3DS2A

Hiv-1 capsid c-terminal domain mutant (y169a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
84
structure length
84
Chain Sequence
TSILDIRQGPKEPFRDYVDRFAKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 27
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds2A00
1QRJA 2XXMA 4U0AA 3MGEA 4XFXA 1E6JP 1EIAA 3DS3A 1AUMA 3G1GA 3NTEA 4U0FA 4WYMA 2XV6A 4XFYA 4U0DA 5I4TG 2BUOA 4XRQA 4XFZA 3G28A 4COPA 1D1DA 4IPYA 1A43A 3P05A 4U0EA 1BAJA 3DS1A 2KODA 5HGMA 5HGOA 3DS2A 2JYLA 4QNBA 5JPAA 3H47A 4PH0A 1A8OA 3VRLC 2M8NA 4U0CA 3DTJA 4COCA 3DPHA 5HGNA 2XT1A 4U0BA 2M8PA 2L6EA 1EOQA 3G0VA 3G1IA 3G21A 3G29A 3G26A 3DS5A 4M0IA 2ONTA 4XROA 4PH1A 2M8LA 3DS0A 3LRYA 3H4EA 2JYGA 2JO0A 5DCKA 3DS4A 5HGLA 2EIAA 2LF4A
chains in the Genus database with same CATH superfamily
3HYBA 1YIJP 3MGEA 4COPA 1VQNP 3I56P 3CCVP 2EHTA 1F80D 4GR2A 2PEJA 1T8KA 2OARA 4H2XC 3RG2A 4PH0A 1A8OA 2KGEA 4BPGA 2K0XA 2NO8A 1K30A 2K0DX 4COCA 2FVAA 3DS4A 2LF4A 1IMPA 5CZDB 2FADA 1VQ4P 4XRQA 1OR5A 2CG5B 3EJBA 3M1MA 4IPYA 3CMAP 3P05A 1YI2P 1ACPA 1UNKA 2JB0A 2VLPA 5JPAA 3DPHA 3CXCO 2ONTA 1CEIA 3H0DA 2N6YA 1K8AQ 2L4BA 1VQKP 2FQ2A 3DS3A 4U0FA 2MD9A 2KOPA 2GZFA 2N5HA 1EMVA 2VSQA 3OW2O 2P9XA 3CD6P 1JJ2O 2K0YA 4U0CA 2N50A 2FQ1A 1M6EX 2PY8A 3G26A 4PWVB 2EIAA 1E6JP 5KP7B 2N6ZA 1AYIA 1M1KQ 2EFJA 2CGQA 4U0DA 2BUOA 2KOSA 1HY8A 2K2QA 2KG9A 3EJEA 2E1MA 1YJWP 2MVUA 1IUQA 2L0QA 1L0HA 1VQMP 4BPHA 4QNBA 3H47A 2GDXA 2XT1A 2L6EA 2CNRA 5HGNA 1EIAA 2JU2A 4XFYA 1K73Q 3CCLP 1HQBA 5F2OA 2DGYA 2K93A 3CCJP 1A43A 2EHSA 3Q20A 2WPTA 5HGMA 2PEMA 2QEXP 3DTJA 5HVCA 2JAZA 2LL8A 3G0VA 1EOQA 1FR2A 2PENA 2Z46A 1YITP 1GXHA 2MR8A 2CWOA 1QVFO 2LTEA 1VQ6P 2GZGA 2KG6A 2LIWA 2ROQA 2M8NA 3CCQP 4F37A 4R0MA 2AVAA 2KGCA 3NY7B 4U0AA 1AUMA 2OTLP 1L0IA 4XFZA 1VQ5P 1BXIA 2K94A 5KP8B 1E0HA 3EJDA 3GZMA 2GYKA 2KODA 4DG9A 3RG6C 4U0BA 4MRTC 1VQOP 3DS0A 2EG5A 3LRYA 2JYGA 3NTEA 1GPJA 5I4TG 3GZLA 5EW5E 1IMQA 2MR7A 5HGOA 1NJIQ 2FQ0A 1QVGO 2QNWA 2KGAA 2KOOA 2X2BA 4PH1A 2JO0A 1W2BO 2GZJA 3CCRP 2KW2A 2KG8A 1X3OA 2JGPA 2MF4A 2LPKA 4U0EA 1Q81Q 1UJZA 2GZEA 3DS2A 2CQ8A 2FVEA 2AFDA 3G1IA 1VQ8P 2FACA 5DCKA 2M5RA 2AFEA 2DNWA 4GR6A 2AF8A 2GDYA 2PEIA 1RNIA 4H2WC 1BAJA 5F2KA 3WBHA 1KQSO 1M90Q 5KP6B 2KGDA 2LOLA 2L22A 2N98A 2GZIA 2KORA 3GJNA 2K5XA 4IZ6A 4M0IA 4XROA 2FHSC 5HGLA 3H4EA 2JU1A 4NEOA 2FAEA 3G4SP 5HV8A 3G6EP 3CPWO 1NQ4A 3LMOA 2MY5A 1YHQP 1YJNP 2JYLA 3CCEP 2LIUA 3G21A 1ZNVA 3DS5A 2PEOA 1VQLP 2XXMA 1Z6MA 1Q86Q 2XV6A 1VKUA 5BS1A 1YJ9P 3I55P 4PXHB 2GDWA 5EJDA 4QKOA 3VRLC 5F2NA 1Q7YQ 2KWLA 2BHVA 2VLNA 2M8LA 1KC8Q 1DNYA 2MVVA 2Z45A 1DV5A 3G28A 3G71P 2LKIA 1KD1Q 1MZ8A 3CC2P 7CEIA 2XZ1C 1KLPA 1M6NA 2Z44A 2JQ4A 2KR5A 3E2DA 4H2YC 1QRJA 2VLQA 4XFXA 1VQ9P 3G1GA 1GXGA 3B5IA 3B4QA 2PEQA 3DS1A 1N8RQ 3CMEP 3GKLC 1M74A 1RO2A 2N5IA 2PEKA 2OTJP 3U43A 5BS2A 2M8PA 1VQ7P 3CE7A 2VLOA 1K9MQ 4BPFA 3CC7P 1Q82Q 4WYMA 3CCMP 2KOQA 1RO0A 2PNGA 1D1DA 2LMLA 1VHNA 2K92A 1S72P 2XZ0D 4HKGA 2JBGA 3HZQA 3CCSP 2ERHA 2L9FA 3CC4P 1ZMBA 4CA3A 4UHPB 2QA4P 3CCUP 1VQPP 3G29A 2FVFA 1AF8A
chains in the Genus database with same CATH topology
3HYBA 1YIJP 2XXMA 3MGEA 4COPA 1EIAA 4XFYA 1Q86Q 1K73Q 3CCRP 2XV6A 3CCLP 5F2OA 1VQNP 5BS1A 3I56P 2DGYA 3CCVP 4GR2A 1YJ9P 3I55P 3CCJP 1A43A 2PEJA 4U0EA 1Q81Q 3Q20A 2OARA 5HGMA 2PEMA 3DS2A 4PH0A 1A8OA 3VRLC 5F2NA 1Q7YQ 2QEXP 3DTJA 1K30A 3G0VA 1EOQA 2BHVA 3G1IA 2M8LA 1VQ8P 2PENA 4COCA 5DCKA 3DS4A 2Z46A 2LF4A 1KC8Q 1YITP 1VQ4P 4GR6A 4XRQA 2Z45A 2PEIA 3G28A 3M1MA 3G71P 1RNIA 4IPYA 3CMAP 2CWOA 3P05A 1KD1Q 1QVFO 1YI2P 1BAJA 1VQ6P 3CC2P 5JPAA 5F2KA 1M6NA 2M8NA 3CCQP 3DPHA 3WBHA 2Z44A 3CXCO 1KQSO 2ONTA 3E2DA 3H0DA 1K8AQ 1QRJA 4U0AA 1M90Q 1VQKP 4XFXA 1VQ9P 3DS3A 4U0FA 3G1GA 1AUMA 2OTLP 4XFZA 3B5IA 1VQ5P 3OW2O 2PEQA 3DS1A 2KODA 1N8RQ 2P9XA 3CMEP 3CD6P 1JJ2O 1M74A 1RO2A 2PEKA 4U0CA 2OTJP 3RG6C 5BS2A 4U0BA 2M8PA 1VQOP 1M6EX 2PY8A 3G26A 4M0IA 4XROA 3DS0A 2EG5A 3H4EA 2JYGA 3LRYA 5HGLA 1VQ7P 2EIAA 1K9MQ 1E6JP 3CC7P 3NTEA 1Q82Q 4WYMA 3G4SP 3CCMP 3G6EP 1RO0A 1M1KQ 2EFJA 4U0DA 5I4TG 2BUOA 1D1DA 3CPWO 1S72P 2E1MA 1YJWP 1IUQA 1YHQP 3HZQA 3CCSP 1YJNP 5HGOA 1VQMP 3CC4P 2JYLA 4QNBA 1ZMBA 1NJIQ 3H47A 2QA4P 1QVGO 3CCEP 2XT1A 3CCUP 2L6EA 3G21A 3G29A 1VQPP 3DS5A 2PEOA 1VQLP 4PH1A 2JO0A 5HGNA 1W2BO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QRJ A;  2XXM A;  4U0A A;  3MGE A;  4XFX A;  1E6J P;  1EIA A;  3DS3 A;  1AUM A;  3G1G A;  3NTE A;  4U0F A;  4WYM A;  2XV6 A;  4XFY A;  4U0D A;  5I4T G;  2BUO A;  4XRQ A;  4XFZ A;  3G28 A;  4COP A;  1D1D A;  4IPY A;  1A43 A;  3P05 A;  4U0E A;  1BAJ A;  3DS1 A;  2KOD A;  5HGM A;  5HGO A;  3DS2 A;  2JYL A;  4QNB A;  5JPA A;  3H47 A;  4PH0 A;  1A8O A;  3VRL C;  2M8N A;  4U0C A;  3DTJ A;  4COC A;  3DPH A;  5HGN A;  2XT1 A;  4U0B A;  2M8P A;  2L6E A;  1EOQ A;  3G0V A;  3G1I A;  3G21 A;  3G29 A;  3G26 A;  3DS5 A;  4M0I A;  2ONT A;  4XRO A;  4PH1 A;  2M8L A;  3DS0 A;  3LRY A;  3H4E A;  2JYG A;  2JO0 A;  5DCK A;  3DS4 A;  5HGL A;  2EIA A;  2LF4 A; 
#chains in the Genus database with same CATH topology
 3HYB A;  1YIJ P;  3MGE A;  4COP A;  1VQN P;  3I56 P;  3CCV P;  2EHT A;  1F80 D;  4GR2 A;  2PEJ A;  1T8K A;  2OAR A;  4H2X C;  3RG2 A;  4PH0 A;  1A8O A;  2KGE A;  4BPG A;  2K0X A;  2NO8 A;  1K30 A;  2K0D X;  4COC A;  2FVA A;  3DS4 A;  2LF4 A;  1IMP A;  5CZD B;  2FAD A;  1VQ4 P;  4XRQ A;  1OR5 A;  2CG5 B;  3EJB A;  3M1M A;  4IPY A;  3CMA P;  3P05 A;  1YI2 P;  1ACP A;  1UNK A;  2JB0 A;  2VLP A;  5JPA A;  3DPH A;  3CXC O;  2ONT A;  1CEI A;  3H0D A;  2N6Y A;  1K8A Q;  2L4B A;  1VQK P;  2FQ2 A;  3DS3 A;  4U0F A;  2MD9 A;  2KOP A;  2GZF A;  2N5H A;  1EMV A;  2VSQ A;  3OW2 O;  2P9X A;  3CD6 P;  1JJ2 O;  2K0Y A;  4U0C A;  2N50 A;  2FQ1 A;  1M6E X;  2PY8 A;  3G26 A;  4PWV B;  2EIA A;  1E6J P;  5KP7 B;  2N6Z A;  1AYI A;  1M1K Q;  2EFJ A;  2CGQ A;  4U0D A;  2BUO A;  2KOS A;  1HY8 A;  2K2Q A;  2KG9 A;  3EJE A;  2E1M A;  1YJW P;  2MVU A;  1IUQ A;  2L0Q A;  1L0H A;  1VQM P;  4BPH A;  4QNB A;  3H47 A;  2GDX A;  2XT1 A;  2L6E A;  2CNR A;  5HGN A;  1EIA A;  2JU2 A;  4XFY A;  1K73 Q;  3CCL P;  1HQB A;  5F2O A;  2DGY A;  2K93 A;  3CCJ P;  1A43 A;  2EHS A;  3Q20 A;  2WPT A;  5HGM A;  2PEM A;  2QEX P;  3DTJ A;  5HVC A;  2JAZ A;  2LL8 A;  3G0V A;  1EOQ A;  1FR2 A;  2PEN A;  2Z46 A;  1YIT P;  1GXH A;  2MR8 A;  2CWO A;  1QVF O;  2LTE A;  1VQ6 P;  2GZG A;  2KG6 A;  2LIW A;  2ROQ A;  2M8N A;  3CCQ P;  4F37 A;  4R0M A;  2AVA A;  2KGC A;  3NY7 B;  4U0A A;  1AUM A;  2OTL P;  1L0I A;  4XFZ A;  1VQ5 P;  1BXI A;  2K94 A;  5KP8 B;  1E0H A;  3EJD A;  3GZM A;  2GYK A;  2KOD A;  4DG9 A;  3RG6 C;  4U0B A;  4MRT C;  1VQO P;  3DS0 A;  2EG5 A;  3LRY A;  2JYG A;  3NTE A;  1GPJ A;  5I4T G;  3GZL A;  5EW5 E;  1IMQ A;  2MR7 A;  5HGO A;  1NJI Q;  2FQ0 A;  1QVG O;  2QNW A;  2KGA A;  2KOO A;  2X2B A;  4PH1 A;  2JO0 A;  1W2B O;  2GZJ A;  3CCR P;  2KW2 A;  2KG8 A;  1X3O A;  2JGP A;  2MF4 A;  2LPK A;  4U0E A;  1Q81 Q;  1UJZ A;  2GZE A;  3DS2 A;  2CQ8 A;  2FVE A;  2AFD A;  3G1I A;  1VQ8 P;  2FAC A;  5DCK A;  2M5R A;  2AFE A;  2DNW A;  4GR6 A;  2AF8 A;  2GDY A;  2PEI A;  1RNI A;  4H2W C;  1BAJ A;  5F2K A;  3WBH A;  1KQS O;  1M90 Q;  5KP6 B;  2KGD A;  2LOL A;  2L22 A;  2N98 A;  2GZI A;  2KOR A;  3GJN A;  2K5X A;  4IZ6 A;  4M0I A;  4XRO A;  2FHS C;  5HGL A;  3H4E A;  2JU1 A;  4NEO A;  2FAE A;  3G4S P;  5HV8 A;  3G6E P;  3CPW O;  1NQ4 A;  3LMO A;  2MY5 A;  1YHQ P;  1YJN P;  2JYL A;  3CCE P;  2LIU A;  3G21 A;  1ZNV A;  3DS5 A;  2PEO A;  1VQL P;  2XXM A;  1Z6M A;  1Q86 Q;  2XV6 A;  1VKU A;  5BS1 A;  1YJ9 P;  3I55 P;  4PXH B;  2GDW A;  5EJD A;  4QKO A;  3VRL C;  5F2N A;  1Q7Y Q;  2KWL A;  2BHV A;  2VLN A;  2M8L A;  1KC8 Q;  1DNY A;  2MVV A;  2Z45 A;  1DV5 A;  3G28 A;  3G71 P;  2LKI A;  1KD1 Q;  1MZ8 A;  3CC2 P;  7CEI A;  2XZ1 C;  1KLP A;  1M6N A;  2Z44 A;  2JQ4 A;  2KR5 A;  3E2D A;  4H2Y C;  1QRJ A;  2VLQ A;  4XFX A;  1VQ9 P;  3G1G A;  1GXG A;  3B5I A;  3B4Q A;  2PEQ A;  3DS1 A;  1N8R Q;  3CME P;  3GKL C;  1M74 A;  1RO2 A;  2N5I A;  2PEK A;  2OTJ P;  3U43 A;  5BS2 A;  2M8P A;  1VQ7 P;  3CE7 A;  2VLO A;  1K9M Q;  4BPF A;  3CC7 P;  1Q82 Q;  4WYM A;  3CCM P;  2KOQ A;  1RO0 A;  2PNG A;  1D1D A;  2LML A;  1VHN A;  2K92 A;  1S72 P;  2XZ0 D;  4HKG A;  2JBG A;  3HZQ A;  3CCS P;  2ERH A;  2L9F A;  3CC4 P;  1ZMB A;  4CA3 A;  4UHP B;  2QA4 P;  3CCU P;  1VQP P;  3G29 A;  2FVF A;  1AF8 A; 
#chains in the Genus database with same CATH homology
 3HYB A;  1YIJ P;  2XXM A;  3MGE A;  4COP A;  1EIA A;  4XFY A;  1Q86 Q;  1K73 Q;  3CCR P;  2XV6 A;  3CCL P;  5F2O A;  1VQN P;  5BS1 A;  3I56 P;  2DGY A;  3CCV P;  4GR2 A;  1YJ9 P;  3I55 P;  3CCJ P;  1A43 A;  2PEJ A;  4U0E A;  1Q81 Q;  3Q20 A;  2OAR A;  5HGM A;  2PEM A;  3DS2 A;  4PH0 A;  1A8O A;  3VRL C;  5F2N A;  1Q7Y Q;  2QEX P;  3DTJ A;  1K30 A;  3G0V A;  1EOQ A;  2BHV A;  3G1I A;  2M8L A;  1VQ8 P;  2PEN A;  4COC A;  5DCK A;  3DS4 A;  2Z46 A;  2LF4 A;  1KC8 Q;  1YIT P;  1VQ4 P;  4GR6 A;  4XRQ A;  2Z45 A;  2PEI A;  3G28 A;  3M1M A;  3G71 P;  1RNI A;  4IPY A;  3CMA P;  2CWO A;  3P05 A;  1KD1 Q;  1QVF O;  1YI2 P;  1BAJ A;  1VQ6 P;  3CC2 P;  5JPA A;  5F2K A;  1M6N A;  2M8N A;  3CCQ P;  3DPH A;  3WBH A;  2Z44 A;  3CXC O;  1KQS O;  2ONT A;  3E2D A;  3H0D A;  1K8A Q;  1QRJ A;  4U0A A;  1M90 Q;  1VQK P;  4XFX A;  1VQ9 P;  3DS3 A;  4U0F A;  3G1G A;  1AUM A;  2OTL P;  4XFZ A;  3B5I A;  1VQ5 P;  3OW2 O;  2PEQ A;  3DS1 A;  2KOD A;  1N8R Q;  2P9X A;  3CME P;  3CD6 P;  1JJ2 O;  1M74 A;  1RO2 A;  2PEK A;  4U0C A;  2OTJ P;  3RG6 C;  5BS2 A;  4U0B A;  2M8P A;  1VQO P;  1M6E X;  2PY8 A;  3G26 A;  4M0I A;  4XRO A;  3DS0 A;  2EG5 A;  3H4E A;  2JYG A;  3LRY A;  5HGL A;  1VQ7 P;  2EIA A;  1K9M Q;  1E6J P;  3CC7 P;  3NTE A;  1Q82 Q;  4WYM A;  3G4S P;  3CCM P;  3G6E P;  1RO0 A;  1M1K Q;  2EFJ A;  4U0D A;  5I4T G;  2BUO A;  1D1D A;  3CPW O;  1S72 P;  2E1M A;  1YJW P;  1IUQ A;  1YHQ P;  3HZQ A;  3CCS P;  1YJN P;  5HGO A;  1VQM P;  3CC4 P;  2JYL A;  4QNB A;  1ZMB A;  1NJI Q;  3H47 A;  2QA4 P;  1QVG O;  3CCE P;  2XT1 A;  3CCU P;  2L6E A;  3G21 A;  3G29 A;  1VQP P;  3DS5 A;  2PEO A;  1VQL P;  4PH1 A;  2JO0 A;  5HGN A;  1W2B O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...