OTJP 2DGYA 2A45H 3OA7A 1RHZB 4L75A 4GIFA 2B88A 3RBXA 3L37A 3HYBA 2QM7A 2AXTH 1PGOA 3AE9C 3L72J 4XE5B 3P32A 2KG6A 3GZMA 1OMIA 2EHTA 2KGDA 3O6QA 3G4SP 2K93A 4UB8H 1BXIA 1H0TA 3II6A 1Q81Q 2A06E 1VQ8P 2KYVA 5KJ7C 1KC8Q 3GW6A 3D71A 5I4TG 2A45G 1URQA 1W2EA 3MZWB 2LR2A 3I55P 1KQLA 5KP7B 4XA4A 3L71E 3H1JD 1QGKB 5CCHD 2J59M 1OR5A 2JAZA 3C8VA 3CXHE 1NGMB 2M0BA 3M9QA 1SQBJ 1FJPA 3B5NA 1CI6B 2H7HA 2FXMA 1YTZI 3HD7A 3L75D 2FFDC 5KAFH 3HUSC 3TK1A 3TYYA 4C7RA 2GZFA 1YJWP 3NFQA 5KP6B 3MD0A 1L0NG 1ZRTD 1KB9I 4OH8B 1GW3A 3VRLC 4Z1MH 2E76B 4N78E 3FXEA 3E7KA 3A3YB 2DNWA 2YO2A 4H13D 3BCCJ 1BSHA 1KV4A 1SFCA 1AUMA 1CZQA 5TISH 3KDPB 2QA4P 2LIUA 1X9VA 2VSQA 1EZVD 3NTEA 2LXBA 3RK2C 3H1LE 1AVYA 3CXCO 2KR5A 4XFZA 1SQXG 1M1JC 5APYA 3WMM0 3R2PA 1TU3F 3I5CA 4BWNA 1LTTC 5GTHH 1SQVJ 1GL2B 2P7JA 1A02J 2KGAA 2P9XA 4NPEA 2QJKB 1IFMA 1KILD 3ZDMA 1EMVA 3MUDC 1T8KA 4NPFX 2NZ2A 2FFDB 1YJ9P 1D7MA 2J58A 2KG9A 1EDIA 1FJKA 1SQXK 2HPCB 3H1LD 2XXMA 4AYCA 1JJ2O 4LC1A 3DS4A 4I2LC 2KIKA 1YIJP 2W8ZA 3CCEP 2PGDA 2HG5D 1DEEG 4YXWH 5BU5A 1T3JA 3B5NC 3VMXA 2UWJE 4H0LB 3KZIE 1QRJA 1KILE 2QRXA 3LMOA 4RESB 2JKVA 2C0XA 4AQRD 4C46A 3LIEA 2KSJA 1A8OA 2MF4A 2WMMA 2Q3IA 2IBZI 2LF4A 1RE3C 5H2FH 3RL0D 1IJDB 1NTZE 1X22A 4BPGA 2P67A 1N73C 2E43A 3L4FA 2KGEA 3CD6P 5KP8B 3FWLA 1BE3E 3SWKA 1ZMEC 1KILC 2OYOA 1M74A 2H88C 1NTKK 1NTZG 2Z5IA 2YNYA 2YIUC 1BCCE 1NTMJ 1SP4A 2IFMA 2K3RA 2IYPA 1OVRA 1ZP0C 3VOPA 3K5BA 2JDIH 1YJNP 1IC2A 1YQ3C 3KQGA 2L91A 1QX8A 3B5IA 3W68A 3C9IA 1URQB 2FACA 1KZUB 4RKUJ 3GMAA 4AUWA 3KYQA 2M8RA 4JPZB 3A2AA 3L71D 2LPKA 2KP8A 3TF5A 3H1ID 3B5ND 5H2FE 2AXCA 3TSIA 2V7QJ 1NAFA 5F2NA 1JTHA 4ZKUA 1KLPA 2IBZE 2LXCB 1LTJA 1FOSF 3DS0A 7CEIA 1ZXGA 3HE5B 4HKGA 1OXZA 1Z56A 1PGQA 3NXSA 4H13C 1BSNA 2WPTA 5HGNA 3KPEA 4U3FE 2PFXA 1L4AD 1RF1A 3H1LG 1K05A 2ERHA 5KAIE 1PP9E 2RKLA 4GOEA 3G21A 5CJ4A 3G28A 2VLPA 5APUA 3V6IA 1HGZA 2N1TA 1T8ZA 1LTSC 1UIIA 3DPHA 4K3AA 2FYUK 2E75D 2LKMA 4H0LC 4EDFA 3CWBJ 3GJNA 1EDKA 4LLHA 2GA1A 4U0EA 1NTME 4TLFA 1KQFB 1PGJA 2E76D 2C0WA 1NKNA 3V4WA 4DZOA 2VRSA 3H1HJ 2FADA 3GHGB 3U43A 2R3SA 3L72G 1LWUC 3FWNA 4TT3H 3ABVC 2MD9A 2GZJA 4H2XC 3L71G 2IX7C 1OW6A 2WWWA 1G1IA 1FZFA 2PNGA 3L73G 1AF8A 2WITA 5AVUB 2NPSA 1L0NJ 3IR9A 2FVFA 3RG2A 2KZJA 3V2NA 2OYHB 1NTMD 1MUUA 1NKZB 3Q5PA 1H89A 1L4AB 1MV8A 1FZCA 4I7ZC 5AW3B 1QVFO 1HF9A 2K2QA 3WUUA 1M7LA 4GDOA 1GXHA 2ZXXA 4I1LA 1YQ4C 3GHGC 2ZJSE 1Q7YQ 2FQ1A 1KB9E 2XV5A 2FQ2A 3CCMP 5CCHC 2JQ4A 5AVRB 1S72P 1E6JP 1L0LK 1BGYG 2QSIA 1ZV8A 2XV6A 1S4XA 3CWBE 1JY2N 1P84D 3M9HA 1E79H 4JBZA 2MR7A 5KTBA 1IK9A 2ZT9C 3S9OA 5EW5E 2H43A 1VF5C 5KJ7D 5DJUB 5KLIB 1BCCG 2Y9YA 2KOOA 2Y0DA 1JUNA 2FHSC 4Y99C 2M5RA 3G3ZA 3BRTB 5KLVD 1SQXJ 1NU1D 3FGAD 1N2DC 5DCKA 5BU8B 3Q5RA 1R8EA 5KKZC 2XDJA 4UB8E 1NOHA 2R44A 4PD4I 4PD4D 3H1IG 1HVVA 3RL0B 2Y0CA 2DW3A 3CWBD 1NO4A 2CPSA 2MVUA 2CGQA 2KOSA 3LRYA 2PEIA 4O9BA 2YO3A 3MGNA 3M0DC 3G26A 3T97A 2OYIA 1PEOA 2WPSA 1ZNVA 4HH2A 1Z6MA 3P8MC 2JWAA 2NPSD 2AVAA 1FZCC 1GU4A 2AEFA 2WT7B 1NU1E 3CCJP 3RL0g 1D1DA 1JO5A 2PRRA 3WUTA 5JPAA 1HY8A 3B71A 1LGHB 3D6ZA 2KW2A 2H89C 1UIXA 3E2DA 4NEOA 2BCCG 4I6MC 3O8ZA 2JU1A 3SSUA 2PEKA 1UNKA 4N78D 1SFCC 2JP3A 3I56P 3SWFA 3L74G 1FR2A 3QWOC 1SQXE 4DOJA 4XROA 3RK3E 1WT6A 3CX5E 2E74B 3EJDA 1AJYA 2WPQA 1JEKA 2BQ1E 3IN6A 3AE7C 1HUCA 2L6EA 3S4RA 1M57D 2WSCH 5KAFE 3H32A 1NTZJ 5CBOA 2QJKC 1QLED 2KK7A 1J1DB 2Q1KA 1RO2A 2GZGA 5AW7B 2NPSB 1GL2C 3L72E 3WU2H 1S9KE 4JQ0D 1L0LD 3A0BE 3BCCG 1JCCA 1SQXD 3OW2O 1AYIA 3L73J 1JNMA 1SQPG 1RE4A 4EI2A 4NPDA 2M8LA 3GHGA 4GR2A 4OGQB 3RGUA 2EG5A 2WPVB 1KILA 5EJDA 1YITP 1KYOE 3PLNA 1KQSO 3V4QA 1N7SC 1CI6A 2FYUJ 4PV1B 1ZMBA 2EFJA 4N3YB 1EDLA 4K35A 2BEZF 2D2CD 5AW6B 1KB9H 1KORA 3B4SA 3GLMA 4OWFA 2N6ZA 2FVAA 1PP9G 1VF5B 4DCKA 5KLVK 2Q3EA 2BASA 2KI7B 1S9KD 4D6TE 2Z5HA 3PTZA 1YBKA 2N1TB 3DS3A 3PP5A 2K37A 3G29A 1GD2E 3AEGC 3H1KG 4QMAA 1L4AC 3AE1C 3CCSP 2N6YA 4KT0J 1YI2P 4DJGA 1JY3P 3O6QB 1LTJB 2N5IA 3VP9A 3VN0A 2HR3A 2CWOA 2KG8A 1PP9J 1KYOH 1LT9C 2E5TA 3TGUE 2JEEA 5HV8A 1MKMA 4H44D 1VHNA 1NTKD 3U59A 5CZDB 1K73Q 3DS5A 3PHLA 5GTHE 3NY7B 3BCCD 1MZ8A 1AQTA 1BCCD 3U1AA 4WY4A 1J1DC 2XNXA 2G3AA 3H1HD 5AW9B 1FDIA 1R5SA 2IZ0A 2JBGA 1X0TA 2J5UA 3L75J 3USSA 1L0IA 1VQ6P 4GKGA 1EDJA 2GZIA 2GDXA 2FY8A 3Q2YA 1MFTA 3IF4A 3TGUD 1FBMA 2E75C 3MHVA 2FBWC 1SFCB 3BCCE 3T97B
chains in the Genus database with same CATH topology
1VQLP 3DTJA 5HGMA 3VRLC 3DS2A 1S72P 1VQ4P 2ONTA 1E6JP 3WBHA 2QEXP 3MGEA 4WYMA 2OTLP 3G21A 3G28A 3H4EA 1A8OA 4IPYA 2M8PA 4PH1A 1M6EX 3E2DA 2KODA 2XV6A 4U0BA 4PH0A 1M6NA 1VQKP 1AUMA 2E1MA 1Q86Q 3DPHA 3DS3A 2LF4A 1KD1Q 1W2BO 3CCQP 3G29A 2QA4P 1PEMA 4GR6A 2PEKA 2BUOA 3NTEA 2Z45A 2DGYA 5BS1A 2OTJP 2Z46A 1VQNP 3I56P 3CXCO 2BHVA 3CCSP 3CPWO 3CD6P 3HZQA 4XFZA 1YHQP 3HYBA 2PEJA 4U0EA 4XROA 2M8NA 4U0FA 3CCUP 1YI2P 2Z44A 3H47A 1N8RQ 1M74A 4U0AA 4COCA 3P05A 2XT1A 1VQOP 2PY8A 1PEQA 1BAJA 3G4SP 1RNIA 2PEQA 2BQ1E 1VQ9P 1IUQA 2CWOA 2P9XA 4M0IA 5DCKA 1Q81Q 4COPA 4XFXA 1VQ8P 2L6EA 1KC8Q 4XFYA 1K73Q 3DS5A 5BS2A 2JYLA 1YJNP 1RO0A 5I4TG 1EIAA 3CC4P 3CCRP 2JYGA 1YJ9P 3B5IA 1RO2A 2PENA 1K9MQ 2PEMA 2PEOA 3G1IA 3LRYA 1K8AQ 2PEIA 1M90Q 3RG6C 3I55P 3CC2P 3CC7P 3CCVP 1K30A 3G26A 4QNBA 5HGLA 3CCLP 2XXMA 1JJ2O 4U0CA 1PEOA 1M1KQ 3G1GA 3H0DA 3OW2O 1A43A 3CMEP 2EIAA 3DS4A 1VQ7P 1YIJP 2M8LA 5HGOA 3CMAP 1VQPP 2OARA 5F2NA 1EOQA 4GR2A 3CCEP 1QVFO 1VQ6P 2JO0A 1NJIQ 3M1MA 1VQMP 2EG5A 1Q82Q 3DS0A 4U0DA 4XRQA 3CCJP 1VQ5P 1YJWP 3G71P 3G6EP 1PEUA 1QRJA 1D1DA 1QVGO 1YITP 1Q7YQ 3Q20A 3DS1A 1KQSO 5F2KA 5F2OA 3CCMP 3G0VA 1ZMBA 5HGNA 5JPAA 2EFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL P;  1VQN P;  1VQ8 P;  3I56 P;  3OW2 O;  1KC8 Q;  1S72 P;  1VQ4 P;  3CXC O;  1K73 Q;  3CME P;  1YJN P;  2QEX P;  3CCS P;  1VQ7 P;  3CPW O;  3CD6 P;  2OTL P;  1YHQ P;  1YIJ P;  3CC4 P;  3CMA P;  3CCR P;  1VQP P;  1YJ9 P;  1QVF O;  3CCE P;  1VQ6 P;  3CCU P;  1YI2 P;  1NJI Q;  1K9M Q;  1VQM P;  1N8R Q;  1K8A Q;  1M90 Q;  1Q82 Q;  1VQK P;  3I55 P;  1VQO P;  1Q86 Q;  3CCJ P;  1VQ5 P;  1YJW P;  3CC2 P;  3CC7 P;  3G71 P;  3G6E P;  1KD1 Q;  3G4S P;  1QVG O;  1YIT P;  1W2B O;  1Q7Y Q;  3CCV P;  2QA4 P;  3CCQ P;  1VQ9 P;  1KQS O;  3CCL P;  1Q81 Q;  3CCM P;  1JJ2 O;  2OTJ P;  1M1K Q; 
#chains in the Genus database with same CATH topology
 2XZ0 D;  2W27 A;  1DH3 A;  3L73 D;  3KXD A;  5TJH A;  2GM4 A;  1FZB A;  2B89 A;  1JY2 O;  1PZQ A;  1S5L E;  4KHX A;  1HJB A;  2M5A B;  2AEM A;  2XZR A;  5AVT B;  3D70 A;  1CW5 A;  1YHQ P;  3SWY A;  2PEJ A;  1NTM G;  4HJG H;  3H1J E;  3RK3 D;  1ZR4 A;  3CX5 I;  1N8R Q;  3SFE C;  1DX7 A;  1J1E C;  1EZV I;  3W67 A;  2QE7 H;  5APV A;  4N6J A;  3HTK A;  1EZV G;  3EFF K;  1JCD A;  1VQ9 P;  1IUQ A;  5GTI H;  4M0I A;  2OYI B;  3LW5 J;  5CHX A;  1GTW A;  2CPB A;  3KZI H;  3F5H A;  2AFD A;  5B66 H;  1XTG B;  2M3B A;  3PJS K;  3H1L J;  1BE3 J;  4DT0 A;  4U3F G;  2XZ1 C;  2R5B A;  5KLI C;  3UIA A;  1MZ9 A;  2FAE A;  1L0L E;  1OFC X;  1Q2N A;  1U57 A;  2O01 H;  2V7Q H;  4U0C A;  2K9Y A;  2CNR A;  3TGU G;  3A7O A;  2IBZ G;  1VQ7 P;  3PH0 A;  1FZE A;  4Y99 B;  5APT A;  1OX3 A;  2L4B A;  5AVS B;  1PIX A;  1RF0 A;  2H8P D;  2YIU B;  1VQ5 P;  1BE3 G;  3DS1 A;  2OYH A;  3OAK A;  2BCC E;  2E75 B;  1VQ4 P;  2LML A;  1FOS E;  2OTL P;  2L9F A;  5AW0 B;  3M06 A;  1PPJ G;  3HD7 C;  2P2U A;  1RF1 C;  2Y9Z A;  1QL2 A;  1ZLL A;  3H1I J;  1NU1 G;  2RN0 A;  2BUO A;  2Z46 A;  4PV1 D;  4HYT B;  1R5L A;  2O01 J;  2RMZ A;  1N7L A;  4U0F A;  3AEF C;  4WY4 C;  4IFF A;  2I1K A;  3GG2 A;  4ASV A;  2GYK A;  1VQO P;  2ZVO B;  3TNU B;  3P8C E;  2PY8 A;  1PEQ A;  3HD7 B;  2WZ7 A;  3B5N B;  3CL3 D;  2N1T D;  2KOP A;  1NU1 K;  5CJ0 A;  5AVQ B;  3A5T A;  1M1J A;  2WSC J;  3EJE A;  1K9M Q;  4F37 A;  5KLV E;  2PEM A;  3B8E B;  3H32 B;  3RG6 C;  3AED C;  5KJ7 A;  4PJ0 E;  1PV3 A;  2R3C A;  3CC2 P;  1T2K C;  5CCH A;  2HOD B;  2K0D X;  4PD4 E;  1YTZ T;  1HH0 A;  1RF1 B;  1M1K Q;  1SQV G;  1A43 A;  1CSB A;  3L70 J;  4EIJ A;  1IZN B;  3HE5 A;  3B4Q A;  5TIS E;  3S1K A;  1EOQ A;  1NTZ D;  1HGV A;  4LGD E;  2KOG A;  2JO0 A;  3MTU E;  1VQM P;  2BCC J;  4U0D A;  4U3F J;  4XRQ A;  2JB0 A;  5B5E E;  3G71 P;  2FYZ A;  3A0H E;  1Q90 D;  1BE3 D;  5F2O A;  2FFD A;  1VQL P;  1OW8 A;  3RK2 B;  2AXT E;  1IMP A;  2KOD A;  2NRG A;  5DJT B;  4XFJ A;  3L73 E;  4H0L D;  4RJT A;  3P7K A;  3PRJ A;  4IL6 E;  1DNY A;  1KYO I;  2WPR A;  1SQQ K;  1N7S D;  2A45 I;  3U1C A;  2E76 C;  4H13 B;  1LTG C;  1RE3 A;  1BGY J;  2NPS C;  2W6A A;  2FQ0 A;  1FC2 C;  3H1J G;  1IFN A;  1RY3 A;  2I1J A;  2FYU E;  1NH4 A;  4HB1 A;  2XKM A;  3HUS B;  4GT1 A;  2IBZ D;  1XTC C;  3Q5S A;  1N73 A;  5GTI E;  4COP A;  4XFX A;  2E74 D;  1QL1 A;  1RO0 A;  1JOC A;  2XND H;  4UB6 E;  1AV1 A;  3R4Y A;  2JYG A;  2PEN A;  1M90 Q;  5AW5 B;  4OGQ D;  2C9N Y;  1N73 B;  2W90 A;  2MVV A;  1PGP A;  2YMY A;  2P1J A;  1VL2 A;  3JC2 2;  3IAO A;  1OZH A;  2QIW A;  2MJZ A;  1SS1 A;  1S3J A;  1AQ5 A;  1FU1 A;  1VQP P;  1N86 A;  5C39 A;  1NJI Q;  1NWQ A;  2KOR A;  1IFD A;  1S2E A;  3C1L A;  1QVG O;  1HTL C;  3AEB C;  4H2Y C;  2Y0E A;  5AVX B;  3G0V A;  5CCG A;  1X3O A;  5APX A;  2HPC A;  1LWU B;  3JCU E;  4IPY A;  1EQ7 A;  2VLQ A;  3L70 D;  1KYO D;  1LTJ C;  1VQK P;  2O3J A;  2GDW A;  4CA3 A;  3H1H G;  1L2P A;  1PEM A;  4WB4 A;  2Z45 A;  1SLQ A;  3GKL C;  1DD4 A;  1SQP D;  4D6T D;  1SQV K;  4U7J A;  4L74 A;  1HBW A;  3M0D A;  1LTB C;  2N1T C;  1LT9 B;  1FZC B;  4JF7 A;  1L4A A;  4UB6 H;  3P8C D;  2KWL A;  2Q9I A;  4JYC A;  1SQB E;  1RQU A;  1FDO A;  3NMD A;  3H1K E;  3V5B A;  4PV1 C;  1HQB A;  4WWI A;  4D6T G;  1IFI A;  1EC5 A;  3VMY A;  1IO4 A;  3AE4 C;  1BGY D;  1NYH A;  4BPH A;  2IPP A;  1FS0 E;  3AEC C;  2ZXE B;  3F89 A;  1CEI A;  2N9B A;  1NTK G;  3FX0 A;  2MR8 A;  1P84 E;  5CBN A;  2B87 A;  2FYU G;  1SQQ D;  3VP8 A;  1SQB D;  3JCU H;  1URQ C;  2IYO A;  3M0A A;  3WUV A;  4ZNC A;  5KAI H;  1KFN A;  3G9R A;  1PPJ E;  2KUB A;  3M91 A;  2QG4 A;  4YXD C;  3DS2 A;  1GXG A;  4W80 A;  1E0H A;  1GK4 A;  4EYY Q;  4IL6 X;  2E5Y A;  2JWD A;  4I7Z B;  3V2R A;  1L0L J;  3BAT A;  4A7P A;  3RK3 B;  3H25 A;  3MUD A;  1ZW0 A;  3AEE C;  1USE A;  1FE6 A;  3OJA B;  4HKZ H;  3H1J J;  4PD4 H;  3WU2 E;  4MN4 C;  4L76 A;  2W6J H;  2IZ1 A;  1SQQ E;  1JTH B;  4RO0 A;  3EWK A;  1PL5 A;  3RK2 D;  4DG9 A;  1HWT C;  2M3E A;  3H1K J;  1LTA C;  1F80 D;  1RNI A;  4IFM A;  4R4M A;  1J2J B;  1WRG A;  4H2W C;  1LTI C;  3CLQ A;  4ASW A;  2KNC A;  1LP1 B;  1LJ2 A;  4UHP B;  5EFW B;  2K94 A;  3CXH I;  1VPC A;  2L0Q A;  2LTE A;  2FVE A;  3CCR P;  1FAV A;  2PEO A;  1SQP J;  3HE4 A;  3CXH H;  3AE2 C;  2K9J A;  1N7S A;  4C7N B;  2D2C B;  5APS A;  2I8D A;  4QNB A;  3CCL P;  2KLV A;  4BRY A;  2CQ8 A;  5BVZ A;  2K5X A;  3G1G A;  3VYI A;  3GF7 A;  1G2C A;  3BVH A;  5HGO A;  1JMM A;  2K92 A;  2OAR A;  3RK3 C;  2RH0 A;  3EQ2 A;  1E5W A;  5M1B A;  1RQV A;  2MKV A;  4R4L A;  1FDM A;  4W7Z A;  2MY5 A;  2VLN A;  1SQV D;  3CX5 D;  1NTK J;  2N5H A;  1NTZ K;  2JGP A;  1JY3 O;  3DTJ A;  4H44 C;  1RF0 C;  3A0H H;  5KKZ B;  2Q6Q A;  2OQQ A;  2ONT A;  2LIW A;  2JJL A;  4WYM A;  1U7J A;  1KQG B;  1RE4 C;  2KS1 B;  3GF3 A;  4U0B A;  3L70 E;  3Q1M A;  1SVF A;  4Y28 J;  3VMZ A;  2QNW A;  2BCC D;  3LID A;  5HVC A;  1SQB G;  3VTP C;  4GR6 A;  5AW8 B;  1G1J A;  2WSF H;  2QJY C;  2HFE D;  2IFN A;  1G2C B;  2K1A A;  3AE8 C;  3RL0 C;  1VF5 D;  4BXL A;  2QM8 A;  4ZMD A;  4U0A A;  1PP9 D;  2LOL A;  2YXQ B;  3IFM A;  3TGU J;  2AF8 A;  3CE7 A;  1OVV A;  2PEQ A;  1N7S B;  4C7N A;  2QJP B;  2N50 A;  2KGC A;  1SQB K;  1BCC J;  4EOT A;  2PP6 A;  3CC4 P;  2ZVN B;  2ZAE B;  2ZYG A;  1S1C X;  5K5G B;  3CC7 P;  1BGY E;  5CCG C;  2IDB A;  3L75 E;  2YKP A;  2ROQ A;  1GZL A;  2KB7 P;  1GL2 A;  1LWU A;  4QKO A;  1P84 I;  2O1J A;  2E74 C;  3CME P;  3Q3D A;  2EIA A;  3L71 J;  2YKQ A;  1ZRT E;  1OW7 A;  3H6P A;  1U7M A;  4R0M A;  2FYN B;  2E42 A;  1Q82 Q;  3G6E P;  2PAJ A;  1FZG A;  2ZYD A;  5AVY B;  1LNQ A;  5F2K A;  2E1M A;  3L36 A;  4BPF A;  1IFJ A;  3M9B A;  5HGM A;  5AVV B;  2HLO A;  3WBH A;  2QEX P;  1OIP A;  3TDK A;  1JM0 A;  3H4E A;  5APW A;  1S5L X;  1DV5 A;  4PH1 A;  1M6E X;  1HJ0 A;  2ZFC A;  2POH A;  2N9Y B;  1VKU A;  1M6N A;  3QH9 A;  3CCQ P;  2KOQ A;  1M56 D;  1X79 B;  5APQ A;  1JMB A;  4YTP C;  2P58 A;  4JYB A;  2Q7C A;  3E1I A;  2BHV A;  1K04 A;  3CPW O;  1L0N E;  3D6Y A;  3AEA C;  2ZT9 D;  2NO8 A;  2HYN A;  5L8R J;  3HUS A;  2WSE H;  3P05 A;  2BEQ D;  5CMZ A;  1BAJ A;  2O1K A;  1Y8A A;  5B66 E;  1H8A A;  2GDY A;  1SQP K;  3E1R A;  2FYN C;  1GK6 A;  1AA0 A;  3NTN A;  2WVR A;  4IOI H;  3EJB A;  3MIW A;  4XFY A;  2QJP C;  2K0X A;  1RH5 B;  5E79 E;  3G1I A;  2K9J B;  2ZYA A;  1PFI A;  2W6B A;  2B9B A;  1K30 A;  3A0B H;  1WMK A;  4B86 A;  2GUV A;  2Q5U A;  1H0T B;  1L0N D;  3H0D A;  1KFM A;  1LP1 A;  1SQQ G;  3AE3 C;  2N98 A;  1EXI A;  4MRT C;  3AE6 C;  2ITA A;  1BDD A;  1USD A;  1PEU A;  1JB0 J;  3Q20 A;  2KSE A;  2WQY C;  5AW2 B;  2V4H A;  1SQV E;  1MFZ A;  1FZA A;  1GU5 A;  1LT1 A;  3MGE A;  1J1E B;  4OVN F;  5B5E H;  1EXJ A;  4GOD A;  1AVO A;  2P10 A;  2QJY B;  2WSF J;  1NAY A;  1Q86 Q;  2HOD A;  3V2P A;  4WVZ A;  1SQQ J;  1KD1 Q;  2YKO A;  1W2B O;  1Y47 A;  3V2Q A;  5BS1 A;  1VQN P;  3SFD C;  1GMJ A;  2WTY A;  2YXR B;  2WSS H;  3HZQ A;  3N4X A;  1NQ4 A;  2OTK E;  2WT7 A;  3CCU P;  3H47 A;  2AEJ A;  1T3U A;  2KXP B;  4COC A;  2M5A A;  4WBA A;  3TNU A;  1OWA A;  2OYI C;  1GW4 A;  2B87 B;  1L0H A;  1SQP E;  4ZKP A;  1NVO A;  4GOF A;  3L74 J;  2EHS A;  1OVU A;  1H88 A;  1T6A A;  1Y9B A;  1EIA A;  3H1I E;  2YMK A;  1BDC A;  1M8O B;  3L70 G;  3CX5 H;  2JU2 A;  1P84 H;  2D2C C;  3MP7 B;  2OYH C;  3H1K D;  2K0Y A;  5HGL A;  5AVW B;  1AFO A;  2L5G B;  1ZR2 A;  1ACP A;  3CXH D;  4PJ0 H;  4IZ6 A;  5E79 H;  3N7N A;  4U3F D;  4WY4 D;  1UJZ A;  2CK3 H;  2GUS A;  4PWV B;  3M1M A;  1GPJ A;  1W5C E;  2KZI A;  3GZL A;  4IFD K;  3BAS A;  5KLV J;  4WY4 B;  1NU1 J;  3RBZ A;  3L72 D;  4YPC A;  2K88 A;  2Z4E A;  3CI9 A;  2C9L Y;  2KNC B;  2M8P A;  4M3L A;  4PH0 A;  1GL2 D;  4L73 A;  1T2K D;  1IK7 A;  1VDF A;  4KJM A;  1NHL A;  1PPJ D;  3JSV C;  1JY2 P;  1EZV E;  2JO1 A;  1KN7 A;  1X8Y A;  1DD3 A;  2QVA A;  1KTM A;  2L22 A;  1JY3 N;  2M8N A;  2Z44 A;  3L74 E;  1L0L G;  1A02 F;  2XT1 A;  1L0N K;  3HTK B;  1URQ D;  5CCG D;  2W83 C;  4PXH B;  2FKW B;  2R32 A;  4W7Y A;  1DIP A;  5AW1 B;  2WSE J;  1M1J B;  2KLU A;  5BS2 A;  2JYL A;  2FXO A;  4OGQ C;  1KMI Z;  2O01 N;  1ZN5 A;  3VMA A;  3HRN A;  1K8A Q;  2KS1 A;  2ZT9 B;  5KLV G;  1NTM K;  3CCV P;  1YYC A;  2AFE A;  1DEB A;  1S5L H;  2SPZ A;  1KB9 D;  4D6T J;  1SFC D;  1KIL B;  5AVZ B;  2JR8 A;  1QEX A;  3ITK A;  2XU6 A;  2GZE A;  3L74 D;  3CMA P;  2OGU A;  1ZOY C;  2R5D A;  3LW5 H;  2LKI A;  2CG5 B;  1GDT A;  2X2B A;  1NTK E;  3AE5 C;  5AW4 B;  2G8Y A;  3FXD A;  4BRY B;  1IMQ A;  1IFP A;  3L75 G;  3L35 A;  2FYU D;  2A06 D;  3H1H E;  3HE4 B;  3EFG A;  3CWB G;  4CPG A;  3BRV B;  1LT9 A;  2VLO A;  2LL8 A;  4IL6 H;  3KHU A;  4H44 B;  2FXP A;  2A06 G;  3HD7 D;  2OTJ P;  2DGY A;  2A45 H;  3OA7 A;  1RHZ B;  4L75 A;  4GIF A;  2B88 A;  3RBX A;  3L37 A;  3HYB A;  2QM7 A;  2AXT H;  1PGO A;  3AE9 C;  3L72 J;  4XE5 B;  3P32 A;  2KG6 A;  3GZM A;  1OMI A;  2EHT A;  2KGD A;  3O6Q A;  3G4S P;  2K93 A;  4UB8 H;  1BXI A;  1H0T A;  3II6 A;  1Q81 Q;  2A06 E;  1VQ8 P;  2KYV A;  5KJ7 C;  1KC8 Q;  3GW6 A;  3D71 A;  5I4T G;  2A45 G;  1URQ A;  1W2E A;  3MZW B;  2LR2 A;  3I55 P;  1KQL A;  5KP7 B;  4XA4 A;  3L71 E;  3H1J D;  1QGK B;  5CCH D;  2J59 M;  1OR5 A;  2JAZ A;  3C8V A;  3CXH E;  1NGM B;  2M0B A;  3M9Q A;  1SQB J;  1FJP A;  3B5N A;  1CI6 B;  2H7H A;  2FXM A;  1YTZ I;  3HD7 A;  3L75 D;  2FFD C;  5KAF H;  3HUS C;  3TK1 A;  3TYY A;  4C7R A;  2GZF A;  1YJW P;  3NFQ A;  5KP6 B;  3MD0 A;  1L0N G;  1ZRT D;  1KB9 I;  4OH8 B;  1GW3 A;  3VRL C;  4Z1M H;  2E76 B;  4N78 E;  3FXE A;  3E7K A;  3A3Y B;  2DNW A;  2YO2 A;  4H13 D;  3BCC J;  1BSH A;  1KV4 A;  1SFC A;  1AUM A;  1CZQ A;  5TIS H;  3KDP B;  2QA4 P;  2LIU A;  1X9V A;  2VSQ A;  1EZV D;  3NTE A;  2LXB A;  3RK2 C;  3H1L E;  1AVY A;  3CXC O;  2KR5 A;  4XFZ A;  1SQX G;  1M1J C;  5APY A;  3WMM 0;  3R2P A;  1TU3 F;  3I5C A;  4BWN A;  1LTT C;  5GTH H;  1SQV J;  1GL2 B;  2P7J A;  1A02 J;  2KGA A;  2P9X A;  4NPE A;  2QJK B;  1IFM A;  1KIL D;  3ZDM A;  1EMV A;  3MUD C;  1T8K A;  4NPF X;  2NZ2 A;  2FFD B;  1YJ9 P;  1D7M A;  2J58 A;  2KG9 A;  1EDI A;  1FJK A;  1SQX K;  2HPC B;  3H1L D;  2XXM A;  4AYC A;  1JJ2 O;  4LC1 A;  3DS4 A;  4I2L C;  2KIK A;  1YIJ P;  2W8Z A;  3CCE P;  2PGD A;  2HG5 D;  1DEE G;  4YXW H;  5BU5 A;  1T3J A;  3B5N C;  3VMX A;  2UWJ E;  4H0L B;  3KZI E;  1QRJ A;  1KIL E;  2QRX A;  3LMO A;  4RES B;  2JKV A;  2C0X A;  4AQR D;  4C46 A;  3LIE A;  2KSJ A;  1A8O A;  2MF4 A;  2WMM A;  2Q3I A;  2IBZ I;  2LF4 A;  1RE3 C;  5H2F H;  3RL0 D;  1IJD B;  1NTZ E;  1X22 A;  4BPG A;  2P67 A;  1N73 C;  2E43 A;  3L4F A;  2KGE A;  3CD6 P;  5KP8 B;  3FWL A;  1BE3 E;  3SWK A;  1ZME C;  1KIL C;  2OYO A;  1M74 A;  2H88 C;  1NTK K;  1NTZ G;  2Z5I A;  2YNY A;  2YIU C;  1BCC E;  1NTM J;  1SP4 A;  2IFM A;  2K3R A;  2IYP A;  1OVR A;  1ZP0 C;  3VOP A;  3K5B A;  2JDI H;  1YJN P;  1IC2 A;  1YQ3 C;  3KQG A;  2L91 A;  1QX8 A;  3B5I A;  3W68 A;  3C9I A;  1URQ B;  2FAC A;  1KZU B;  4RKU J;  3GMA A;  4AUW A;  3KYQ A;  2M8R A;  4JPZ B;  3A2A A;  3L71 D;  2LPK A;  2KP8 A;  3TF5 A;  3H1I D;  3B5N D;  5H2F E;  2AXC A;  3TSI A;  2V7Q J;  1NAF A;  5F2N A;  1JTH A;  4ZKU A;  1KLP A;  2IBZ E;  2LXC B;  1LTJ A;  1FOS F;  3DS0 A;  7CEI A;  1ZXG A;  3HE5 B;  4HKG A;  1OXZ A;  1Z56 A;  1PGQ A;  3NXS A;  4H13 C;  1BSN A;  2WPT A;  5HGN A;  3KPE A;  4U3F E;  2PFX A;  1L4A D;  1RF1 A;  3H1L G;  1K05 A;  2ERH A;  5KAI E;  1PP9 E;  2RKL A;  4GOE A;  3G21 A;  5CJ4 A;  3G28 A;  2VLP A;  5APU A;  3V6I A;  1HGZ A;  2N1T A;  1T8Z A;  1LTS C;  1UII A;  3DPH A;  4K3A A;  2FYU K;  2E75 D;  2LKM A;  4H0L C;  4EDF A;  3CWB J;  3GJN A;  1EDK A;  4LLH A;  2GA1 A;  4U0E A;  1NTM E;  4TLF A;  1KQF B;  1PGJ A;  2E76 D;  2C0W A;  1NKN A;  3V4W A;  4DZO A;  2VRS A;  3H1H J;  2FAD A;  3GHG B;  3U43 A;  2R3S A;  3L72 G;  1LWU C;  3FWN A;  4TT3 H;  3ABV C;  2MD9 A;  2GZJ A;  4H2X C;  3L71 G;  2IX7 C;  1OW6 A;  2WWW A;  1G1I A;  1FZF A;  2PNG A;  3L73 G;  1AF8 A;  2WIT A;  5AVU B;  2NPS A;  1L0N J;  3IR9 A;  2FVF A;  3RG2 A;  2KZJ A;  3V2N A;  2OYH B;  1NTM D;  1MUU A;  1NKZ B;  3Q5P A;  1H89 A;  1L4A B;  1MV8 A;  1FZC A;  4I7Z C;  5AW3 B;  1QVF O;  1HF9 A;  2K2Q A;  3WUU A;  1M7L A;  4GDO A;  1GXH A;  2ZXX A;  4I1L A;  1YQ4 C;  3GHG C;  2ZJS E;  1Q7Y Q;  2FQ1 A;  1KB9 E;  2XV5 A;  2FQ2 A;  3CCM P;  5CCH C;  2JQ4 A;  5AVR B;  1S72 P;  1E6J P;  1L0L K;  1BGY G;  2QSI A;  1ZV8 A;  2XV6 A;  1S4X A;  3CWB E;  1JY2 N;  1P84 D;  3M9H A;  1E79 H;  4JBZ A;  2MR7 A;  5KTB A;  1IK9 A;  2ZT9 C;  3S9O A;  5EW5 E;  2H43 A;  1VF5 C;  5KJ7 D;  5DJU B;  5KLI B;  1BCC G;  2Y9Y A;  2KOO A;  2Y0D A;  1JUN A;  2FHS C;  4Y99 C;  2M5R A;  3G3Z A;  3BRT B;  5KLV D;  1SQX J;  1NU1 D;  3FGA D;  1N2D C;  5DCK A;  5BU8 B;  3Q5R A;  1R8E A;  5KKZ C;  2XDJ A;  4UB8 E;  1NOH A;  2R44 A;  4PD4 I;  4PD4 D;  3H1I G;  1HVV A;  3RL0 B;  2Y0C A;  2DW3 A;  3CWB D;  1NO4 A;  2CPS A;  2MVU A;  2CGQ A;  2KOS A;  3LRY A;  2PEI A;  4O9B A;  2YO3 A;  3MGN A;  3M0D C;  3G26 A;  3T97 A;  2OYI A;  1PEO A;  2WPS A;  1ZNV A;  4HH2 A;  1Z6M A;  3P8M C;  2JWA A;  2NPS D;  2AVA A;  1FZC C;  1GU4 A;  2AEF A;  2WT7 B;  1NU1 E;  3CCJ P;  3RL0 g;  1D1D A;  1JO5 A;  2PRR A;  3WUT A;  5JPA A;  1HY8 A;  3B71 A;  1LGH B;  3D6Z A;  2KW2 A;  2H89 C;  1UIX A;  3E2D A;  4NEO A;  2BCC G;  4I6M C;  3O8Z A;  2JU1 A;  3SSU A;  2PEK A;  1UNK A;  4N78 D;  1SFC C;  2JP3 A;  3I56 P;  3SWF A;  3L74 G;  1FR2 A;  3QWO C;  1SQX E;  4DOJ A;  4XRO A;  3RK3 E;  1WT6 A;  3CX5 E;  2E74 B;  3EJD A;  1AJY A;  2WPQ A;  1JEK A;  2BQ1 E;  3IN6 A;  3AE7 C;  1HUC A;  2L6E A;  3S4R A;  1M57 D;  2WSC H;  5KAF E;  3H32 A;  1NTZ J;  5CBO A;  2QJK C;  1QLE D;  2KK7 A;  1J1D B;  2Q1K A;  1RO2 A;  2GZG A;  5AW7 B;  2NPS B;  1GL2 C;  3L72 E;  3WU2 H;  1S9K E;  4JQ0 D;  1L0L D;  3A0B E;  3BCC G;  1JCC A;  1SQX D;  3OW2 O;  1AYI A;  3L73 J;  1JNM A;  1SQP G;  1RE4 A;  4EI2 A;  4NPD A;  2M8L A;  3GHG A;  4GR2 A;  4OGQ B;  3RGU A;  2EG5 A;  2WPV B;  1KIL A;  5EJD A;  1YIT P;  1KYO E;  3PLN A;  1KQS O;  3V4Q A;  1N7S C;  1CI6 A;  2FYU J;  4PV1 B;  1ZMB A;  2EFJ A;  4N3Y B;  1EDL A;  4K35 A;  2BEZ F;  2D2C D;  5AW6 B;  1KB9 H;  1KOR A;  3B4S A;  3GLM A;  4OWF A;  2N6Z A;  2FVA A;  1PP9 G;  1VF5 B;  4DCK A;  5KLV K;  2Q3E A;  2BAS A;  2KI7 B;  1S9K D;  4D6T E;  2Z5H A;  3PTZ A;  1YBK A;  2N1T B;  3DS3 A;  3PP5 A;  2K37 A;  3G29 A;  1GD2 E;  3AEG C;  3H1K G;  4QMA A;  1L4A C;  3AE1 C;  3CCS P;  2N6Y A;  4KT0 J;  1YI2 P;  4DJG A;  1JY3 P;  3O6Q B;  1LTJ B;  2N5I A;  3VP9 A;  3VN0 A;  2HR3 A;  2CWO A;  2KG8 A;  1PP9 J;  1KYO H;  1LT9 C;  2E5T A;  3TGU E;  2JEE A;  5HV8 A;  1MKM A;  4H44 D;  1VHN A;  1NTK D;  3U59 A;  5CZD B;  1K73 Q;  3DS5 A;  3PHL A;  5GTH E;  3NY7 B;  3BCC D;  1MZ8 A;  1AQT A;  1BCC D;  3U1A A;  4WY4 A;  1J1D C;  2XNX A;  2G3A A;  3H1H D;  5AW9 B;  1FDI A;  1R5S A;  2IZ0 A;  2JBG A;  1X0T A;  2J5U A;  3L75 J;  3USS A;  1L0I A;  1VQ6 P;  4GKG A;  1EDJ A;  2GZI A;  2GDX A;  2FY8 A;  3Q2Y A;  1MFT A;  3IF4 A;  3TGU D;  1FBM A;  2E75 C;  3MHV A;  2FBW C;  1SFC B;  3BCC E;  3T97 B; 
#chains in the Genus database with same CATH homology
 1VQL P;  3DTJ A;  5HGM A;  3VRL C;  3DS2 A;  1S72 P;  1VQ4 P;  2ONT A;  1E6J P;  3WBH A;  2QEX P;  3MGE A;  4WYM A;  2OTL P;  3G21 A;  3G28 A;  3H4E A;  1A8O A;  4IPY A;  2M8P A;  4PH1 A;  1M6E X;  3E2D A;  2KOD A;  2XV6 A;  4U0B A;  4PH0 A;  1M6N A;  1VQK P;  1AUM A;  2E1M A;  1Q86 Q;  3DPH A;  3DS3 A;  2LF4 A;  1KD1 Q;  1W2B O;  3CCQ P;  3G29 A;  2QA4 P;  1PEM A;  4GR6 A;  2PEK A;  2BUO A;  3NTE A;  2Z45 A;  2DGY A;  5BS1 A;  2OTJ P;  2Z46 A;  1VQN P;  3I56 P;  3CXC O;  2BHV A;  3CCS P;  3CPW O;  3CD6 P;  3HZQ A;  4XFZ A;  1YHQ P;  3HYB A;  2PEJ A;  4U0E A;  4XRO A;  2M8N A;  4U0F A;  3CCU P;  1YI2 P;  2Z44 A;  3H47 A;  1N8R Q;  1M74 A;  4U0A A;  4COC A;  3P05 A;  2XT1 A;  1VQO P;  2PY8 A;  1PEQ A;  1BAJ A;  3G4S P;  1RNI A;  2PEQ A;  2BQ1 E;  1VQ9 P;  1IUQ A;  2CWO A;  2P9X A;  4M0I A;  5DCK A;  1Q81 Q;  4COP A;  4XFX A;  1VQ8 P;  2L6E A;  1KC8 Q;  4XFY A;  1K73 Q;  3DS5 A;  5BS2 A;  2JYL A;  1YJN P;  1RO0 A;  5I4T G;  1EIA A;  3CC4 P;  3CCR P;  2JYG A;  1YJ9 P;  3B5I A;  1RO2 A;  2PEN A;  1K9M Q;  2PEM A;  2PEO A;  3G1I A;  3LRY A;  1K8A Q;  2PEI A;  1M90 Q;  3RG6 C;  3I55 P;  3CC2 P;  3CC7 P;  3CCV P;  1K30 A;  3G26 A;  4QNB A;  5HGL A;  3CCL P;  2XXM A;  1JJ2 O;  4U0C A;  1PEO A;  1M1K Q;  3G1G A;  3H0D A;  3OW2 O;  1A43 A;  3CME P;  2EIA A;  3DS4 A;  1VQ7 P;  1YIJ P;  2M8L A;  5HGO A;  3CMA P;  1VQP P;  2OAR A;  5F2N A;  1EOQ A;  4GR2 A;  3CCE P;  1QVF O;  1VQ6 P;  2JO0 A;  1NJI Q;  3M1M A;  1VQM P;  2EG5 A;  1Q82 Q;  3DS0 A;  4U0D A;  4XRQ A;  3CCJ P;  1VQ5 P;  1YJW P;  3G71 P;  3G6E P;  1PEU A;  1QRJ A;  1D1D A;  1QVG O;  1YIT P;  1Q7Y Q;  3Q20 A;  3DS1 A;  1KQS O;  5F2K A;  5F2O A;  3CCM P;  3G0V A;  1ZMB A;  5HGN A;  5JPA A;  2EFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...