1NJIQ

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1njiQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1njiQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1njiQ03
3CCVP 3G6EP 3I55P 2OTJP 1YJWP 1QVFO 2QA4P 1KD1Q 3CC4P 3CD6P 3CC2P 1VQ5P 1VQ7P 1YIJP 1K8AQ 1VQMP 1VQOP 1K73Q 3CMAP 3CCSP 1N8RQ 3OW2O 3CCJP 1Q82Q 1VQKP 1W2BO 3CMEP 2QEXP 3G4SP 3CCQP 1VQPP 1VQ4P 1VQ6P 1VQNP 1QVGO 1K9MQ 1NJIQ 3I56P 1M1KQ 1Q86Q 3CPWO 1KC8Q 2OTLP 3CCLP 3CCEP 1KQSO 1Q81Q 1YJ9P 3CCRP 3G71P 1YITP 1Q7YQ 3CCMP 1M90Q 3CC7P 3CCUP 1VQLP 1JJ2O 1YHQP 1YJNP 1VQ8P 1VQ9P 1YI2P 3CXCO 1S72P
chains in the Genus database with same CATH superfamily
2C0XA 1LTJC 2IYOA 2K0YA 4TLFA 3L73G 3CD6P 1LTJB 3CC2P 4JQ0D 2N9BA 2H88C 2O1KA 2LMLA 3MUDC 4U3FE 2R5DA 1GL2D 2IBZD 3CCRP 1NU1D 1SQBD 1A8OA 4UHPB 2PEQA 5KLVJ 3E7KA 1YJNP 3SFEC 4TT3H 3ABVC 1NVOA 2E75D 2JU1A 4UB8E 1SQXD 3CCSP 1L0NJ 3H1LG 5AW0B 1HJBA 2M0BA 5AVZB 3P05A 3P8CD 2JJLA 3RK3D 3GZMA 4MN4C 3P7KA 3MD0A 2YMYA 4WVZA 3A7OA 1FZGA 5KJ7D 4Z1MH 3CCUP 1OFCX 1P84I 2QJKC 3BATA 3IF4A 1SQPG 2QJKB 5AVRB 3KQGA 4U0FA 3M0AA 2BCCG 5CBOA 2KZIA 2ITAA 1DD3A 3EQ2A 1NTMG 1A43A 1PFIA 2L9FA 3KYQA 3F89A 3RK2D 3B8EB 1H89A 1MV8A 2KB7P 1AFOA 3TGUD 4L74A 4HB1A 1VQOP 3H1IE 2GZGA 3GMAA 3V4QA 2BEQD 3BCCG 3NMDA 3SWFA 5AW1B 4LC1A 1N2DC 1KV4A 3GG2A 1KQLA 5CCGC 1E6JP 1BCCJ 2Z46A 4PD4E 3JCUH 2YKQA 4GR2A 5GTHE 2K0XA 1X22A 4HJGH 1ZOYC 3L73D 1IUQA 5DJUB 3B5ND 2FFDC 1KMIZ 3GF3A 1R5SA 2FFDB 3G71P 4BPFA 1NTZE 4R0MA 3DTJA 2YKPA 2M5AA 2RH0A 5EW5E 4O9BA 1CW5A 4BRYB 2QEXP 5KAIE 5HV8A 4ASVA 3Q5SA 3H1LD 3CCLP 2YIUC 2OGUA 1L0LD 1G2CA 2LKIA 2YIUB 1KYOH 2E43A 2ERHA 2CQ8A 4COCA 3A5TA 2ONTA 3AEDC 2KNCA 2O01H 1ZN5A 1HF9A 2YXRB 1ZNVA 2QE7H 1VQNP 2PGDA 2VRSA 1ZR4A 1S5LX 5APQA 1FS0E 1E0HA 2HLOA 2P58A 2WT7B 1NTMD 2JYGA 3L70J 1QVFO 4YXDC 4UB6E 3Q5RA 4AYCA 3H1IG 2LIUA 1PEOA 3GHGC 3GHGB 1LP1A 3R4YA 2H43A 2ZT9D 2N1TA 1JO5A 3CLQA 1ZRTE 1SQVJ 1EC5A 1SQQE 1AQTA 3Q2YA 2XZ1C 1EOQA 5CCHC 2FQ0A 2CPSA 3PRJA 1GZLA 3V4WA 1NJIQ 4H0LC 5APTA 1FAVA 2A45H 1KYOD 2P10A 4GODA 2VLOA 4H0LB 4I7ZC 1YITP 1X0TA 4HYTB 2R3CA 4I7ZB 2LTEA 1UJZA 3EFGA 1NTZG 2K9JA 2O01N 1NTKJ 1K04A 5AVVB 1NU1J 3KXDA 3PHLA 1M1JC 1SQBJ 1FJPA 3DS2A 4XFZA 1PGJA 3NY7B 1M1JB 1YBKA 2WSFJ 3USSA 1IMPA 2WPRA 1JMBA 2CPBA 3CCEP 5KLVK 2ZYDA 1T2KD 2IFMA 1LNQA 1L0NK 2JGPA 1LGHB 2HYNA 3N7NA 4D6TE 4OH8B 4XFXA 1VQMP 3CX5H 2E5YA 2AXTH 2NO8A 2KGCA 3HE4A 5HGOA 5E79H 5AVYB 2GYKA 4KT0J 2KOGA 4OGQC 3EWKA 2QIWA 4OGQB 1SFCC 5H2FE 1AYIA 1SFCB 2L6EA 3I55P 1HJ0A 4IL6E 2JBGA 1VQKP 1OR5A 3TGUJ 2PENA 2W6AA 1QL1A 5AW7B 2B89A 1RE3C 1OWAA 5APWA 1NAYA 1SQQG 2KR5A 2BQ1E 2IZ0A 1CZQA 3IN6A 2FACA 1FBMA 2A06E 4IFDK 3G1IA 1YJ9P 1LTTC 4ZKPA 2RMZA 3HRNA 4RKUJ 3L73J 2VLPA 5BVZA 1MZ8A 3A0HE 1CSBA 5AW5B 2OQQA 1Y47A 2QRXA 3CX5D 4RO0A 1Y9BA 1W2BO 1MUUA 1M74A 1XTGB 3HYBA 4YPCA 3VMZA 1LT9A 2FYUE 1KFNA 3Q5PA 1USEA 4DG9A 1IFJA 1PP9E 1RY3A 3H1LJ 2EFJA 1ZXGA 1L0LJ 3RGUA 4D6TG 1KB9H 1L0HA 1BGYE 2KOPA 3B71A 1SQPJ 1JMMA 3L74D 4DJGA 3G28A 3FGAD 1FZFA 2POHA 3M1MA 1M6EX 4L75A 3KZIH 1DEBA 2OYHA 2BCCJ 2ZVOB 2WPTA 1R5LA 4GIFA 2WWWA 4GOFA 3ZDMA 1Q90D 4I6MC 1NTMJ 4M0IA 2KG8A 4XA4A 3GZLA 4KJMA 4N3YB 3OJAB 2M5RA 5BS2A 1AA0A 2N50A 1MFZA 5BU8B 4K35A 2HPCB 3H1HE 5KP8B 2IDBA 1KB9I 2OYOA 1NKZB 1GW3A 2L22A 2PAJA 1ZRTD 3PP5A 2KOQA 4C46A 1GK4A 1M56D 4OWFA 3E1RA 1P84E 2B87B 1L4AA 2A06G 1SQVK 1E79H 2GZFA 2W6JH 3L72D 2JEEA 2L5GB 1EDJA 4ZNCA 2XV5A 1JNMA 2VSQA 4JF7A 2E76C 2AEJA 2E76B 1Z6MA 3GW6A 1RQUA 4NPDA 2MJZA 2V7QH 3I56P 2ZXEB 3CE7A 3GJNA 1NOHA 2HFED 2FYUG 5GTIH 1NU1K 1S3JA 1SQBK 1PP9G 3H1KD 1H8AA 1Z56A 1WT6A 1SQXK 1EIAA 1ZV8A 1DNYA 1BGYG 5B5EE 1QEXA 2EHSA 1N7SC 1MKMA 1BE3E 1MZ9A 2CNRA 1NO4A 5F2NA 4HKZH 1N7SB 3CC7P 3H6PA 3E2DA 2IX7C 2NRGA 2GZJA 4EIJA 1ZR2A 5HGLA 2CG5B 2JAZA 2P67A 1LTIC 2Q3IA 1LT1A 3CCQP 1KTMA 2YNYA 1S9KE 2KG6A 3L71E 5CHXA 1TU3F 2GA1A 1NQ4A 1FZCA 1GK6A 1EMVA 2ZVNB 2WTYA 3KDPB 4WY4C 1SLQA 2E1MA 3M0DA 3H1HG 4WY4B 2V4HA 2OYIC 3AE5C 4GOEA 2OYIB 1K30A 2WMMA 1VDFA 2Q3EA 2LPKA 1VF5C 2KSJA 2IBZI 3DS0A 4GKGA 3FX0A 3G1GA 1G1IA 2BEZF 2GDYA 1VF5B 4BPGA 2Z5IA 1H0TB 3G3ZA 1YI2P 1ZP0C 2PP6A 1GTWA 2KGDA 2KZJA 1GL2A 3AE8C 3MZWB 1W5CE 1IO4A 1GW4A 3HE5B 1CI6A 2FQ2A 1URQC 5AVTB 4ASWA 1NTKD 3AE7C 1URQB 3B5IA 2E76D 2NPSC 2HODA 2WZ7A 1N73C 2KOSA 1SP4A 2WSSH 2NPSB 1N73B 2I8DA 1X8YA 2G3AA 3C9IA 1VKUA 4N78D 3A2AA 5KJ7A 5CZDB 4MRTC 2YMKA 5KAFH 1OMIA 1YTZI 5CMZA 1L0LK 5APUA 1BE3G 3WMM0 1BGYD 4GR6A 2MKVA 1RH5B 2ZAEB 3G6EP 3B4QA 3VMYA 3L74J 5B66E 2WSCJ 1KILE 1DEEG 2QJPC 5TJHA 1DIPA 1G2CB 2FVAA 2QJPB 1AVOA 2ZYGA 3RG2A 2KNCB 4GT1A 3L71G 1JTHB 1IC2A 4U7JA 3TNUA 2KWLA 3G9RA 1X3OA 1J1EC 4XE5B 1Q2NA 1J1EB 1RNIA 3OA7A 5BU5A 2JWDA 1JY3O 2LR2A 1OXZA 2Q6QA 2MVVA 3BVHA 1RQVA 1IFPA 4DCKA 2JYLA 4WY4D 3LW5J 3H32B 4RJTA 3RBXA 3B5NA 3DPHA 3A0BE 3L72J 1QLED 1QGKB 3OW2O 1LTJA 1VF5D 4ZMDA 4NPEA 5AW9B 3V2QA 2JR8A 5KP6B 2GDWA 2O3JA 2Y0EA 2I1KA 2K1AA 2KK7A 1GDTA 4U3FG 3HD7C 1BAJA 1PPJE 3H1JE 3MUDA 1AF8A 3HD7B 2N5HA 5TISH 4LGDE 3VP8A 1URQD 2FADA 3V2PA 3VOPA 4L73A 3H1KJ 3TSIA 1PGPA 4ZKUA 4F37A 3M06A 1D1DA 1Q7YQ 2PEMA 5AW8B 1LTBC 1KILC 3CCVP 1KZUB 5KLVE 1HTLC 1KILB 1E5WA 2WITA 2H7HA 2WPQA 3I5CA 2KYVA 1S5LH 5EFWB 1SQPD 1L0NE 2DNWA 2OTLP 2IPPA 5DCKA 3G21A 3EJDA 1HH0A 3BRVB 1RF1C 4UB8H 2BCCD 1RF1B 2QJYC 1RE4C 1S9KD 4WBAA 3HZQA 1OVRA 2QJYB 3LMOA 1JB0J 2W27A 4H2WC 1IK9A 3TF5A 3H25A 1VQ4P 3D6ZA 3EJBA 3GF7A 1KC8Q 1KYOI 2FQ1A 3H0DA 2W90A 3AE3C 3M9HA 2V7QJ 4DOJA 3HTKB 1HBWA 3BCCD 4I1LA 2CWOA 5CCGA 2ZJSE 3K5BA 3HUSC 1QX8A 3FWNA 3CMEP 3W67A 3HUSB 1HGZA 2N6YA 5CCGD 2FFDA 3H1JG 4H2XC 2YO2A 4U3FD 2W6BA 2QA4P 1BCCE 1NKNA 3MP7B 3SFDC 3FWLA 3AEAC 2GUVA 3CXHE 3Q20A 3VP9A 2MY5A 2E74C 4BRYA 3HD7D 2SPZA 3RBZA 1EZVE 2E74B 2GZEA 4PD4H 1PP9J 1KB9E 1IJDB 5GTHH 2VLNA 3L75E 2JKVA 5AVSB 2MR8A 5KLVG 5DJTB 3DS1A 1BGYJ 1LT9C 1T3JA 2K94A 1LT9B 1HQBA 1VQPP 2A45I 4WB4A 2K0DX 1L0NG 1PGQA 4W80A 2M8RA 5AW3B 4XROA 2PRRA 2Y9ZA 1GXHA 5KAIH 1IK7A 2FYZA 4PWVB 2WT7A 3CMAP 2Q1KA 2RKLA 3U59A 1OW6A 1PV3A 1AUMA 1OVVA 5HGNA 4COPA 3GHGA 3H1ID 7CEIA 2WSCH 2QG4A 1HVVA 2AFDA 3CX5I 1KD1Q 3L70E 5APVA 2H89C 2XT1A 4PD4D 2XZRA 5CCHA 3VN0A 3T97B 2QNWA 1NAFA 4UB6H 4PJ0E 3QWOC 4DZOA 1JM0A 5AVQB 5CCHD 3WU2E 3II6A 1KN7A 1SQVE 5I4TG 1K8AQ 1KQFB 4H44C 1BCCG 1NTZD 4H0LD 1PGOA 3L37A 4H44B 1VQ6P 2XZ0D 3M91A 1M1JA 3S9OA 2PFXA 3LW5H 2XV6A 1EZVG 2R44A 4NPFX 1DH3A 1GPJA 1X9VA 2VLQA 3L75G 3O6QB 1RF0C 1NU1E 3U43A 4PH0A 1SQBE 3WUUA 3NFQA 2PEKA 4A7PA 1T6AA 4PXHB 3IFMA 1SQXE 2JB0A 3RL0g 5M1BA 1FJKA 2LOLA 3P8CE 3DS3A 3RK3E 1SFCA 1KORA 1Q82Q 1LWUC 3H47A 1QVGO 1GMJA 1LWUB 4OGQD 2M8LA 1Q86Q 4L76A 1SFCD 4DT0A 3IAOA 2BUOA 5F2OA 3G0VA 1FDOA 1XTCC 1N7LA 1S1CX 2OTJP 1JY2P 1RE3A 2KORA 1G1JA 2FKWB 3CCJP 3BCCJ 2GZIA 3L70G 2YKOA 1SQQD 5H2FH 2D2CC 1IMQA 2D2CB 5AW2B 2PY8A 3TGUE 4IL6H 3LIEA 3AE2C 5AVXB 5L8RJ 4IL6X 2QM7A 1SQVG 1LJ2A 1EXIA 4U3FJ 1PEMA 1AVYA 2KS1B 2WSEH 3M9QA 4C7NB 1VL2A 1NTKK 1JCCA 5HVCA 3CWBE 5KAFE 1VQ9P 2K93A 2KGEA 3RG6C 2XKMA 3SWKA 2W8ZA 3VTPC 4R4LA 2FXMA 3S4RA 2KIKA 1NU1G 2E75C 3GLMA 1SQBG 2E75B 4Y28J 3PTZA 4D6TD 2Y0CA 1T3UA 3A3YB 1ZW0A 4XRQA 1SQXG 2PNGA 3H1LE 2K9YA 2WQYC 1L0LE 1A02J 2X2BA 3W68A 1L0IA 2K92A 2XDJA 3AEEC 3G29A 1JOCA 5C39A 1USDA 2Q5UA 3D71A 2CK3H 3EFFK 1R8EA 2JO0A 3H1IJ 4JPZB 1HUCA 3C8VA 1D7MA 2HPCA 3L35A 3UIAA 1N8RQ 1UIXA 1NWQA 1IFIA 4N6JA 3JCUE 1M1KQ 3OAKA 1J1DC 1KQSO 1J1DB 2M8NA 2B87A 3TGUG 1AJYA 2Y9YA 5KLIC 1YTZT 1NHLA 2JDIH 1DV5A 1F80D 5KLIB 3DS5A 2A06D 2O1JA 3Q1MA 2LF4A 2QM8A 1VQ7P 2D2CD 5JPAA 3GKLC 4Y99C 3JSVC 3TDKA 4Y99B 3H1JJ 4BWNA 1NTZJ 5CBNA 2C9LY 2IFNA 1GU4A 1FR2A 4U0CA 3WBHA 1JJ2O 1EQ7A 3CWBG 1P84H 5AW6B 2FYUD 2ZFCA 1KYOE 3S1KA 1YIJP 3DS4A 1T8KA 2FHSC 1PP9D 1S4XA 2FVFA 1M8OB 1Q81Q 1BDDA 2LXBA 1S5LE 3QH9A 4XFJA 2I1JA 2JWAA 2KUBA 2N5IA 2M5AB 3SWYA 1FDIA 1N7SA 1K05A 1U7MA 1U7JA 2ZYAA 1YJWP 3BRTB 4U0AA 1L0LG 2JP3A 1JY2N 3L36A 4C7RA 1N7SD 1M57D 1SQPK 3LRYA 1M90Q 1VHNA 2R32A 4H2YC 3D70A 2JQ4A 2Q7CA 2LL8A 2EIAA 4GDOA 1AV1A 1OVUA 1KLPA 5B5EH 1NTMK 4IZ6A 1KQGB 5F2KA 1UNKA 2PEOA 4WY4A 2K2QA 5KP7B 3H1HD 1X79B 3CPWO 2XXMA 2EHTA 1BSNA 2OYIA 1AQ5A 1SQQJ 2NZ2A 1P84D 1Y8AA 2ZT9C 3C1LA 1CEIA 1YQ3C 1EXJA 2ZT9B 1YQ4C 1H0TA 1PZQA 2FYNC 2XNXA 3Q3DA 2KGAA 2FYNB 2K37A 1PL5A 3PH0A 1LP1B 2N1TC 4JBZA 3HE5A 3P32A 2N1TB 1FOSF 2N9YB 1URQA 2Q9IA 1LTSC 3V2NA 2NPSA 2E42A 1N73A 2KLVA 1EDKA 3CWBD 2NPSD 2MF4A 3AEBC 2C0WA 2KP8A 3VYIA 3L75J 3CX5E 3JC22 3CI9A 2K9JB 2AXTE 1VPCA 1T2KC 4D6TJ 5E79E 3NTNA 4JYCA 4R4MA 1BE3D 4W7ZA 2J58A 4QMAA 4RESB 1KFMA 1JTHA 2B9BA 1PIXA 3CXCO 4WWIA 1BSHA 2ZXXA 1FC2C 3L71D 2GUSA 2MR7A 5APYA 5EJDA 2WPVB 1M6NA 3L74E 2FXOA 3HE4B 2AVAA 1J2JB 3FXDA 2P2UA 3AE9C 3SSUA 5B66H 2Y0DA 4KHXA 2WSEJ 3KHUA 1IFDA 3AE6C 2FVEA 1GD2E 3H32A 2FAEA 2A45G 1HGVA 3E1IA 3CC4P 1VQ5P 4HKGA 5HGMA 3NXSA 4H13C 3PJSK 2FBWC 2PEJA 4H13B 3G4SP 2L0QA 2R5BA 1JY3P 1M7LA 4U0EA 3CCMP 1PPJG 3HD7A 1IFNA 2H8PD 2N1TD 1RO0A 4IFMA 3L72E 1NTZK 3M9BA 3BASA 4NEOA 2UWJE 2QSIA 2FYUJ 1FOSE 1JUNA 2G8YA 4PV1C 1ZLLA 2P1JA 3ITKA 4PV1B 3A0BH 2FY8A 4K3AA 1VQLP 4W7YA 2ROQA 2K88A 3V2RA 1FZEA 1PEUA 3MGNA 4BPHA 3G26A 1NGMB 3CL3D 5APSA 1KILA 2CGQA 3KZIE 1SQXJ 3LIDA 1LTAC 1T8ZA 3H1KE 1KILD 1U57A 1RO2A 1FU1A 1OZHA 2M3BA 1RF1A 2N98A 1RE4A 4PH1A 3AECC 3MHVA 4IFFA 1GU5A 2FXPA 2YO3A 1DD4A 1OIPA 3L74G 4JYBA 4PD4I 1YYCA 1N86A 1OW8A 1PEQA 5CJ0A 2OYHC 3TK1A 3H1HJ 1JY2O 3AE1C 3RL0C 2OYHB 2XNDH 3HTKA 3RL0B 2R3SA 2KLUA 1HY8A 2Z4EA 1DX7A 3HUSA 1SQQK 1MFTA 3VMAA 4AQRD 2PEIA 1RHZB 3B4SA 4H13D 3AEFC 2HR3A 2P7JA 1L2PA 5GTIE 4EOTA 1K73Q 1PPJD 3H1JD 4OVNF 1L4AC 2GM4A 5AVWB 1NYHA 1L4AB 3L72G 2JO1A 3CWBJ 5BS1A 4YTPC 3N4XA 4EI2A 3WUVA 2AXCA 3FXEA 3IR9A 1WRGA 3AEGC 2J59M 4BXLA 2N6ZA 4PV1D 2E74D 1NTKE 1BDCA 2IBZE 4QNBA 4IPYA 4YXWH 5KLVD 2AFEA 1BE3J 3V6IA 2YXQB 4WYMA 2AEFA 3H1KG 3VMXA 2W83C 2EG5A 3NTEA 1L0ND 1VQ8P 4N78E 3CXHH 5CJ4A 2HG5D 1NH4A 1LTGC 2BHVA 3VRLC 1QL2A 4CA3A 2JU2A 3L71J 2DGYA 2LXCB 1JY3N 3AE4C 3U1AA 1H88A 3D6YA 2MVUA 2J5UA 2B88A 2KOOA 2QVAA 3KPEA 1FZCC 4QKOA 4CPGA 1FE6A 1FZCB 3RL0D 3CXHI 1IZNB 3R2PA 3T97A 2K3RA 5AW4B 3M0DC 1EZVI 2OARA 5KTBA 2M3EA 4M3LA 2IZ1A 5APXA 2KSEA 1SVFA 1OX3A 1BCCD 5AVUB 1SS1A 3CXHD 1UIIA 2BASA 2KW2A 1YHQP 1GL2C 1S72P 4H44D 1EZVD 2OTKE 1L4AD 3L73E 2KI7B 2WVRA 1GL2B 2O01J 2KXPB 4IOIH 1KB9D 3O6QA 5K5GB 1JCDA 2FYUK 2M8PA 1CI6B 1S2EA 4I2LC 3L75D 4PJ0H 1NTKG 4U0DA 1RF0A 2IBZG 3TYYA 1K9MQ 1W2EA 2LKMA 3WU2H 3A0HH 1HWTC 2HODB 2Z5HA 4HH2A 2C9NY 4LLHA 3MTUE 3RK3C 1QRJA 3RK3B 2P9XA 2AF8A 1IFMA 5KJ7C 1FDMA 3P8MC 4EYYQ 5KKZC 2Z45A 1GXGA 2E5TA 5KKZB 2GDXA 4B86A 2L4BA 4EDFA 3H4EA 1LWUA 1A02F 1EDLA 2WPSA 3O8ZA 2DW3A 3PLNA 2MD9A 1FZBA 1EDIA 1SQPE 1WMKA 2RN0A 2K5XA 2XU6A 3U1CA 2WSFH 3RK2C 4U0BA 1OW7A 4AUWA 2BCCE 3RK2B 1ZMBA 2IYPA 2KG9A 1NTME 3L70D 3TNUB 3F5HA 3V5BA 2KODA 3WUTA 2Z44A 3MIWA 3L4FA 2L91A 5TISE 1ACPA 3BCCE 1SQVD 1JEKA 2AEMA 2KS1A 1FZAA 3MGEA 2LIWA 3B5NC 4XFYA 1ZMEC 4C7NA 1BXIA 3B5NB 3EJEA
chains in the Genus database with same CATH topology
1PEUA 3DS3A 1YJWP 3G26A 1RNIA 2E1MA 3CD6P 2BQ1E 1EOQA 4U0AA 3CC2P 4GR2A 2M8PA 3CMAP 1Q82Q 4QNBA 3H47A 4U0DA 1VQ4P 1AUMA 4IPYA 1QVGO 1IUQA 1K30A 3G29A 1NJIQ 2M8LA 5HGNA 1K9MQ 1Q86Q 1KC8Q 3H0DA 3LRYA 3G1IA 4WYMA 4COPA 1YJ9P 3DS0A 3G71P 3CCRP 1YITP 3G1GA 2JYLA 2BUOA 5F2OA 3G0VA 1A8OA 1RO2A 2EG5A 2PEQA 3NTEA 1M90Q 1QRJA 1YJNP 1VQ8P 1YI2P 3CXCO 2JO0A 2P9XA 3DTJA 2EIAA 2CWOA 2OTJP 1KD1Q 3DPHA 2Z45A 4PH1A 3DS2A 1M6NA 3CCSP 4XFZA 3OW2O 1N8RQ 3CCJP 2BHVA 5F2KA 2PEOA 3VRLC 1W2BO 3CMEP 2QEXP 1M74A 3P05A 3HYBA 2XT1A 2DGYA 3I56P 1M1KQ 3CPWO 2XXMA 3CCLP 3CCEP 1KQSO 3H4EA 2PY8A 2M8NA 3B5IA 1PEQA 1BAJA 3CCUP 4COCA 2ONTA 2EFJA 3DS5A 2LF4A 2QA4P 3CC4P 5I4TG 1VQ5P 1VQ7P 1K8AQ 5HGMA 4XFXA 5JPAA 1VQMP 4U0BA 2PEJA 1EIAA 3G4SP 1VQNP 1VQ6P 4U0FA 3Q20A 1ZMBA 1PEMA 5HGOA 2XV6A 1D1DA 1A43A 4U0EA 1Q7YQ 3CCMP 5F2NA 3CC7P 2PEMA 4U0CA 2PEIA 3E2DA 4GR6A 3G28A 3WBHA 1JJ2O 2KODA 1VQ9P 5HGLA 2OARA 3RG6C 3M1MA 3CCVP 1M6EX 2L6EA 3G6EP 2JYGA 3I55P 2Z44A 1QVFO 1YIJP 3DS1A 3DS4A 1VQOP 1K73Q 1RO0A 4PH0A 1VQKP 3CCQP 1PEOA 1VQPP 2PEKA 4M0IA 2PENA 2OTLP 5DCKA 1Q81Q 3G21A 5BS1A 3MGEA 4XROA 5BS2A 4XFYA 4XRQA 1VQLP 1YHQP 3HZQA 1E6JP 1S72P 2Z46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV P;  3G6E P;  3I55 P;  2OTJ P;  1YJW P;  1QVF O;  2QA4 P;  1KD1 Q;  3CC4 P;  3CD6 P;  3CC2 P;  1VQ5 P;  1VQ7 P;  1YIJ P;  1K8A Q;  1VQM P;  1VQO P;  1K73 Q;  3CMA P;  3CCS P;  1N8R Q;  3OW2 O;  3CCJ P;  1Q82 Q;  1VQK P;  1W2B O;  3CME P;  2QEX P;  3G4S P;  3CCQ P;  1VQP P;  1VQ4 P;  1VQ6 P;  1VQN P;  1QVG O;  1K9M Q;  1NJI Q;  3I56 P;  1M1K Q;  1Q86 Q;  3CPW O;  1KC8 Q;  2OTL P;  3CCL P;  3CCE P;  1KQS O;  1Q81 Q;  1YJ9 P;  3CCR P;  3G71 P;  1YIT P;  1Q7Y Q;  3CCM P;  1M90 Q;  3CC7 P;  3CCU P;  1VQL P;  1JJ2 O;  1YHQ P;  1YJN P;  1VQ8 P;  1VQ9 P;  1YI2 P;  3CXC O;  1S72 P; 
#chains in the Genus database with same CATH topology
 2C0X A;  1LTJ C;  2IYO A;  2K0Y A;  4TLF A;  3L73 G;  3CD6 P;  1LTJ B;  3CC2 P;  4JQ0 D;  2N9B A;  2H88 C;  2O1K A;  2LML A;  3MUD C;  4U3F E;  2R5D A;  1GL2 D;  2IBZ D;  3CCR P;  1NU1 D;  1SQB D;  1A8O A;  4UHP B;  2PEQ A;  5KLV J;  3E7K A;  1YJN P;  3SFE C;  4TT3 H;  3ABV C;  1NVO A;  2E75 D;  2JU1 A;  4UB8 E;  1SQX D;  3CCS P;  1L0N J;  3H1L G;  5AW0 B;  1HJB A;  2M0B A;  5AVZ B;  3P05 A;  3P8C D;  2JJL A;  3RK3 D;  3GZM A;  4MN4 C;  3P7K A;  3MD0 A;  2YMY A;  4WVZ A;  3A7O A;  1FZG A;  5KJ7 D;  4Z1M H;  3CCU P;  1OFC X;  1P84 I;  2QJK C;  3BAT A;  3IF4 A;  1SQP G;  2QJK B;  5AVR B;  3KQG A;  4U0F A;  3M0A A;  2BCC G;  5CBO A;  2KZI A;  2ITA A;  1DD3 A;  3EQ2 A;  1NTM G;  1A43 A;  1PFI A;  2L9F A;  3KYQ A;  3F89 A;  3RK2 D;  3B8E B;  1H89 A;  1MV8 A;  2KB7 P;  1AFO A;  3TGU D;  4L74 A;  4HB1 A;  1VQO P;  3H1I E;  2GZG A;  3GMA A;  3V4Q A;  2BEQ D;  3BCC G;  3NMD A;  3SWF A;  5AW1 B;  4LC1 A;  1N2D C;  1KV4 A;  3GG2 A;  1KQL A;  5CCG C;  1E6J P;  1BCC J;  2Z46 A;  4PD4 E;  3JCU H;  2YKQ A;  4GR2 A;  5GTH E;  2K0X A;  1X22 A;  4HJG H;  1ZOY C;  3L73 D;  1IUQ A;  5DJU B;  3B5N D;  2FFD C;  1KMI Z;  3GF3 A;  1R5S A;  2FFD B;  3G71 P;  4BPF A;  1NTZ E;  4R0M A;  3DTJ A;  2YKP A;  2M5A A;  2RH0 A;  5EW5 E;  4O9B A;  1CW5 A;  4BRY B;  2QEX P;  5KAI E;  5HV8 A;  4ASV A;  3Q5S A;  3H1L D;  3CCL P;  2YIU C;  2OGU A;  1L0L D;  1G2C A;  2LKI A;  2YIU B;  1KYO H;  2E43 A;  2ERH A;  2CQ8 A;  4COC A;  3A5T A;  2ONT A;  3AED C;  2KNC A;  2O01 H;  1ZN5 A;  1HF9 A;  2YXR B;  1ZNV A;  2QE7 H;  1VQN P;  2PGD A;  2VRS A;  1ZR4 A;  1S5L X;  5APQ A;  1FS0 E;  1E0H A;  2HLO A;  2P58 A;  2WT7 B;  1NTM D;  2JYG A;  3L70 J;  1QVF O;  4YXD C;  4UB6 E;  3Q5R A;  4AYC A;  3H1I G;  2LIU A;  1PEO A;  3GHG C;  3GHG B;  1LP1 A;  3R4Y A;  2H43 A;  2ZT9 D;  2N1T A;  1JO5 A;  3CLQ A;  1ZRT E;  1SQV J;  1EC5 A;  1SQQ E;  1AQT A;  3Q2Y A;  2XZ1 C;  1EOQ A;  5CCH C;  2FQ0 A;  2CPS A;  3PRJ A;  1GZL A;  3V4W A;  1NJI Q;  4H0L C;  5APT A;  1FAV A;  2A45 H;  1KYO D;  2P10 A;  4GOD A;  2VLO A;  4H0L B;  4I7Z C;  1YIT P;  1X0T A;  4HYT B;  2R3C A;  4I7Z B;  2LTE A;  1UJZ A;  3EFG A;  1NTZ G;  2K9J A;  2O01 N;  1NTK J;  1K04 A;  5AVV B;  1NU1 J;  3KXD A;  3PHL A;  1M1J C;  1SQB J;  1FJP A;  3DS2 A;  4XFZ A;  1PGJ A;  3NY7 B;  1M1J B;  1YBK A;  2WSF J;  3USS A;  1IMP A;  2WPR A;  1JMB A;  2CPB A;  3CCE P;  5KLV K;  2ZYD A;  1T2K D;  2IFM A;  1LNQ A;  1L0N K;  2JGP A;  1LGH B;  2HYN A;  3N7N A;  4D6T E;  4OH8 B;  4XFX A;  1VQM P;  3CX5 H;  2E5Y A;  2AXT H;  2NO8 A;  2KGC A;  3HE4 A;  5HGO A;  5E79 H;  5AVY B;  2GYK A;  4KT0 J;  2KOG A;  4OGQ C;  3EWK A;  2QIW A;  4OGQ B;  1SFC C;  5H2F E;  1AYI A;  1SFC B;  2L6E A;  3I55 P;  1HJ0 A;  4IL6 E;  2JBG A;  1VQK P;  1OR5 A;  3TGU J;  2PEN A;  2W6A A;  1QL1 A;  5AW7 B;  2B89 A;  1RE3 C;  1OWA A;  5APW A;  1NAY A;  1SQQ G;  2KR5 A;  2BQ1 E;  2IZ0 A;  1CZQ A;  3IN6 A;  2FAC A;  1FBM A;  2A06 E;  4IFD K;  3G1I A;  1YJ9 P;  1LTT C;  4ZKP A;  2RMZ A;  3HRN A;  4RKU J;  3L73 J;  2VLP A;  5BVZ A;  1MZ8 A;  3A0H E;  1CSB A;  5AW5 B;  2OQQ A;  1Y47 A;  2QRX A;  3CX5 D;  4RO0 A;  1Y9B A;  1W2B O;  1MUU A;  1M74 A;  1XTG B;  3HYB A;  4YPC A;  3VMZ A;  1LT9 A;  2FYU E;  1KFN A;  3Q5P A;  1USE A;  4DG9 A;  1IFJ A;  1PP9 E;  1RY3 A;  3H1L J;  2EFJ A;  1ZXG A;  1L0L J;  3RGU A;  4D6T G;  1KB9 H;  1L0H A;  1BGY E;  2KOP A;  3B71 A;  1SQP J;  1JMM A;  3L74 D;  4DJG A;  3G28 A;  3FGA D;  1FZF A;  2POH A;  3M1M A;  1M6E X;  4L75 A;  3KZI H;  1DEB A;  2OYH A;  2BCC J;  2ZVO B;  2WPT A;  1R5L A;  4GIF A;  2WWW A;  4GOF A;  3ZDM A;  1Q90 D;  4I6M C;  1NTM J;  4M0I A;  2KG8 A;  4XA4 A;  3GZL A;  4KJM A;  4N3Y B;  3OJA B;  2M5R A;  5BS2 A;  1AA0 A;  2N50 A;  1MFZ A;  5BU8 B;  4K35 A;  2HPC B;  3H1H E;  5KP8 B;  2IDB A;  1KB9 I;  2OYO A;  1NKZ B;  1GW3 A;  2L22 A;  2PAJ A;  1ZRT D;  3PP5 A;  2KOQ A;  4C46 A;  1GK4 A;  1M56 D;  4OWF A;  3E1R A;  1P84 E;  2B87 B;  1L4A A;  2A06 G;  1SQV K;  1E79 H;  2GZF A;  2W6J H;  3L72 D;  2JEE A;  2L5G B;  1EDJ A;  4ZNC A;  2XV5 A;  1JNM A;  2VSQ A;  4JF7 A;  2E76 C;  2AEJ A;  2E76 B;  1Z6M A;  3GW6 A;  1RQU A;  4NPD A;  2MJZ A;  2V7Q H;  3I56 P;  2ZXE B;  3CE7 A;  3GJN A;  1NOH A;  2HFE D;  2FYU G;  5GTI H;  1NU1 K;  1S3J A;  1SQB K;  1PP9 G;  3H1K D;  1H8A A;  1Z56 A;  1WT6 A;  1SQX K;  1EIA A;  1ZV8 A;  1DNY A;  1BGY G;  5B5E E;  1QEX A;  2EHS A;  1N7S C;  1MKM A;  1BE3 E;  1MZ9 A;  2CNR A;  1NO4 A;  5F2N A;  4HKZ H;  1N7S B;  3CC7 P;  3H6P A;  3E2D A;  2IX7 C;  2NRG A;  2GZJ A;  4EIJ A;  1ZR2 A;  5HGL A;  2CG5 B;  2JAZ A;  2P67 A;  1LTI C;  2Q3I A;  1LT1 A;  3CCQ P;  1KTM A;  2YNY A;  1S9K E;  2KG6 A;  3L71 E;  5CHX A;  1TU3 F;  2GA1 A;  1NQ4 A;  1FZC A;  1GK6 A;  1EMV A;  2ZVN B;  2WTY A;  3KDP B;  4WY4 C;  1SLQ A;  2E1M A;  3M0D A;  3H1H G;  4WY4 B;  2V4H A;  2OYI C;  3AE5 C;  4GOE A;  2OYI B;  1K30 A;  2WMM A;  1VDF A;  2Q3E A;  2LPK A;  1VF5 C;  2KSJ A;  2IBZ I;  3DS0 A;  4GKG A;  3FX0 A;  3G1G A;  1G1I A;  2BEZ F;  2GDY A;  1VF5 B;  4BPG A;  2Z5I A;  1H0T B;  3G3Z A;  1YI2 P;  1ZP0 C;  2PP6 A;  1GTW A;  2KGD A;  2KZJ A;  1GL2 A;  3AE8 C;  3MZW B;  1W5C E;  1IO4 A;  1GW4 A;  3HE5 B;  1CI6 A;  2FQ2 A;  1URQ C;  5AVT B;  4ASW A;  1NTK D;  3AE7 C;  1URQ B;  3B5I A;  2E76 D;  2NPS C;  2HOD A;  2WZ7 A;  1N73 C;  2KOS A;  1SP4 A;  2WSS H;  2NPS B;  1N73 B;  2I8D A;  1X8Y A;  2G3A A;  3C9I A;  1VKU A;  4N78 D;  3A2A A;  5KJ7 A;  5CZD B;  4MRT C;  2YMK A;  5KAF H;  1OMI A;  1YTZ I;  5CMZ A;  1L0L K;  5APU A;  1BE3 G;  3WMM 0;  1BGY D;  4GR6 A;  2MKV A;  1RH5 B;  2ZAE B;  3G6E P;  3B4Q A;  3VMY A;  3L74 J;  5B66 E;  2WSC J;  1KIL E;  1DEE G;  2QJP C;  5TJH A;  1DIP A;  1G2C B;  2FVA A;  2QJP B;  1AVO A;  2ZYG A;  3RG2 A;  2KNC B;  4GT1 A;  3L71 G;  1JTH B;  1IC2 A;  4U7J A;  3TNU A;  2KWL A;  3G9R A;  1X3O A;  1J1E C;  4XE5 B;  1Q2N A;  1J1E B;  1RNI A;  3OA7 A;  5BU5 A;  2JWD A;  1JY3 O;  2LR2 A;  1OXZ A;  2Q6Q A;  2MVV A;  3BVH A;  1RQV A;  1IFP A;  4DCK A;  2JYL A;  4WY4 D;  3LW5 J;  3H32 B;  4RJT A;  3RBX A;  3B5N A;  3DPH A;  3A0B E;  3L72 J;  1QLE D;  1QGK B;  3OW2 O;  1LTJ A;  1VF5 D;  4ZMD A;  4NPE A;  5AW9 B;  3V2Q A;  2JR8 A;  5KP6 B;  2GDW A;  2O3J A;  2Y0E A;  2I1K A;  2K1A A;  2KK7 A;  1GDT A;  4U3F G;  3HD7 C;  1BAJ A;  1PPJ E;  3H1J E;  3MUD A;  1AF8 A;  3HD7 B;  2N5H A;  5TIS H;  4LGD E;  3VP8 A;  1URQ D;  2FAD A;  3V2P A;  3VOP A;  4L73 A;  3H1K J;  3TSI A;  1PGP A;  4ZKU A;  4F37 A;  3M06 A;  1D1D A;  1Q7Y Q;  2PEM A;  5AW8 B;  1LTB C;  1KIL C;  3CCV P;  1KZU B;  5KLV E;  1HTL C;  1KIL B;  1E5W A;  2WIT A;  2H7H A;  2WPQ A;  3I5C A;  2KYV A;  1S5L H;  5EFW B;  1SQP D;  1L0N E;  2DNW A;  2OTL P;  2IPP A;  5DCK A;  3G21 A;  3EJD A;  1HH0 A;  3BRV B;  1RF1 C;  4UB8 H;  2BCC D;  1RF1 B;  2QJY C;  1RE4 C;  1S9K D;  4WBA A;  3HZQ A;  1OVR A;  2QJY B;  3LMO A;  1JB0 J;  2W27 A;  4H2W C;  1IK9 A;  3TF5 A;  3H25 A;  1VQ4 P;  3D6Z A;  3EJB A;  3GF7 A;  1KC8 Q;  1KYO I;  2FQ1 A;  3H0D A;  2W90 A;  3AE3 C;  3M9H A;  2V7Q J;  4DOJ A;  3HTK B;  1HBW A;  3BCC D;  4I1L A;  2CWO A;  5CCG A;  2ZJS E;  3K5B A;  3HUS C;  1QX8 A;  3FWN A;  3CME P;  3W67 A;  3HUS B;  1HGZ A;  2N6Y A;  5CCG D;  2FFD A;  3H1J G;  4H2X C;  2YO2 A;  4U3F D;  2W6B A;  2QA4 P;  1BCC E;  1NKN A;  3MP7 B;  3SFD C;  3FWL A;  3AEA C;  2GUV A;  3CXH E;  3Q20 A;  3VP9 A;  2MY5 A;  2E74 C;  4BRY A;  3HD7 D;  2SPZ A;  3RBZ A;  1EZV E;  2E74 B;  2GZE A;  4PD4 H;  1PP9 J;  1KB9 E;  1IJD B;  5GTH H;  2VLN A;  3L75 E;  2JKV A;  5AVS B;  2MR8 A;  5KLV G;  5DJT B;  3DS1 A;  1BGY J;  1LT9 C;  1T3J A;  2K94 A;  1LT9 B;  1HQB A;  1VQP P;  2A45 I;  4WB4 A;  2K0D X;  1L0N G;  1PGQ A;  4W80 A;  2M8R A;  5AW3 B;  4XRO A;  2PRR A;  2Y9Z A;  1GXH A;  5KAI H;  1IK7 A;  2FYZ A;  4PWV B;  2WT7 A;  3CMA P;  2Q1K A;  2RKL A;  3U59 A;  1OW6 A;  1PV3 A;  1AUM A;  1OVV A;  5HGN A;  4COP A;  3GHG A;  3H1I D;  7CEI A;  2WSC H;  2QG4 A;  1HVV A;  2AFD A;  3CX5 I;  1KD1 Q;  3L70 E;  5APV A;  2H89 C;  2XT1 A;  4PD4 D;  2XZR A;  5CCH A;  3VN0 A;  3T97 B;  2QNW A;  1NAF A;  4UB6 H;  4PJ0 E;  3QWO C;  4DZO A;  1JM0 A;  5AVQ B;  5CCH D;  3WU2 E;  3II6 A;  1KN7 A;  1SQV E;  5I4T G;  1K8A Q;  1KQF B;  4H44 C;  1BCC G;  1NTZ D;  4H0L D;  1PGO A;  3L37 A;  4H44 B;  1VQ6 P;  2XZ0 D;  3M91 A;  1M1J A;  3S9O A;  2PFX A;  3LW5 H;  2XV6 A;  1EZV G;  2R44 A;  4NPF X;  1DH3 A;  1GPJ A;  1X9V A;  2VLQ A;  3L75 G;  3O6Q B;  1RF0 C;  1NU1 E;  3U43 A;  4PH0 A;  1SQB E;  3WUU A;  3NFQ A;  2PEK A;  4A7P A;  1T6A A;  4PXH B;  3IFM A;  1SQX E;  2JB0 A;  3RL0 g;  5M1B A;  1FJK A;  2LOL A;  3P8C E;  3DS3 A;  3RK3 E;  1SFC A;  1KOR A;  1Q82 Q;  1LWU C;  3H47 A;  1QVG O;  1GMJ A;  1LWU B;  4OGQ D;  2M8L A;  1Q86 Q;  4L76 A;  1SFC D;  4DT0 A;  3IAO A;  2BUO A;  5F2O A;  3G0V A;  1FDO A;  1XTC C;  1N7L A;  1S1C X;  2OTJ P;  1JY2 P;  1RE3 A;  2KOR A;  1G1J A;  2FKW B;  3CCJ P;  3BCC J;  2GZI A;  3L70 G;  2YKO A;  1SQQ D;  5H2F H;  2D2C C;  1IMQ A;  2D2C B;  5AW2 B;  2PY8 A;  3TGU E;  4IL6 H;  3LIE A;  3AE2 C;  5AVX B;  5L8R J;  4IL6 X;  2QM7 A;  1SQV G;  1LJ2 A;  1EXI A;  4U3F J;  1PEM A;  1AVY A;  2KS1 B;  2WSE H;  3M9Q A;  4C7N B;  1VL2 A;  1NTK K;  1JCC A;  5HVC A;  3CWB E;  5KAF E;  1VQ9 P;  2K93 A;  2KGE A;  3RG6 C;  2XKM A;  3SWK A;  2W8Z A;  3VTP C;  4R4L A;  2FXM A;  3S4R A;  2KIK A;  1NU1 G;  2E75 C;  3GLM A;  1SQB G;  2E75 B;  4Y28 J;  3PTZ A;  4D6T D;  2Y0C A;  1T3U A;  3A3Y B;  1ZW0 A;  4XRQ A;  1SQX G;  2PNG A;  3H1L E;  2K9Y A;  2WQY C;  1L0L E;  1A02 J;  2X2B A;  3W68 A;  1L0I A;  2K92 A;  2XDJ A;  3AEE C;  3G29 A;  1JOC A;  5C39 A;  1USD A;  2Q5U A;  3D71 A;  2CK3 H;  3EFF K;  1R8E A;  2JO0 A;  3H1I J;  4JPZ B;  1HUC A;  3C8V A;  1D7M A;  2HPC A;  3L35 A;  3UIA A;  1N8R Q;  1UIX A;  1NWQ A;  1IFI A;  4N6J A;  3JCU E;  1M1K Q;  3OAK A;  1J1D C;  1KQS O;  1J1D B;  2M8N A;  2B87 A;  3TGU G;  1AJY A;  2Y9Y A;  5KLI C;  1YTZ T;  1NHL A;  2JDI H;  1DV5 A;  1F80 D;  5KLI B;  3DS5 A;  2A06 D;  2O1J A;  3Q1M A;  2LF4 A;  2QM8 A;  1VQ7 P;  2D2C D;  5JPA A;  3GKL C;  4Y99 C;  3JSV C;  3TDK A;  4Y99 B;  3H1J J;  4BWN A;  1NTZ J;  5CBN A;  2C9L Y;  2IFN A;  1GU4 A;  1FR2 A;  4U0C A;  3WBH A;  1JJ2 O;  1EQ7 A;  3CWB G;  1P84 H;  5AW6 B;  2FYU D;  2ZFC A;  1KYO E;  3S1K A;  1YIJ P;  3DS4 A;  1T8K A;  2FHS C;  1PP9 D;  1S4X A;  2FVF A;  1M8O B;  1Q81 Q;  1BDD A;  2LXB A;  1S5L E;  3QH9 A;  4XFJ A;  2I1J A;  2JWA A;  2KUB A;  2N5I A;  2M5A B;  3SWY A;  1FDI A;  1N7S A;  1K05 A;  1U7M A;  1U7J A;  2ZYA A;  1YJW P;  3BRT B;  4U0A A;  1L0L G;  2JP3 A;  1JY2 N;  3L36 A;  4C7R A;  1N7S D;  1M57 D;  1SQP K;  3LRY A;  1M90 Q;  1VHN A;  2R32 A;  4H2Y C;  3D70 A;  2JQ4 A;  2Q7C A;  2LL8 A;  2EIA A;  4GDO A;  1AV1 A;  1OVU A;  1KLP A;  5B5E H;  1NTM K;  4IZ6 A;  1KQG B;  5F2K A;  1UNK A;  2PEO A;  4WY4 A;  2K2Q A;  5KP7 B;  3H1H D;  1X79 B;  3CPW O;  2XXM A;  2EHT A;  1BSN A;  2OYI A;  1AQ5 A;  1SQQ J;  2NZ2 A;  1P84 D;  1Y8A A;  2ZT9 C;  3C1L A;  1CEI A;  1YQ3 C;  1EXJ A;  2ZT9 B;  1YQ4 C;  1H0T A;  1PZQ A;  2FYN C;  2XNX A;  3Q3D A;  2KGA A;  2FYN B;  2K37 A;  1PL5 A;  3PH0 A;  1LP1 B;  2N1T C;  4JBZ A;  3HE5 A;  3P32 A;  2N1T B;  1FOS F;  2N9Y B;  1URQ A;  2Q9I A;  1LTS C;  3V2N A;  2NPS A;  2E42 A;  1N73 A;  2KLV A;  1EDK A;  3CWB D;  2NPS D;  2MF4 A;  3AEB C;  2C0W A;  2KP8 A;  3VYI A;  3L75 J;  3CX5 E;  3JC2 2;  3CI9 A;  2K9J B;  2AXT E;  1VPC A;  1T2K C;  4D6T J;  5E79 E;  3NTN A;  4JYC A;  4R4M A;  1BE3 D;  4W7Z A;  2J58 A;  4QMA A;  4RES B;  1KFM A;  1JTH A;  2B9B A;  1PIX A;  3CXC O;  4WWI A;  1BSH A;  2ZXX A;  1FC2 C;  3L71 D;  2GUS A;  2MR7 A;  5APY A;  5EJD A;  2WPV B;  1M6N A;  3L74 E;  2FXO A;  3HE4 B;  2AVA A;  1J2J B;  3FXD A;  2P2U A;  3AE9 C;  3SSU A;  5B66 H;  2Y0D A;  4KHX A;  2WSE J;  3KHU A;  1IFD A;  3AE6 C;  2FVE A;  1GD2 E;  3H32 A;  2FAE A;  2A45 G;  1HGV A;  3E1I A;  3CC4 P;  1VQ5 P;  4HKG A;  5HGM A;  3NXS A;  4H13 C;  3PJS K;  2FBW C;  2PEJ A;  4H13 B;  3G4S P;  2L0Q A;  2R5B A;  1JY3 P;  1M7L A;  4U0E A;  3CCM P;  1PPJ G;  3HD7 A;  1IFN A;  2H8P D;  2N1T D;  1RO0 A;  4IFM A;  3L72 E;  1NTZ K;  3M9B A;  3BAS A;  4NEO A;  2UWJ E;  2QSI A;  2FYU J;  1FOS E;  1JUN A;  2G8Y A;  4PV1 C;  1ZLL A;  2P1J A;  3ITK A;  4PV1 B;  3A0B H;  2FY8 A;  4K3A A;  1VQL P;  4W7Y A;  2ROQ A;  2K88 A;  3V2R A;  1FZE A;  1PEU A;  3MGN A;  4BPH A;  3G26 A;  1NGM B;  3CL3 D;  5APS A;  1KIL A;  2CGQ A;  3KZI E;  1SQX J;  3LID A;  1LTA C;  1T8Z A;  3H1K E;  1KIL D;  1U57 A;  1RO2 A;  1FU1 A;  1OZH A;  2M3B A;  1RF1 A;  2N98 A;  1RE4 A;  4PH1 A;  3AEC C;  3MHV A;  4IFF A;  1GU5 A;  2FXP A;  2YO3 A;  1DD4 A;  1OIP A;  3L74 G;  4JYB A;  4PD4 I;  1YYC A;  1N86 A;  1OW8 A;  1PEQ A;  5CJ0 A;  2OYH C;  3TK1 A;  3H1H J;  1JY2 O;  3AE1 C;  3RL0 C;  2OYH B;  2XND H;  3HTK A;  3RL0 B;  2R3S A;  2KLU A;  1HY8 A;  2Z4E A;  1DX7 A;  3HUS A;  1SQQ K;  1MFT A;  3VMA A;  4AQR D;  2PEI A;  1RHZ B;  3B4S A;  4H13 D;  3AEF C;  2HR3 A;  2P7J A;  1L2P A;  5GTI E;  4EOT A;  1K73 Q;  1PPJ D;  3H1J D;  4OVN F;  1L4A C;  2GM4 A;  5AVW B;  1NYH A;  1L4A B;  3L72 G;  2JO1 A;  3CWB J;  5BS1 A;  4YTP C;  3N4X A;  4EI2 A;  3WUV A;  2AXC A;  3FXE A;  3IR9 A;  1WRG A;  3AEG C;  2J59 M;  4BXL A;  2N6Z A;  4PV1 D;  2E74 D;  1NTK E;  1BDC A;  2IBZ E;  4QNB A;  4IPY A;  4YXW H;  5KLV D;  2AFE A;  1BE3 J;  3V6I A;  2YXQ B;  4WYM A;  2AEF A;  3H1K G;  3VMX A;  2W83 C;  2EG5 A;  3NTE A;  1L0N D;  1VQ8 P;  4N78 E;  3CXH H;  5CJ4 A;  2HG5 D;  1NH4 A;  1LTG C;  2BHV A;  3VRL C;  1QL2 A;  4CA3 A;  2JU2 A;  3L71 J;  2DGY A;  2LXC B;  1JY3 N;  3AE4 C;  3U1A A;  1H88 A;  3D6Y A;  2MVU A;  2J5U A;  2B88 A;  2KOO A;  2QVA A;  3KPE A;  1FZC C;  4QKO A;  4CPG A;  1FE6 A;  1FZC B;  3RL0 D;  3CXH I;  1IZN B;  3R2P A;  3T97 A;  2K3R A;  5AW4 B;  3M0D C;  1EZV I;  2OAR A;  5KTB A;  2M3E A;  4M3L A;  2IZ1 A;  5APX A;  2KSE A;  1SVF A;  1OX3 A;  1BCC D;  5AVU B;  1SS1 A;  3CXH D;  1UII A;  2BAS A;  2KW2 A;  1YHQ P;  1GL2 C;  1S72 P;  4H44 D;  1EZV D;  2OTK E;  1L4A D;  3L73 E;  2KI7 B;  2WVR A;  1GL2 B;  2O01 J;  2KXP B;  4IOI H;  1KB9 D;  3O6Q A;  5K5G B;  1JCD A;  2FYU K;  2M8P A;  1CI6 B;  1S2E A;  4I2L C;  3L75 D;  4PJ0 H;  1NTK G;  4U0D A;  1RF0 A;  2IBZ G;  3TYY A;  1K9M Q;  1W2E A;  2LKM A;  3WU2 H;  3A0H H;  1HWT C;  2HOD B;  2Z5H A;  4HH2 A;  2C9N Y;  4LLH A;  3MTU E;  3RK3 C;  1QRJ A;  3RK3 B;  2P9X A;  2AF8 A;  1IFM A;  5KJ7 C;  1FDM A;  3P8M C;  4EYY Q;  5KKZ C;  2Z45 A;  1GXG A;  2E5T A;  5KKZ B;  2GDX A;  4B86 A;  2L4B A;  4EDF A;  3H4E A;  1LWU A;  1A02 F;  1EDL A;  2WPS A;  3O8Z A;  2DW3 A;  3PLN A;  2MD9 A;  1FZB A;  1EDI A;  1SQP E;  1WMK A;  2RN0 A;  2K5X A;  2XU6 A;  3U1C A;  2WSF H;  3RK2 C;  4U0B A;  1OW7 A;  4AUW A;  2BCC E;  3RK2 B;  1ZMB A;  2IYP A;  2KG9 A;  1NTM E;  3L70 D;  3TNU B;  3F5H A;  3V5B A;  2KOD A;  3WUT A;  2Z44 A;  3MIW A;  3L4F A;  2L91 A;  5TIS E;  1ACP A;  3BCC E;  1SQV D;  1JEK A;  2AEM A;  2KS1 A;  1FZA A;  3MGE A;  2LIW A;  3B5N C;  4XFY A;  1ZME C;  4C7N A;  1BXI A;  3B5N B;  3EJE A; 
#chains in the Genus database with same CATH homology
 1PEU A;  3DS3 A;  1YJW P;  3G26 A;  1RNI A;  2E1M A;  3CD6 P;  2BQ1 E;  1EOQ A;  4U0A A;  3CC2 P;  4GR2 A;  2M8P A;  3CMA P;  1Q82 Q;  4QNB A;  3H47 A;  4U0D A;  1VQ4 P;  1AUM A;  4IPY A;  1QVG O;  1IUQ A;  1K30 A;  3G29 A;  1NJI Q;  2M8L A;  5HGN A;  1K9M Q;  1Q86 Q;  1KC8 Q;  3H0D A;  3LRY A;  3G1I A;  4WYM A;  4COP A;  1YJ9 P;  3DS0 A;  3G71 P;  3CCR P;  1YIT P;  3G1G A;  2JYL A;  2BUO A;  5F2O A;  3G0V A;  1A8O A;  1RO2 A;  2EG5 A;  2PEQ A;  3NTE A;  1M90 Q;  1QRJ A;  1YJN P;  1VQ8 P;  1YI2 P;  3CXC O;  2JO0 A;  2P9X A;  3DTJ A;  2EIA A;  2CWO A;  2OTJ P;  1KD1 Q;  3DPH A;  2Z45 A;  4PH1 A;  3DS2 A;  1M6N A;  3CCS P;  4XFZ A;  3OW2 O;  1N8R Q;  3CCJ P;  2BHV A;  5F2K A;  2PEO A;  3VRL C;  1W2B O;  3CME P;  2QEX P;  1M74 A;  3P05 A;  3HYB A;  2XT1 A;  2DGY A;  3I56 P;  1M1K Q;  3CPW O;  2XXM A;  3CCL P;  3CCE P;  1KQS O;  3H4E A;  2PY8 A;  2M8N A;  3B5I A;  1PEQ A;  1BAJ A;  3CCU P;  4COC A;  2ONT A;  2EFJ A;  3DS5 A;  2LF4 A;  2QA4 P;  3CC4 P;  5I4T G;  1VQ5 P;  1VQ7 P;  1K8A Q;  5HGM A;  4XFX A;  5JPA A;  1VQM P;  4U0B A;  2PEJ A;  1EIA A;  3G4S P;  1VQN P;  1VQ6 P;  4U0F A;  3Q20 A;  1ZMB A;  1PEM A;  5HGO A;  2XV6 A;  1D1D A;  1A43 A;  4U0E A;  1Q7Y Q;  3CCM P;  5F2N A;  3CC7 P;  2PEM A;  4U0C A;  2PEI A;  3E2D A;  4GR6 A;  3G28 A;  3WBH A;  1JJ2 O;  2KOD A;  1VQ9 P;  5HGL A;  2OAR A;  3RG6 C;  3M1M A;  3CCV P;  1M6E X;  2L6E A;  3G6E P;  2JYG A;  3I55 P;  2Z44 A;  1QVF O;  1YIJ P;  3DS1 A;  3DS4 A;  1VQO P;  1K73 Q;  1RO0 A;  4PH0 A;  1VQK P;  3CCQ P;  1PEO A;  1VQP P;  2PEK A;  4M0I A;  2PEN A;  2OTL P;  5DCK A;  1Q81 Q;  3G21 A;  5BS1 A;  3MGE A;  4XRO A;  5BS2 A;  4XFY A;  4XRQ A;  1VQL P;  1YHQ P;  3HZQ A;  1E6J P;  1S72 P;  2Z46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...