1NJIQ

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1njiQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1njiQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1njiQ03
3CCLP 3CC7P 1Q7YQ 1YIJP 3CC2P 1QVFO 1S72P 3CD6P 1YJ9P 3I55P 3OW2O 1VQ4P 1W2BO 1VQMP 3CCUP 1VQPP 1YJNP 1NJIQ 1VQ7P 1YITP 2QEXP 1M1KQ 3CPWO 1KD1Q 1VQ6P 1Q81Q 1VQLP 1VQKP 1KQSO 3G4SP 1YHQP 2QA4P 1VQ5P 3I56P 3CCRP 1Q82Q 1KC8Q 1JJ2O 1VQNP 1YI2P 1YJWP 1N8RQ 1K9MQ 3CC4P 3CCEP 1QVGO 1K8AQ 3CMAP 3CCJP 1VQ8P 3CCQP 3G6EP 1VQ9P 3CCMP 3CMEP 3CCVP 3CXCO 2OTJP 1VQOP 1K73Q 2OTLP 1M90Q 3G71P 3CCSP 1Q86Q
chains in the Genus database with same CATH superfamily
4IOIH 3P32A 2N1TA 2HR3A 1PFIA 2VLPA 2W90A 2C9LY 1NU1E 1M6NA 2FYNC 3C8VA 3WUTA 2KOOA 5GTHE 1S5LE 2BCCD 1BCCE 2K9JB 3U59A 3GJNA 4O9BA 3L75G 1NHLA 3H1KE 4DT0A 5F2KA 1PPJE 1YYCA 3B71A 4PV1C 2PFXA 3WUUA 1WMKA 3G3ZA 5KLVK 2W6AA 1SFCA 5CMZA 1D1DA 5AW2B 2YIUB 1EMVA 5GTIH 1T8KA 3A0HE 3H1JG 5KKZB 2LIWA 4N78E 2G3AA 4U3FE 2OARA 2HODA 1T8ZA 1QX8A 1IMPA 4UB8H 2WTYA 1SQXK 2QJKB 4U0CA 1NTMJ 4BPGA 5F2NA 4DCKA 2LKMA 1IFJA 1ZXGA 3TYYA 5CJ4A 1N7SB 4H44D 1FDOA 2B87A 2KWLA 3H4EA 4M3LA 2K9JA 3VMZA 5HVCA 4U7JA 1RF0C 3H1HG 1QEXA 2E74C 2CQ8A 3NY7B 1BSNA 3V6IA 2ZYAA 2WSCJ 2JR8A 1PEMA 2Q9IA 2C0WA 1PP9E 4IFFA 2FXOA 2YIUC 2JU1A 1Q7YQ 3WU2H 5KKZC 1RE4A 1NTZG 3E7KA 1OVRA 4LGDE 3V2RA 2E5YA 3L70D 3EJEA 2K37A 4GODA 3EFFK 1R8EA 3L36A 5AVXB 1T2KC 3CXHD 4MRTC 3WMM0 2QJKC 4A7PA 2ZAEB 2D2CB 1N7SA 2JEEA 4JPZB 2ERHA 2B9BA 3DS2A 2Q6QA 3L74E 2NPSD 2KUBA 2IBZD 3CCLP 1VF5B 1L0ND 2WT7B 1N7SC 1SQPD 2IPPA 1WT6A 4F37A 1KILE 3VMXA 2OYHB 3IFMA 2MJZA 2EIAA 1FU1A 2EHTA 1NU1G 1VQ9P 2K5XA 3HD7C 1ZNVA 2QJPC 4OH8B 4W7YA 2NRGA 3CI9A 1EDLA 2XXMA 3EJBA 3H0DA 1BCCG 5KAFH 1JY3P 2GDXA 1KFMA 1YJNP 3H1KG 1PPJG 1KV4A 1VQ5P 4UB6H 3W68A 1NTME 2FQ2A 5EFWB 5KAIH 2ZXEB 1T6AA 3CMEP 3L71J 1VQOP 3VTPC 1FS0E 2HLOA 4GT1A 5L8RJ 1QVFO 4C46A 3RK2B 4D6TJ 3NMDA 2D2CC 2WT7A 2FAEA 4BPFA 1RHZB 2Z5HA 4U3FG 5KLIB 3RL0B 4PJ0E 2OYHA 1S2EA 1DX7A 5AW1B 3GLMA 2OYHC 2V7QH 4BRYB 1VDFA 2P1JA 5KP6B 1OX3A 1SQXJ 2K0DX 2E75B 4NPEA 1ZMEC 3B5NC 4WY4B 2YXRB 2W8ZA 1SVFA 1VQKP 1LNQA 1Q82Q 1GK6A 2L91A 1TU3F 3TGUJ 5B5EH 3NFQA 3HE4B 2OTJP 3V2NA 4QNBA 1VPCA 2N50A 2WITA 1BDDA 2RN0A 5AW0B 5CCGC 2H8PD 1KD1Q 1PP9G 1GZLA 2Y9YA 2VRSA 3D71A 2PENA 1IJDB 3TF5A 5GTHH 4H13B 1S5LH 2P67A 3G26A 5E79E 3MHVA 3L72D 3GKLC 2IYOA 3SWFA 3U1CA 2C9NY 3RL0C 2H89C 3EJDA 4CPGA 4EIJA 4PV1D 1VQLP 1KQSO 1P84D 3VN0A 2VLOA 3LMOA 1KYOI 1A8OA 3L74G 2FVAA 3I5CA 1QRJA 3OA7A 4WY4C 2YMKA 3HE4A 1RF1B 3A0HH 4TLFA 4LLHA 3OJAB 1QLED 1FBMA 2FXMA 3AE4C 2FHSC 3L71E 3H1IJ 1FAVA 2K88A 1LP1B 2B88A 5C39A 7CEIA 4M0IA 2KK7A 3OAKA 4D6TE 3CX5D 3HTKB 1KZUB 3CCUP 4KJMA 4Z1MH 4DG9A 4H13C 2A45I 3NXSA 1NTMG 4TT3H 2AFEA 5GTIE 1A02F 2E74D 4WB4A 1SQXE 1GW4A 1G2CA 4UB8E 2WPVB 3TGUE 1RF1A 3CPWO 1IFIA 2BASA 1YQ3C 2P7JA 4EOTA 1LTBC 1JY2O 1N73C 2JO0A 1FZGA 3CCQP 2KGDA 2GZIA 3L73J 4GOEA 4PD4E 2WPTA 4XFZA 1LP1A 3P8CD 2OYIB 1A02J 3CD6P 1T2KD 3EQ2A 1OWAA 1KORA 1VQMP 3HTKA 1EZVI 2BUOA 2DGYA 2FYUK 2YKQA 2BEQD 2PEQA 1N7SD 5AVZB 2KB7P 1IO4A 5AVYB 3KDPB 1FZFA 1PGQA 1DIPA 1NO4A 3M0DA 1EQ7A 2PGDA 1URQC 2QEXP 3WU2E 3HD7D 1NH4A 1LWUB 1FZCC 2I1KA 1DEEG 4I6MC 3HZQA 3SWKA 5HGMA 5DCKA 1Q86Q 2NPSA 3GF3A 1ZMBA 4I7ZC 3H1IE 2OYIA 1MZ8A 2KSEA 3R2PA 2E5TA 2FVFA 5APYA 1LJ2A 3F5HA 3H47A 2D2CD 4XROA 3CWBJ 2LMLA 3BCCD 3FWNA 5APUA 2WSEJ 2FXPA 3B5IA 3L71G 1PGPA 3HUSB 1D7MA 5DJUB 2O01N 1SQQK 3V2QA 1GU5A 2WSCH 4D6TG 1J1EB 1FJPA 3H6PA 3VOPA 3PHLA 3CCVP 1KILB 1KB9I 2P9XA 3A5TA 2K0XA 1T3UA 5KAIE 2KOSA 2WQYC 1LWUC 1LT9B 3A2AA 2Y9ZA 1LTJB 2KODA 4BPHA 3M9BA 3L73E 1VHNA 4XRQA 2FFDB 4AUWA 3MP7B 3KXDA 3G1IA 1SQXG 3HE5A 3JCUE 3E2DA 1L0LJ 2Z46A 1MZ9A 1M6EX 3Q3DA 1ZP0C 3GG2A 4IL6E 1S4XA 1R5LA 3TGUG 2FY8A 3AE6C 4HJGH 1GPJA 4N3YB 3L75D 1EDJA 3TDKA 1HTLC 4H2YC 1AV1A 2PEJA 2J59M 5E79H 4I2LC 3HUSA 1S5LX 4L75A 3RL0D 5AVSB 4OGQC 3AEEC 4WWIA 1JMMA 3E1IA 1K04A 5APWA 3HUSC 2XDJA 5B5EE 1Z6MA 1YQ4C 3SSUA 3H1JD 2XNXA 1J1EC 1IUQA 4W7ZA 3CL3D 1KILC 4R4LA 2L0QA 1K30A 2E75D 1LTJA 4WY4D 2FVEA 3LRYA 2GZGA 2FYUJ 1BGYJ 2FFDA 1LT9C 1LTJC 1GL2C 3MIWA 2ONTA 2KXPB 2FFDC 3PJSK 1VKUA 2M8PA 5AW5B 2E74B 1RH5B 1S9KE 5CHXA 3CWBE 3G0VA 2PY8A 2KOPA 5CCHA 5KP8B 2JP3A 2P58A 1FZAA 1FOSF 3H1HD 2BQ1E 1M74A 2XU6A 4H13D 5CCHC 3H1IG 2C0XA 2R3CA 2Q7CA 1HBWA 4YTPC 1AQ5A 1EDIA 1EDKA 3PH0A 1KC8Q 1X3OA 3GW6A 2FQ0A 4HB1A 2LF4A 2MVUA 1SQVK 3CC2P 1NTZD 2XT1A 4IPYA 1IK9A 3U1AA 2QM8A 2GZEA 4LC1A 2WSFH 1L0LE 4PD4H 2MD9A 2N5HA 1RF0A 2ZXXA 3Q2YA 3GZMA 1HGVA 4IFDK 1SQQJ 2HFED 1ZLLA 1HVVA 4NPDA 1SP4A 5TISH 1YTZT 2HG5D 3HD7B 2QJPB 1VQ7P 2MR7A 2KS1B 3L73G 4HKZH 3A0BE 1MFZA 3B8EB 2MR8A 1NU1D 2M8RA 2JKVA 3MZWB 1G1JA 2JU2A 4R4MA 1URQD 3D6ZA 4DZOA 2FADA 1BCCD 3S4RA 2UWJE 4H0LC 3GMAA 5AW3B 2RH0A 3H1KD 1NGMB 1PPJD 1L4AC 1J1DC 3GHGC 3RG6C 2FYUE 1BGYE 1SQBJ 1CZQA 2QVAA 1NTKJ 1WRGA 5AVUB 3CCRP 2GUVA 1FE6A 3M9QA 2FKWB 2GA1A 3B4QA 4XFYA 2V4HA 1N7LA 1JOCA 3WUVA 2GZJA 4N78D 4PH0A 1LTIC 2RMZA 5KP7B 4GDOA 5F2OA 4U3FD 3HD7A 3SWYA 2BHVA 2I8DA 5EW5E 2L6EA 2KS1A 2XNDH 3LW5H 4DOJA 3F89A 3PP5A 3CXHI 3B5NB 1YBKA 2N9BA 1LTAC 2A06E 3CLQA 2IBZI 2KLVA 1BE3J 4RO0A 4GOFA 1VQ6P 4XE5B 4QMAA 1JMBA 3CWBG 4GKGA 1H0TB 1RE3A 1KYOE 2LKIA 5APXA 2Y0EA 3TNUB 1LTTC 3VP8A 3RL0g 1HWTC 1FOSE 1L2PA 1RE3C 1W2EA 5B66E 2AEJA 5KJ7C 1PP9D 4PXHB 4Y99B 1NAFA 5AW8B 5KLVJ 1Q81Q 3GZLA 1ACPA 3V2PA 3JCUH 1JJ2O 1SQQE 3MGEA 1JY2P 2O01H 3AE7C 4U0BA 3RK3C 3G6EP 3O6QB 2JO1A 3M9HA 2Q3IA 4IL6H 3L35A 3B5NA 2QRXA 4AYCA 2WWWA 1VL2A 2POHA 3AECC 3PTZA 1SQVJ 3ABVC 3HRNA 1L0LG 4OGQD 2JJLA 3UIAA 1W5CE 3L74D 2KOQA 3JC22 2JWAA 1Q90D 3EFGA 1H88A 3TNUA 1ZN5A 5CCGA 3L4FA 1KILD 1MFTA 1SQBE 1NTZK 3OW2O 1NAYA 2WSFJ 2W27A 3N7NA 1NTKE 1JY2N 2KGEA 2KG6A 3VMYA 3KHUA 1YJWP 1E0HA 1S3JA 4U0AA 3CCJP 4U0FA 1GL2D 1OR5A 3O6QA 2NO8A 4Y99C 5AVRB 5AW9B 4WBAA 4IZ6A 5AW6B 1EZVE 2FYUG 1BGYG 3DPHA 1Z56A 3H1LJ 1Y8AA 1NTMD 2CK3H 4BRYA 2WVRA 2WSEH 3RG2A 2H88C 4WY4A 1HUCA 4OWFA 5CCHD 2QIWA 4C7RA 3H32B 1N73B 1UIXA 1BE3E 1DV5A 3DTJA 2M8NA 2QA4P 3VP9A 3GF7A 4MN4C 1JEKA 1P84I 1SS1A 1OVVA 1K73Q 2A06G 3CCSP 1X0TA 3JSVC 1RO0A 5KLVE 1L0NK 1SLQA 1SQPK 1GMJA 2KNCB 1NJIQ 3LW5J 3Q5SA 2PEMA 2Z4EA 1ZOYC 2Y0CA 5BVZA 3H25A 1URQB 2OTKE 3IF4A 4YXWH 2IDBA 4JF7A 3AEFC 1EIAA 1FZCB 2E76C 1SQVE 1JY3O 1GU4A 3A0BH 5CBNA 3H32A 2MF4A 1N73A 3CX5I 2DW3A 4BWNA 2K1AA 5HGLA 4I1LA 1M8OB 1CEIA 1SQQG 5APSA 3Q20A 3G4SP 1JTHB 2W6BA 4B86A 3RK3E 3CC4P 4I7ZB 4Y28J 2FACA 1R5SA 1L0IA 4H0LD 2BCCJ 2R5DA 1KB9E 2K9YA 2YXQB 1M90Q 1AQTA 1L4AD 3M0AA 2ZFCA 1AFOA 1HQBA 1X8YA 3NTNA 2A45G 2O01J 2K93A 2JAZA 3TK1A 1Y47A 2QSIA 1DH3A 3MD0A 5TISE 2KNCA 5HGOA 5HGNA 3AE2C 1X22A 1URQA 1AJYA 3DS0A 1SQBG 1USDA 3C9IA 3H1LE 1QGKB 1NTKG 1PL5A 3I55P 1USEA 1FZCA 2KSJA 3L71D 1VQPP 2GM4A 2AEFA 2AFDA 3NTEA 3Q5RA 1NTZJ 4D6TD 1KLPA 1XTCC 2Q1KA 2P10A 2WSSH 5AW7B 3U43A 2R44A 2K2QA 3G71P 1DD4A 2WPQA 1YJ9P 1NKZB 4W80A 3D6YA 3IR9A 1EZVG 5H2FE 1F80D 3P8MC 1KYOH 3MUDC 4JYBA 2N5IA 1QL2A 4BXLA 3ITKA 4KHXA 2E43A 1SQXD 1ZRTE 5B66H 4EYYQ 3CXCO 4ASVA 5KJ7D 1BE3G 2GZFA 2LOLA 3C1LA 1OW8A 3TGUD 4ZKUA 2YKPA 1J2JB 1OMIA 1HY8A 3BVHA 1YITP 1RQUA 2YO3A 2KG8A 2ZT9B 4OGQB 2N9YB 1PV3A 2KZJA 2K92A 3Q5PA 4CA3A 1OW7A 4IL6X 4PD4D 3L70J 1LWUA 3QWOC 1IFDA 3RBXA 2YO2A 5KLVG 2JYLA 3B5ND 2A45H 1AYIA 2YKOA 4XFXA 2JYGA 2BCCE 2JBGA 1MKMA 1GL2B 1L0NJ 1SQPJ 3DS1A 2PEOA 3IAOA 2MVVA 1X9VA 2M5RA 1IMQA 1SQVG 5CCGD 2KOGA 2O3JA 2SPZA 3D70A 1H8AA 2QNWA 2M8LA 2ITAA 4EDFA 2GDYA 1CW5A 2O1JA 4R0MA 2K3RA 1NWQA 1FZBA 1AF8A 2ZT9C 3H1ID 2YNYA 1KILA 2ZYDA 4JBZA 3MGNA 1M1JC 2HYNA 2L4BA 4HH2A 1AA0A 3S1KA 3A3YB 1GW3A 1LT9A 2PP6A 3ZDMA 3CCEP 3N4XA 1HJ0A 1GL2A 5JPAA 1N2DC 3FWLA 5APTA 3H1LG 1CI6B 2AEMA 1GXHA 2AVAA 2HODB 1AUMA 2KORA 2J5UA 2N1TC 2VLNA 1RQVA 2OQQA 1LTSC 1EC5A 2LPKA 1HGZA 5APQA 2RKLA 3A7OA 1KMIZ 3L74J 1G1IA 2B87B 3L73D 1IFNA 1BSHA 3L70E 3VRLC 4C7NB 4H0LB 2E76D 3II6A 2CGQA 3B4SA 3T97B 3CXHE 5AVQB 2G8YA 4XFJA 1BXIA 2CG5B 1GD2E 3HYBA 1J1DB 1L4AB 3GHGB 1KQLA 2R5BA 1NQ4A 4ZNCA 2JQ4A 2IBZE 2PRRA 1E5WA 1L0NE 1SQPE 1CI6A 5DJTB 3G9RA 1SFCC 2CNRA 1KB9H 3L72J 2R32A 4UHPB 1Q2NA 5EJDA 3SFEC 4U0DA 4YPCA 4H2WC 4XA4A 2KR5A 2BCCG 1OXZA 1UIIA 1NOHA 3LIEA 3DS5A 3FXDA 2CWOA 1PEUA 2IX7C 1BDCA 2HPCB 1KQGB 4C7NA 2H43A 3G21A 3T97A 1MV8A 2VLQA 3G1GA 1L4AA 3GHGA 2AXTH 2I1JA 1LTGC 4K3AA 1S9KD 1OW6A 3CWBD 3USSA 1L0HA 1VQNP 1T3JA 2IZ1A 1AVOA 2OGUA 3Q1MA 2LL8A 4JYCA 5H2FH 2IFNA 2QE7H 3RBZA 3LIDA 3RK3B 2Z45A 1IFMA 2E42A 1HH0A 1Y9BA 1M1KQ 4RESB 2FYZA 1RE4C 1E6JP 3DS4A 1YI2P 5CJ0A 5BU5A 1GK4A 1RY3A 3MTUE 2Z44A 3PLNA 4AQRD 2P2UA 2FBWC 1JNMA 2HPCA 4K35A 2KLUA 1CSBA 4GR2A 3S9OA 2Y0DA 3FX0A 3K5BA 1L0LD 1RO2A 5AVTB 1FR2A 4H2XC 1MUUA 2NZ2A 3G28A 3CCMP 3VMAA 1RNIA 2XZ1C 5AW4B 1OFCX 2KI7B 5KJ7A 5HV8A 1M57D 1LT1A 3CE7A 1U57A 3L72E 3L70G 1XTGB 1JCCA 3P05A 1OIPA 3DS3A 5CZDB 3AEDC 2WZ7A 2L5GB 2WPSA 1P84E 1PGJA 2KYVA 1E79H 2OYOA 3AE8C 2IBZG 1L0NG 1M7LA 1SQPG 2EHSA 2FYUD 1BGYD 1KQFB 4KT0J 4ASWA 2M3EA 5CBOA 4COCA 1EOQA 3BASA 1YHQP 2PAJA 2M3BA 1VF5C 1N8RQ 3M1MA 2ZT9D 1JY3N 2M5AB 3EWKA 3FGAD 3AE1C 1H0TA 4JQ0D 3KZIH 3CX5E 2ZVOB 3V4QA 1BAJA 1GTWA 4WYMA 3BCCJ 1H89A 2A06D 2BEZF 2GYKA 2N6YA 3CC7P 2XV5A 1EXIA 2N1TD 3KQGA 2Z5IA 1ZV8A 2E76B 1KYOD 4HKGA 1FDMA 3VYIA 3KPEA 1A43A 4GR6A 1K8AQ 5M1BA 1NU1K 3RK2C 2ZJSE 2ZYGA 3BATA 2W83C 2LIUA 1ZR2A 1YIJP 2M5AA 5KLIC 5BS1A 3P8CE 3BRTB 4U0EA 1N86A 1SQQD 3CXHH 3P7KA 3I56P 2FQ1A 1OZHA 2LXCB 1NVOA 2E75C 1G2CB 1U7MA 3L75J 2IZ0A 1SFCD 1S72P 3AE5C 4H44B 2GDWA 1JUNA 2KG9A 1DEBA 3TSIA 1AVYA 3CMAP 2M0BA 2PEKA 2X2BA 2KGCA 1FDIA 3H1JJ 4L76A 3W67A 1SQBD 2E1MA 2PNGA 2CPSA 3SFDC 5K5GB 1NTKD 3L72G 4ZKPA 4COPA 1VQ4P 2Q5UA 2WPRA 2MKVA 4RJTA 1HF9A 1JM0A 2K94A 1L0LK 1IK7A 2H7HA 4PWVB 1QVGO 1NYHA 2LTEA 3M91A 2EFJA 2OTLP 2JGPA 2JDIH 1X79B 1PEQA 1UNKA 1IC2A 4NEOA 1EZVD 2LR2A 3KYQA 1PZQA 2W6JH 3BCCE 3L37A 4L74A 5TJHA 3H1HJ 2IYPA 1JO5A 2NPSB 1RF1C 4DJGA 1BE3D 4H44C 1PGOA 1DNYA 4WVZA 2N6ZA 2GUSA 3V5BA 2ROQA 5BU8B 4L73A 1KFNA 2IFMA 2L9FA 2XZ0D 2MY5A 2AXTE 2R3SA 3FXEA 1JB0J 5BS2A 2WMMA 1HJBA 2V7QJ 1JTHA 4IFMA 1KTMA 3IN6A 5KLVD 5APVA 1IZNB 3MUDA 3AEBC 3E1RA 4HYTB 1LGHB 2KZIA 4OVNF 2KW2A 2QM7A 2QJYB 3QH9A 2JWDA 3M0DC 1UJZA 1U7JA 3L75E 4QKOA 4GIFA 1FC2C 1EXJA 1FJKA 1SQVD 3G29A 5AVVB 1FZEA 4RKUJ 4YXDC 1ZR4A 1NU1J 2XV6A 3AE3C 3AEAC 2VSQA 1W2BO 2NPSC 2Q3EA 2EG5A 3RK3D 1NKNA 3V4WA 2QG4A 1P84H 3AE9C 2N98A 3H1JE 3HE5B 1BCCJ 2DNWA 1K9MQ 1KB9D 1NTMK 2OYIC 2L22A 1M1JB 3R4YA 2AXCA 1PEOA 3H1KJ 2O1KA 1YTZI 1GDTA 3AEGC 2J58A 4NPFX 1OVUA 5KTBA 1VF5D 2PEIA 4N6JA 4PJ0H 2CPBA 5AVWB 3O8ZA 2K0YA 1PIXA 3PRJA 2AF8A 5KAFE 1JCDA 1ZW0A 3RGUA 2JB0A 4UB6E 2B89A 3CX5H 3H1LD 1S1CX 4PD4I 4U3FJ 2N1TB 2QJYC 3BRVB 1DD3A 3H1HE 2FYNB 1M56D 5I4TG 1K05A 2ZVNB 4ZMDA 4EI2A 1VQ8P 2KIKA 4PH1A 1M1JA 1KN7A 2KP8A 4PV1B 1SQBK 3BCCG 3M06A 1NTKK 2XZRA 2YMYA 2KGAA 1NTZE 2XKMA 3RK2D 3KZIE 1IFPA 1ZRTD 3WBHA 1QL1A 1SFCB 1PP9J 1GXGA 2LXBA
chains in the Genus database with same CATH topology
2LF4A 2E1MA 2Z46A 2JYLA 3CC2P 1M6EX 1QVFO 2XV6A 2Z45A 2XT1A 4IPYA 4COPA 4XFXA 1VQ4P 1W2BO 2JYGA 1M1KQ 2QEXP 1BAJA 2EG5A 1PEMA 3DPHA 1VQ6P 3VRLC 2PEJA 1E6JP 4WYMA 3DS4A 1YI2P 1K9MQ 5HGOA 3DS1A 5HGNA 1QVGO 2PEOA 1M6NA 2EFJA 3HZQA 4M0IA 1PEOA 2Z44A 2OTLP 3HYBA 5HGMA 5DCKA 1Q86Q 1ZMBA 3CC7P 4GR2A 1Q7YQ 1PEQA 3DS0A 3DTJA 2PEIA 3I55P 1VQPP 2M8NA 3CCUP 1VQ7P 1IUQA 3NTEA 2M8LA 1Q81Q 1VQKP 1RO2A 2QA4P 1K30A 1Q82Q 5F2KA 1JJ2O 3MGEA 1A43A 3G28A 4GR6A 1K8AQ 4U0BA 3G6EP 3LRYA 3CCMP 3DS2A 1RNIA 1K73Q 2OTJP 3H47A 3G71P 3CCSP 4XROA 3CCLP 1RO0A 4QNBA 1YIJP 4U0DA 1D1DA 5BS1A 1YJ9P 2ONTA 1QRJA 1NJIQ 3B5IA 4U0EA 3CPWO 5I4TG 1KD1Q 2M8PA 2PEMA 3RG6C 3DS5A 3P05A 2EIAA 2JO0A 3I56P 2CWOA 3DS3A 2PENA 3G0VA 3CCEP 5BS2A 1PEUA 1VQ9P 1VQ8P 3CCQP 2PY8A 2OARA 4PH1A 3CCVP 3G21A 3CXCO 1EIAA 2P9XA 5JPAA 3CCRP 3G26A 4XFZA 4U0CA 2BQ1E 5F2NA 1M74A 4XFYA 2XXMA 3G1GA 1S72P 3H0DA 3CD6P 3OW2O 1VQMP 1YJNP 1YITP 4PH0A 5HGLA 2BUOA 2KODA 4COCA 1EOQA 2DGYA 1AUMA 5F2OA 1VQLP 1KQSO 2BHVA 3Q20A 3G4SP 1VQ5P 1YHQP 1VQNP 3H4EA 1KC8Q 2PEQA 4XRQA 1YJWP 1N8RQ 3CC4P 3M1MA 2L6EA 3WBHA 3CMAP 4U0AA 3CCJP 1A8OA 3G1IA 2PEKA 4U0FA 3CMEP 1VQOP 1M90Q 3E2DA 3G29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL P;  3CC7 P;  1Q7Y Q;  1YIJ P;  3CC2 P;  1QVF O;  1S72 P;  3CD6 P;  1YJ9 P;  3I55 P;  3OW2 O;  1VQ4 P;  1W2B O;  1VQM P;  3CCU P;  1VQP P;  1YJN P;  1NJI Q;  1VQ7 P;  1YIT P;  2QEX P;  1M1K Q;  3CPW O;  1KD1 Q;  1VQ6 P;  1Q81 Q;  1VQL P;  1VQK P;  1KQS O;  3G4S P;  1YHQ P;  2QA4 P;  1VQ5 P;  3I56 P;  3CCR P;  1Q82 Q;  1KC8 Q;  1JJ2 O;  1VQN P;  1YI2 P;  1YJW P;  1N8R Q;  1K9M Q;  3CC4 P;  3CCE P;  1QVG O;  1K8A Q;  3CMA P;  3CCJ P;  1VQ8 P;  3CCQ P;  3G6E P;  1VQ9 P;  3CCM P;  3CME P;  3CCV P;  3CXC O;  2OTJ P;  1VQO P;  1K73 Q;  2OTL P;  1M90 Q;  3G71 P;  3CCS P;  1Q86 Q; 
#chains in the Genus database with same CATH topology
 4IOI H;  3P32 A;  2N1T A;  2HR3 A;  1PFI A;  2VLP A;  2W90 A;  2C9L Y;  1NU1 E;  1M6N A;  2FYN C;  3C8V A;  3WUT A;  2KOO A;  5GTH E;  1S5L E;  2BCC D;  1BCC E;  2K9J B;  3U59 A;  3GJN A;  4O9B A;  3L75 G;  1NHL A;  3H1K E;  4DT0 A;  5F2K A;  1PPJ E;  1YYC A;  3B71 A;  4PV1 C;  2PFX A;  3WUU A;  1WMK A;  3G3Z A;  5KLV K;  2W6A A;  1SFC A;  5CMZ A;  1D1D A;  5AW2 B;  2YIU B;  1EMV A;  5GTI H;  1T8K A;  3A0H E;  3H1J G;  5KKZ B;  2LIW A;  4N78 E;  2G3A A;  4U3F E;  2OAR A;  2HOD A;  1T8Z A;  1QX8 A;  1IMP A;  4UB8 H;  2WTY A;  1SQX K;  2QJK B;  4U0C A;  1NTM J;  4BPG A;  5F2N A;  4DCK A;  2LKM A;  1IFJ A;  1ZXG A;  3TYY A;  5CJ4 A;  1N7S B;  4H44 D;  1FDO A;  2B87 A;  2KWL A;  3H4E A;  4M3L A;  2K9J A;  3VMZ A;  5HVC A;  4U7J A;  1RF0 C;  3H1H G;  1QEX A;  2E74 C;  2CQ8 A;  3NY7 B;  1BSN A;  3V6I A;  2ZYA A;  2WSC J;  2JR8 A;  1PEM A;  2Q9I A;  2C0W A;  1PP9 E;  4IFF A;  2FXO A;  2YIU C;  2JU1 A;  1Q7Y Q;  3WU2 H;  5KKZ C;  1RE4 A;  1NTZ G;  3E7K A;  1OVR A;  4LGD E;  3V2R A;  2E5Y A;  3L70 D;  3EJE A;  2K37 A;  4GOD A;  3EFF K;  1R8E A;  3L36 A;  5AVX B;  1T2K C;  3CXH D;  4MRT C;  3WMM 0;  2QJK C;  4A7P A;  2ZAE B;  2D2C B;  1N7S A;  2JEE A;  4JPZ B;  2ERH A;  2B9B A;  3DS2 A;  2Q6Q A;  3L74 E;  2NPS D;  2KUB A;  2IBZ D;  3CCL P;  1VF5 B;  1L0N D;  2WT7 B;  1N7S C;  1SQP D;  2IPP A;  1WT6 A;  4F37 A;  1KIL E;  3VMX A;  2OYH B;  3IFM A;  2MJZ A;  2EIA A;  1FU1 A;  2EHT A;  1NU1 G;  1VQ9 P;  2K5X A;  3HD7 C;  1ZNV A;  2QJP C;  4OH8 B;  4W7Y A;  2NRG A;  3CI9 A;  1EDL A;  2XXM A;  3EJB A;  3H0D A;  1BCC G;  5KAF H;  1JY3 P;  2GDX A;  1KFM A;  1YJN P;  3H1K G;  1PPJ G;  1KV4 A;  1VQ5 P;  4UB6 H;  3W68 A;  1NTM E;  2FQ2 A;  5EFW B;  5KAI H;  2ZXE B;  1T6A A;  3CME P;  3L71 J;  1VQO P;  3VTP C;  1FS0 E;  2HLO A;  4GT1 A;  5L8R J;  1QVF O;  4C46 A;  3RK2 B;  4D6T J;  3NMD A;  2D2C C;  2WT7 A;  2FAE A;  4BPF A;  1RHZ B;  2Z5H A;  4U3F G;  5KLI B;  3RL0 B;  4PJ0 E;  2OYH A;  1S2E A;  1DX7 A;  5AW1 B;  3GLM A;  2OYH C;  2V7Q H;  4BRY B;  1VDF A;  2P1J A;  5KP6 B;  1OX3 A;  1SQX J;  2K0D X;  2E75 B;  4NPE A;  1ZME C;  3B5N C;  4WY4 B;  2YXR B;  2W8Z A;  1SVF A;  1VQK P;  1LNQ A;  1Q82 Q;  1GK6 A;  2L91 A;  1TU3 F;  3TGU J;  5B5E H;  3NFQ A;  3HE4 B;  2OTJ P;  3V2N A;  4QNB A;  1VPC A;  2N50 A;  2WIT A;  1BDD A;  2RN0 A;  5AW0 B;  5CCG C;  2H8P D;  1KD1 Q;  1PP9 G;  1GZL A;  2Y9Y A;  2VRS A;  3D71 A;  2PEN A;  1IJD B;  3TF5 A;  5GTH H;  4H13 B;  1S5L H;  2P67 A;  3G26 A;  5E79 E;  3MHV A;  3L72 D;  3GKL C;  2IYO A;  3SWF A;  3U1C A;  2C9N Y;  3RL0 C;  2H89 C;  3EJD A;  4CPG A;  4EIJ A;  4PV1 D;  1VQL P;  1KQS O;  1P84 D;  3VN0 A;  2VLO A;  3LMO A;  1KYO I;  1A8O A;  3L74 G;  2FVA A;  3I5C A;  1QRJ A;  3OA7 A;  4WY4 C;  2YMK A;  3HE4 A;  1RF1 B;  3A0H H;  4TLF A;  4LLH A;  3OJA B;  1QLE D;  1FBM A;  2FXM A;  3AE4 C;  2FHS C;  3L71 E;  3H1I J;  1FAV A;  2K88 A;  1LP1 B;  2B88 A;  5C39 A;  7CEI A;  4M0I A;  2KK7 A;  3OAK A;  4D6T E;  3CX5 D;  3HTK B;  1KZU B;  3CCU P;  4KJM A;  4Z1M H;  4DG9 A;  4H13 C;  2A45 I;  3NXS A;  1NTM G;  4TT3 H;  2AFE A;  5GTI E;  1A02 F;  2E74 D;  4WB4 A;  1SQX E;  1GW4 A;  1G2C A;  4UB8 E;  2WPV B;  3TGU E;  1RF1 A;  3CPW O;  1IFI A;  2BAS A;  1YQ3 C;  2P7J A;  4EOT A;  1LTB C;  1JY2 O;  1N73 C;  2JO0 A;  1FZG A;  3CCQ P;  2KGD A;  2GZI A;  3L73 J;  4GOE A;  4PD4 E;  2WPT A;  4XFZ A;  1LP1 A;  3P8C D;  2OYI B;  1A02 J;  3CD6 P;  1T2K D;  3EQ2 A;  1OWA A;  1KOR A;  1VQM P;  3HTK A;  1EZV I;  2BUO A;  2DGY A;  2FYU K;  2YKQ A;  2BEQ D;  2PEQ A;  1N7S D;  5AVZ B;  2KB7 P;  1IO4 A;  5AVY B;  3KDP B;  1FZF A;  1PGQ A;  1DIP A;  1NO4 A;  3M0D A;  1EQ7 A;  2PGD A;  1URQ C;  2QEX P;  3WU2 E;  3HD7 D;  1NH4 A;  1LWU B;  1FZC C;  2I1K A;  1DEE G;  4I6M C;  3HZQ A;  3SWK A;  5HGM A;  5DCK A;  1Q86 Q;  2NPS A;  3GF3 A;  1ZMB A;  4I7Z C;  3H1I E;  2OYI A;  1MZ8 A;  2KSE A;  3R2P A;  2E5T A;  2FVF A;  5APY A;  1LJ2 A;  3F5H A;  3H47 A;  2D2C D;  4XRO A;  3CWB J;  2LML A;  3BCC D;  3FWN A;  5APU A;  2WSE J;  2FXP A;  3B5I A;  3L71 G;  1PGP A;  3HUS B;  1D7M A;  5DJU B;  2O01 N;  1SQQ K;  3V2Q A;  1GU5 A;  2WSC H;  4D6T G;  1J1E B;  1FJP A;  3H6P A;  3VOP A;  3PHL A;  3CCV P;  1KIL B;  1KB9 I;  2P9X A;  3A5T A;  2K0X A;  1T3U A;  5KAI E;  2KOS A;  2WQY C;  1LWU C;  1LT9 B;  3A2A A;  2Y9Z A;  1LTJ B;  2KOD A;  4BPH A;  3M9B A;  3L73 E;  1VHN A;  4XRQ A;  2FFD B;  4AUW A;  3MP7 B;  3KXD A;  3G1I A;  1SQX G;  3HE5 A;  3JCU E;  3E2D A;  1L0L J;  2Z46 A;  1MZ9 A;  1M6E X;  3Q3D A;  1ZP0 C;  3GG2 A;  4IL6 E;  1S4X A;  1R5L A;  3TGU G;  2FY8 A;  3AE6 C;  4HJG H;  1GPJ A;  4N3Y B;  3L75 D;  1EDJ A;  3TDK A;  1HTL C;  4H2Y C;  1AV1 A;  2PEJ A;  2J59 M;  5E79 H;  4I2L C;  3HUS A;  1S5L X;  4L75 A;  3RL0 D;  5AVS B;  4OGQ C;  3AEE C;  4WWI A;  1JMM A;  3E1I A;  1K04 A;  5APW A;  3HUS C;  2XDJ A;  5B5E E;  1Z6M A;  1YQ4 C;  3SSU A;  3H1J D;  2XNX A;  1J1E C;  1IUQ A;  4W7Z A;  3CL3 D;  1KIL C;  4R4L A;  2L0Q A;  1K30 A;  2E75 D;  1LTJ A;  4WY4 D;  2FVE A;  3LRY A;  2GZG A;  2FYU J;  1BGY J;  2FFD A;  1LT9 C;  1LTJ C;  1GL2 C;  3MIW A;  2ONT A;  2KXP B;  2FFD C;  3PJS K;  1VKU A;  2M8P A;  5AW5 B;  2E74 B;  1RH5 B;  1S9K E;  5CHX A;  3CWB E;  3G0V A;  2PY8 A;  2KOP A;  5CCH A;  5KP8 B;  2JP3 A;  2P58 A;  1FZA A;  1FOS F;  3H1H D;  2BQ1 E;  1M74 A;  2XU6 A;  4H13 D;  5CCH C;  3H1I G;  2C0X A;  2R3C A;  2Q7C A;  1HBW A;  4YTP C;  1AQ5 A;  1EDI A;  1EDK A;  3PH0 A;  1KC8 Q;  1X3O A;  3GW6 A;  2FQ0 A;  4HB1 A;  2LF4 A;  2MVU A;  1SQV K;  3CC2 P;  1NTZ D;  2XT1 A;  4IPY A;  1IK9 A;  3U1A A;  2QM8 A;  2GZE A;  4LC1 A;  2WSF H;  1L0L E;  4PD4 H;  2MD9 A;  2N5H A;  1RF0 A;  2ZXX A;  3Q2Y A;  3GZM A;  1HGV A;  4IFD K;  1SQQ J;  2HFE D;  1ZLL A;  1HVV A;  4NPD A;  1SP4 A;  5TIS H;  1YTZ T;  2HG5 D;  3HD7 B;  2QJP B;  1VQ7 P;  2MR7 A;  2KS1 B;  3L73 G;  4HKZ H;  3A0B E;  1MFZ A;  3B8E B;  2MR8 A;  1NU1 D;  2M8R A;  2JKV A;  3MZW B;  1G1J A;  2JU2 A;  4R4M A;  1URQ D;  3D6Z A;  4DZO A;  2FAD A;  1BCC D;  3S4R A;  2UWJ E;  4H0L C;  3GMA A;  5AW3 B;  2RH0 A;  3H1K D;  1NGM B;  1PPJ D;  1L4A C;  1J1D C;  3GHG C;  3RG6 C;  2FYU E;  1BGY E;  1SQB J;  1CZQ A;  2QVA A;  1NTK J;  1WRG A;  5AVU B;  3CCR P;  2GUV A;  1FE6 A;  3M9Q A;  2FKW B;  2GA1 A;  3B4Q A;  4XFY A;  2V4H A;  1N7L A;  1JOC A;  3WUV A;  2GZJ A;  4N78 D;  4PH0 A;  1LTI C;  2RMZ A;  5KP7 B;  4GDO A;  5F2O A;  4U3F D;  3HD7 A;  3SWY A;  2BHV A;  2I8D A;  5EW5 E;  2L6E A;  2KS1 A;  2XND H;  3LW5 H;  4DOJ A;  3F89 A;  3PP5 A;  3CXH I;  3B5N B;  1YBK A;  2N9B A;  1LTA C;  2A06 E;  3CLQ A;  2IBZ I;  2KLV A;  1BE3 J;  4RO0 A;  4GOF A;  1VQ6 P;  4XE5 B;  4QMA A;  1JMB A;  3CWB G;  4GKG A;  1H0T B;  1RE3 A;  1KYO E;  2LKI A;  5APX A;  2Y0E A;  3TNU B;  1LTT C;  3VP8 A;  3RL0 g;  1HWT C;  1FOS E;  1L2P A;  1RE3 C;  1W2E A;  5B66 E;  2AEJ A;  5KJ7 C;  1PP9 D;  4PXH B;  4Y99 B;  1NAF A;  5AW8 B;  5KLV J;  1Q81 Q;  3GZL A;  1ACP A;  3V2P A;  3JCU H;  1JJ2 O;  1SQQ E;  3MGE A;  1JY2 P;  2O01 H;  3AE7 C;  4U0B A;  3RK3 C;  3G6E P;  3O6Q B;  2JO1 A;  3M9H A;  2Q3I A;  4IL6 H;  3L35 A;  3B5N A;  2QRX A;  4AYC A;  2WWW A;  1VL2 A;  2POH A;  3AEC C;  3PTZ A;  1SQV J;  3ABV C;  3HRN A;  1L0L G;  4OGQ D;  2JJL A;  3UIA A;  1W5C E;  3L74 D;  2KOQ A;  3JC2 2;  2JWA A;  1Q90 D;  3EFG A;  1H88 A;  3TNU A;  1ZN5 A;  5CCG A;  3L4F A;  1KIL D;  1MFT A;  1SQB E;  1NTZ K;  3OW2 O;  1NAY A;  2WSF J;  2W27 A;  3N7N A;  1NTK E;  1JY2 N;  2KGE A;  2KG6 A;  3VMY A;  3KHU A;  1YJW P;  1E0H A;  1S3J A;  4U0A A;  3CCJ P;  4U0F A;  1GL2 D;  1OR5 A;  3O6Q A;  2NO8 A;  4Y99 C;  5AVR B;  5AW9 B;  4WBA A;  4IZ6 A;  5AW6 B;  1EZV E;  2FYU G;  1BGY G;  3DPH A;  1Z56 A;  3H1L J;  1Y8A A;  1NTM D;  2CK3 H;  4BRY A;  2WVR A;  2WSE H;  3RG2 A;  2H88 C;  4WY4 A;  1HUC A;  4OWF A;  5CCH D;  2QIW A;  4C7R A;  3H32 B;  1N73 B;  1UIX A;  1BE3 E;  1DV5 A;  3DTJ A;  2M8N A;  2QA4 P;  3VP9 A;  3GF7 A;  4MN4 C;  1JEK A;  1P84 I;  1SS1 A;  1OVV A;  1K73 Q;  2A06 G;  3CCS P;  1X0T A;  3JSV C;  1RO0 A;  5KLV E;  1L0N K;  1SLQ A;  1SQP K;  1GMJ A;  2KNC B;  1NJI Q;  3LW5 J;  3Q5S A;  2PEM A;  2Z4E A;  1ZOY C;  2Y0C A;  5BVZ A;  3H25 A;  1URQ B;  2OTK E;  3IF4 A;  4YXW H;  2IDB A;  4JF7 A;  3AEF C;  1EIA A;  1FZC B;  2E76 C;  1SQV E;  1JY3 O;  1GU4 A;  3A0B H;  5CBN A;  3H32 A;  2MF4 A;  1N73 A;  3CX5 I;  2DW3 A;  4BWN A;  2K1A A;  5HGL A;  4I1L A;  1M8O B;  1CEI A;  1SQQ G;  5APS A;  3Q20 A;  3G4S P;  1JTH B;  2W6B A;  4B86 A;  3RK3 E;  3CC4 P;  4I7Z B;  4Y28 J;  2FAC A;  1R5S A;  1L0I A;  4H0L D;  2BCC J;  2R5D A;  1KB9 E;  2K9Y A;  2YXQ B;  1M90 Q;  1AQT A;  1L4A D;  3M0A A;  2ZFC A;  1AFO A;  1HQB A;  1X8Y A;  3NTN A;  2A45 G;  2O01 J;  2K93 A;  2JAZ A;  3TK1 A;  1Y47 A;  2QSI A;  1DH3 A;  3MD0 A;  5TIS E;  2KNC A;  5HGO A;  5HGN A;  3AE2 C;  1X22 A;  1URQ A;  1AJY A;  3DS0 A;  1SQB G;  1USD A;  3C9I A;  3H1L E;  1QGK B;  1NTK G;  1PL5 A;  3I55 P;  1USE A;  1FZC A;  2KSJ A;  3L71 D;  1VQP P;  2GM4 A;  2AEF A;  2AFD A;  3NTE A;  3Q5R A;  1NTZ J;  4D6T D;  1KLP A;  1XTC C;  2Q1K A;  2P10 A;  2WSS H;  5AW7 B;  3U43 A;  2R44 A;  2K2Q A;  3G71 P;  1DD4 A;  2WPQ A;  1YJ9 P;  1NKZ B;  4W80 A;  3D6Y A;  3IR9 A;  1EZV G;  5H2F E;  1F80 D;  3P8M C;  1KYO H;  3MUD C;  4JYB A;  2N5I A;  1QL2 A;  4BXL A;  3ITK A;  4KHX A;  2E43 A;  1SQX D;  1ZRT E;  5B66 H;  4EYY Q;  3CXC O;  4ASV A;  5KJ7 D;  1BE3 G;  2GZF A;  2LOL A;  3C1L A;  1OW8 A;  3TGU D;  4ZKU A;  2YKP A;  1J2J B;  1OMI A;  1HY8 A;  3BVH A;  1YIT P;  1RQU A;  2YO3 A;  2KG8 A;  2ZT9 B;  4OGQ B;  2N9Y B;  1PV3 A;  2KZJ A;  2K92 A;  3Q5P A;  4CA3 A;  1OW7 A;  4IL6 X;  4PD4 D;  3L70 J;  1LWU A;  3QWO C;  1IFD A;  3RBX A;  2YO2 A;  5KLV G;  2JYL A;  3B5N D;  2A45 H;  1AYI A;  2YKO A;  4XFX A;  2JYG A;  2BCC E;  2JBG A;  1MKM A;  1GL2 B;  1L0N J;  1SQP J;  3DS1 A;  2PEO A;  3IAO A;  2MVV A;  1X9V A;  2M5R A;  1IMQ A;  1SQV G;  5CCG D;  2KOG A;  2O3J A;  2SPZ A;  3D70 A;  1H8A A;  2QNW A;  2M8L A;  2ITA A;  4EDF A;  2GDY A;  1CW5 A;  2O1J A;  4R0M A;  2K3R A;  1NWQ A;  1FZB A;  1AF8 A;  2ZT9 C;  3H1I D;  2YNY A;  1KIL A;  2ZYD A;  4JBZ A;  3MGN A;  1M1J C;  2HYN A;  2L4B A;  4HH2 A;  1AA0 A;  3S1K A;  3A3Y B;  1GW3 A;  1LT9 A;  2PP6 A;  3ZDM A;  3CCE P;  3N4X A;  1HJ0 A;  1GL2 A;  5JPA A;  1N2D C;  3FWL A;  5APT A;  3H1L G;  1CI6 B;  2AEM A;  1GXH A;  2AVA A;  2HOD B;  1AUM A;  2KOR A;  2J5U A;  2N1T C;  2VLN A;  1RQV A;  2OQQ A;  1LTS C;  1EC5 A;  2LPK A;  1HGZ A;  5APQ A;  2RKL A;  3A7O A;  1KMI Z;  3L74 J;  1G1I A;  2B87 B;  3L73 D;  1IFN A;  1BSH A;  3L70 E;  3VRL C;  4C7N B;  4H0L B;  2E76 D;  3II6 A;  2CGQ A;  3B4S A;  3T97 B;  3CXH E;  5AVQ B;  2G8Y A;  4XFJ A;  1BXI A;  2CG5 B;  1GD2 E;  3HYB A;  1J1D B;  1L4A B;  3GHG B;  1KQL A;  2R5B A;  1NQ4 A;  4ZNC A;  2JQ4 A;  2IBZ E;  2PRR A;  1E5W A;  1L0N E;  1SQP E;  1CI6 A;  5DJT B;  3G9R A;  1SFC C;  2CNR A;  1KB9 H;  3L72 J;  2R32 A;  4UHP B;  1Q2N A;  5EJD A;  3SFE C;  4U0D A;  4YPC A;  4H2W C;  4XA4 A;  2KR5 A;  2BCC G;  1OXZ A;  1UII A;  1NOH A;  3LIE A;  3DS5 A;  3FXD A;  2CWO A;  1PEU A;  2IX7 C;  1BDC A;  2HPC B;  1KQG B;  4C7N A;  2H43 A;  3G21 A;  3T97 A;  1MV8 A;  2VLQ A;  3G1G A;  1L4A A;  3GHG A;  2AXT H;  2I1J A;  1LTG C;  4K3A A;  1S9K D;  1OW6 A;  3CWB D;  3USS A;  1L0H A;  1VQN P;  1T3J A;  2IZ1 A;  1AVO A;  2OGU A;  3Q1M A;  2LL8 A;  4JYC A;  5H2F H;  2IFN A;  2QE7 H;  3RBZ A;  3LID A;  3RK3 B;  2Z45 A;  1IFM A;  2E42 A;  1HH0 A;  1Y9B A;  1M1K Q;  4RES B;  2FYZ A;  1RE4 C;  1E6J P;  3DS4 A;  1YI2 P;  5CJ0 A;  5BU5 A;  1GK4 A;  1RY3 A;  3MTU E;  2Z44 A;  3PLN A;  4AQR D;  2P2U A;  2FBW C;  1JNM A;  2HPC A;  4K35 A;  2KLU A;  1CSB A;  4GR2 A;  3S9O A;  2Y0D A;  3FX0 A;  3K5B A;  1L0L D;  1RO2 A;  5AVT B;  1FR2 A;  4H2X C;  1MUU A;  2NZ2 A;  3G28 A;  3CCM P;  3VMA A;  1RNI A;  2XZ1 C;  5AW4 B;  1OFC X;  2KI7 B;  5KJ7 A;  5HV8 A;  1M57 D;  1LT1 A;  3CE7 A;  1U57 A;  3L72 E;  3L70 G;  1XTG B;  1JCC A;  3P05 A;  1OIP A;  3DS3 A;  5CZD B;  3AED C;  2WZ7 A;  2L5G B;  2WPS A;  1P84 E;  1PGJ A;  2KYV A;  1E79 H;  2OYO A;  3AE8 C;  2IBZ G;  1L0N G;  1M7L A;  1SQP G;  2EHS A;  2FYU D;  1BGY D;  1KQF B;  4KT0 J;  4ASW A;  2M3E A;  5CBO A;  4COC A;  1EOQ A;  3BAS A;  1YHQ P;  2PAJ A;  2M3B A;  1VF5 C;  1N8R Q;  3M1M A;  2ZT9 D;  1JY3 N;  2M5A B;  3EWK A;  3FGA D;  3AE1 C;  1H0T A;  4JQ0 D;  3KZI H;  3CX5 E;  2ZVO B;  3V4Q A;  1BAJ A;  1GTW A;  4WYM A;  3BCC J;  1H89 A;  2A06 D;  2BEZ F;  2GYK A;  2N6Y A;  3CC7 P;  2XV5 A;  1EXI A;  2N1T D;  3KQG A;  2Z5I A;  1ZV8 A;  2E76 B;  1KYO D;  4HKG A;  1FDM A;  3VYI A;  3KPE A;  1A43 A;  4GR6 A;  1K8A Q;  5M1B A;  1NU1 K;  3RK2 C;  2ZJS E;  2ZYG A;  3BAT A;  2W83 C;  2LIU A;  1ZR2 A;  1YIJ P;  2M5A A;  5KLI C;  5BS1 A;  3P8C E;  3BRT B;  4U0E A;  1N86 A;  1SQQ D;  3CXH H;  3P7K A;  3I56 P;  2FQ1 A;  1OZH A;  2LXC B;  1NVO A;  2E75 C;  1G2C B;  1U7M A;  3L75 J;  2IZ0 A;  1SFC D;  1S72 P;  3AE5 C;  4H44 B;  2GDW A;  1JUN A;  2KG9 A;  1DEB A;  3TSI A;  1AVY A;  3CMA P;  2M0B A;  2PEK A;  2X2B A;  2KGC A;  1FDI A;  3H1J J;  4L76 A;  3W67 A;  1SQB D;  2E1M A;  2PNG A;  2CPS A;  3SFD C;  5K5G B;  1NTK D;  3L72 G;  4ZKP A;  4COP A;  1VQ4 P;  2Q5U A;  2WPR A;  2MKV A;  4RJT A;  1HF9 A;  1JM0 A;  2K94 A;  1L0L K;  1IK7 A;  2H7H A;  4PWV B;  1QVG O;  1NYH A;  2LTE A;  3M91 A;  2EFJ A;  2OTL P;  2JGP A;  2JDI H;  1X79 B;  1PEQ A;  1UNK A;  1IC2 A;  4NEO A;  1EZV D;  2LR2 A;  3KYQ A;  1PZQ A;  2W6J H;  3BCC E;  3L37 A;  4L74 A;  5TJH A;  3H1H J;  2IYP A;  1JO5 A;  2NPS B;  1RF1 C;  4DJG A;  1BE3 D;  4H44 C;  1PGO A;  1DNY A;  4WVZ A;  2N6Z A;  2GUS A;  3V5B A;  2ROQ A;  5BU8 B;  4L73 A;  1KFN A;  2IFM A;  2L9F A;  2XZ0 D;  2MY5 A;  2AXT E;  2R3S A;  3FXE A;  1JB0 J;  5BS2 A;  2WMM A;  1HJB A;  2V7Q J;  1JTH A;  4IFM A;  1KTM A;  3IN6 A;  5KLV D;  5APV A;  1IZN B;  3MUD A;  3AEB C;  3E1R A;  4HYT B;  1LGH B;  2KZI A;  4OVN F;  2KW2 A;  2QM7 A;  2QJY B;  3QH9 A;  2JWD A;  3M0D C;  1UJZ A;  1U7J A;  3L75 E;  4QKO A;  4GIF A;  1FC2 C;  1EXJ A;  1FJK A;  1SQV D;  3G29 A;  5AVV B;  1FZE A;  4RKU J;  4YXD C;  1ZR4 A;  1NU1 J;  2XV6 A;  3AE3 C;  3AEA C;  2VSQ A;  1W2B O;  2NPS C;  2Q3E A;  2EG5 A;  3RK3 D;  1NKN A;  3V4W A;  2QG4 A;  1P84 H;  3AE9 C;  2N98 A;  3H1J E;  3HE5 B;  1BCC J;  2DNW A;  1K9M Q;  1KB9 D;  1NTM K;  2OYI C;  2L22 A;  1M1J B;  3R4Y A;  2AXC A;  1PEO A;  3H1K J;  2O1K A;  1YTZ I;  1GDT A;  3AEG C;  2J58 A;  4NPF X;  1OVU A;  5KTB A;  1VF5 D;  2PEI A;  4N6J A;  4PJ0 H;  2CPB A;  5AVW B;  3O8Z A;  2K0Y A;  1PIX A;  3PRJ A;  2AF8 A;  5KAF E;  1JCD A;  1ZW0 A;  3RGU A;  2JB0 A;  4UB6 E;  2B89 A;  3CX5 H;  3H1L D;  1S1C X;  4PD4 I;  4U3F J;  2N1T B;  2QJY C;  3BRV B;  1DD3 A;  3H1H E;  2FYN B;  1M56 D;  5I4T G;  1K05 A;  2ZVN B;  4ZMD A;  4EI2 A;  1VQ8 P;  2KIK A;  4PH1 A;  1M1J A;  1KN7 A;  2KP8 A;  4PV1 B;  1SQB K;  3BCC G;  3M06 A;  1NTK K;  2XZR A;  2YMY A;  2KGA A;  1NTZ E;  2XKM A;  3RK2 D;  3KZI E;  1IFP A;  1ZRT D;  3WBH A;  1QL1 A;  1SFC B;  1PP9 J;  1GXG A;  2LXB A; 
#chains in the Genus database with same CATH homology
 2LF4 A;  2E1M A;  2Z46 A;  2JYL A;  3CC2 P;  1M6E X;  1QVF O;  2XV6 A;  2Z45 A;  2XT1 A;  4IPY A;  4COP A;  4XFX A;  1VQ4 P;  1W2B O;  2JYG A;  1M1K Q;  2QEX P;  1BAJ A;  2EG5 A;  1PEM A;  3DPH A;  1VQ6 P;  3VRL C;  2PEJ A;  1E6J P;  4WYM A;  3DS4 A;  1YI2 P;  1K9M Q;  5HGO A;  3DS1 A;  5HGN A;  1QVG O;  2PEO A;  1M6N A;  2EFJ A;  3HZQ A;  4M0I A;  1PEO A;  2Z44 A;  2OTL P;  3HYB A;  5HGM A;  5DCK A;  1Q86 Q;  1ZMB A;  3CC7 P;  4GR2 A;  1Q7Y Q;  1PEQ A;  3DS0 A;  3DTJ A;  2PEI A;  3I55 P;  1VQP P;  2M8N A;  3CCU P;  1VQ7 P;  1IUQ A;  3NTE A;  2M8L A;  1Q81 Q;  1VQK P;  1RO2 A;  2QA4 P;  1K30 A;  1Q82 Q;  5F2K A;  1JJ2 O;  3MGE A;  1A43 A;  3G28 A;  4GR6 A;  1K8A Q;  4U0B A;  3G6E P;  3LRY A;  3CCM P;  3DS2 A;  1RNI A;  1K73 Q;  2OTJ P;  3H47 A;  3G71 P;  3CCS P;  4XRO A;  3CCL P;  1RO0 A;  4QNB A;  1YIJ P;  4U0D A;  1D1D A;  5BS1 A;  1YJ9 P;  2ONT A;  1QRJ A;  1NJI Q;  3B5I A;  4U0E A;  3CPW O;  5I4T G;  1KD1 Q;  2M8P A;  2PEM A;  3RG6 C;  3DS5 A;  3P05 A;  2EIA A;  2JO0 A;  3I56 P;  2CWO A;  3DS3 A;  2PEN A;  3G0V A;  3CCE P;  5BS2 A;  1PEU A;  1VQ9 P;  1VQ8 P;  3CCQ P;  2PY8 A;  2OAR A;  4PH1 A;  3CCV P;  3G21 A;  3CXC O;  1EIA A;  2P9X A;  5JPA A;  3CCR P;  3G26 A;  4XFZ A;  4U0C A;  2BQ1 E;  5F2N A;  1M74 A;  4XFY A;  2XXM A;  3G1G A;  1S72 P;  3H0D A;  3CD6 P;  3OW2 O;  1VQM P;  1YJN P;  1YIT P;  4PH0 A;  5HGL A;  2BUO A;  2KOD A;  4COC A;  1EOQ A;  2DGY A;  1AUM A;  5F2O A;  1VQL P;  1KQS O;  2BHV A;  3Q20 A;  3G4S P;  1VQ5 P;  1YHQ P;  1VQN P;  3H4E A;  1KC8 Q;  2PEQ A;  4XRQ A;  1YJW P;  1N8R Q;  3CC4 P;  3M1M A;  2L6E A;  3WBH A;  3CMA P;  4U0A A;  3CCJ P;  1A8O A;  3G1I A;  2PEK A;  4U0F A;  3CME P;  1VQO P;  1M90 Q;  3E2D A;  3G29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...