3DS2A

Hiv-1 capsid c-terminal domain mutant (y169a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
84
structure length
84
Chain Sequence
b'TSILDIRQGPKEPFRDYVDRFAKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 27
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds2A00
4XFZA 4PH1A 2BUOA 3P05A 5I4TG 3DPHA 1EOQA 5HGOA 4U0CA 2ONTA 4COPA 1D1DA 2XT1A 4QNBA 2EIAA 3H47A 2XXMA 3DS4A 3DS2A 3VRLC 5JPAA 1A8OA 3MGEA 4XRQA 2L6EA 3DS5A 2JYGA 1EIAA 4M0IA 2JO0A 4U0BA 3G0VA 5HGNA 3LRYA 4U0DA 4U0EA 4U0AA 4IPYA 2M8PA 5HGMA 1A43A 2LF4A 3DS0A 2XV6A 1BAJA 3G1GA 4U0FA 4XFXA 4XROA 2M8LA 4COCA 4PH0A 5DCKA 1AUMA 3G28A 1QRJA 1E6JP 3H4EA 3G29A 5HGLA 3NTEA 3DS1A 4XFYA 2KODA 3G1IA 3G21A 4WYMA 3G26A 3DS3A 2M8NA 2JYLA 3DTJA
chains in the Genus database with same CATH superfamily
3CMAP 2FVEA 3G6EP 2CQ8A 2XXMA 1YIJP 2JBGA 1K9MQ 2JO0A 5F2NA 2N6ZA 3RG6C 2KORA 2KOQA 4DG9A 5BS2A 3NTEA 1VQLP 3RG2A 4GR2A 3GJNA 2VLNA 3CCVP 1D1DA 1EMVA 1Q81Q 1A8OA 3EJEA 1IMQA 3CCJP 3CCUP 4U0AA 2WPTA 1M90Q 3DS0A 2M8LA 2GZEA 1YJNP 2K94A 1VQNP 1L0HA 2EIAA 1VQMP 1UNKA 1W2BO 2BUOA 1Z6MA 1ZNVA 4PWVB 2JB0A 2OTJP 1KC8Q 1MZ8A 1Q82Q 1RNIA 2EHTA 3LRYA 1NJIQ 4U0EA 5DCKA 1VQPP 4UHPB 5EJDA 2KOPA 5HGLA 5BS1A 4PH1A 1M1KQ 3CC7P 2FACA 5I4TG 4BPGA 3LMOA 3CC4P 2GZJA 2K92A 3DS2A 3NY7B 2JYGA 1EIAA 1RO2A 4U0BA 1IMPA 2LIWA 2M8PA 5HGMA 3E2DA 2JQ4A 2CGQA 1VQ6P 2Z46A 3DS3A 2KOSA 2K0XA 2PEMA 4XFZA 2MVVA 3G71P 2GDYA 3DPHA 2MR7A 3EJDA 2GDXA 1HQBA 2AFEA 3CPWO 2MVUA 2FQ1A 1AF8A 3GZMA 1E0HA 3G0VA 2PEQA 3G4SP 3HZQA 1QVGO 4PXHB 3CMEP 1VHNA 2KG6A 4F37A 2LOLA 4QKOA 1M6EX 2JU1A 1IUQA 2N5IA 3CCSP 2GDWA 3U43A 4H2YC 4U0CA 2OARA 3CCEP 2L6EA 2AFDA 2FQ2A 2JGPA 1KQSO 2PEIA 2XV6A 2MY5A 4HKGA 3H4EA 1DV5A 1VKUA 5CZDB 5KP6B 2M8NA 3G26A 1Q86Q 3B4QA 1VQ9P 5KP7B 3H47A 3CCMP 2GZFA 2BHVA 1YI2P 3I55P 2XZ1C 3CE7A 3CC2P 2N98A 2K5XA 1BXIA 2AVAA 3CCRP 2KGCA 1YJ9P 5HV8A 5HGNA 1YJWP 1S72P 1VQKP 3G29A 3CXCO 1FR2A 1VQ8P 2CG5B 1Q7YQ 2FVAA 2MF4A 3M1MA 3CCQP 2XT1A 2PEKA 2MR8A 3DS4A 5JPAA 1JJ2O 2VLQA 2KOOA 2VLPA 2GZIA 2N50A 3Q20A 4IPYA 2K2QA 2KG8A 1A43A 2KGEA 2N6YA 4XROA 5F2OA 4COCA 1N8RQ 2ROQA 2QNWA 3DS1A 4R0MA 3G21A 2Z44A 1K8AQ 1GXGA 2X2BA 5HVCA 1VQ7P 2LTEA 4IZ6A 1HY8A 3CCLP 1X3OA 3H0DA 1F80D 3GZLA 4U0FA 2CNRA 2LMLA 5EW5E 1QRJA 2EFJA 2M5RA 2QEXP 3EJBA 5F2KA 2N5HA 2DGYA 2VLOA 1NQ4A 2CWOA 2ERHA 2DNWA 2KG9A 2OTLP 2GYKA 3GKLC 5KP8B 4XFYA 2KODA 1K73Q 1RO0A 3DTJA 1AYIA 3P05A 1VQ4P 1GXHA 2FVFA 7CEIA 1T8KA 2P9XA 2VSQA 3VRLC 1KD1Q 3I56P 1VQ5P 2KW2A 1DNYA 3HYBA 3G1GA 2EG5A 2K0DX 4CA3A 1ACPA 2KGDA 4MRTC 1YITP 2FHSC 4H2XC 1YHQP 4H2WC 1GPJA 2EHSA 3B5IA 4BPFA 2LF4A 4XFXA 2MD9A 4PH0A 2JAZA 2GZGA 2AF8A 2K0YA 1M6NA 4NEOA 3OW2O 2PNGA 1K30A 1VQOP 3MGEA 3DS5A 2Z45A 4U0DA 2LKIA 3WBHA 2LIUA 3CD6P 2L9FA 2PENA 3G1IA 2L4BA 4WYMA 2QA4P 2E1MA 2KGAA 2LPKA 1UJZA 1ZMBA 4GR6A 4COPA 2XZ0D 2PEJA 2K93A 2KR5A 4QNBA 2L22A 2PY8A 2FQ0A 1BAJA 2FADA 4BPHA 1KLPA 2KWLA 2NO8A 1EOQA 1CEIA 5HGOA 2ONTA 1M74A 2FAEA 4XRQA 4M0IA 2PEOA 1L0IA 1AUMA 3G28A 1E6JP 2L0QA 2JU2A 2LL8A 1QVFO 1OR5A 2JYLA
chains in the Genus database with same CATH topology
4XFZA 3G71P 1VQ8P 3DPHA 1YITP 3CMAP 1Q7YQ 3G6EP 3M1MA 3CCQP 1YHQP 2XT1A 2PEKA 3CPWO 2XXMA 3DS4A 1YIJP 5JPAA 1JJ2O 1K9MQ 2JO0A 3G0VA 3Q20A 2PEQA 5F2NA 3G4SP 3B5IA 4IPYA 3RG6C 1A43A 2LF4A 3HZQA 4XFXA 4XROA 5F2OA 4COCA 4PH0A 1QVGO 1N8RQ 3CMEP 5BS2A 3NTEA 3DS1A 3G21A 1VQLP 2Z44A 1M6EX 1M6NA 1K8AQ 1IUQA 4GR2A 3CCSP 3OW2O 1K30A 4U0CA 2OARA 3CCVP 1D1DA 1Q81Q 1VQ7P 3CCEP 1VQOP 1A8OA 3MGEA 2L6EA 3DS5A 2Z45A 3CCJP 3CCUP 3CCLP 4U0DA 4U0AA 3WBHA 1KQSO 1M90Q 3H0DA 2PEIA 2XV6A 3DS0A 4U0FA 2M8LA 1QRJA 1YJNP 3CD6P 3H4EA 2PENA 1VQNP 3G1IA 4WYMA 2EFJA 2QA4P 3G26A 2M8NA 2EIAA 1Q86Q 2E1MA 1VQMP 5F2KA 2QEXP 2BUOA 1W2BO 1VQ9P 1ZMBA 2DGYA 4GR6A 4COPA 2PEJA 2OTJP 4QNBA 1KC8Q 2CWOA 3H47A 3CCMP 1Q82Q 1RNIA 2BHVA 1YI2P 2OTLP 3LRYA 1NJIQ 4U0EA 2PY8A 3I55P 1BAJA 5DCKA 1VQPP 4XFYA 2KODA 1K73Q 5HGLA 5BS1A 1RO0A 3CC2P 3DTJA 4PH1A 1M1KQ 3CC7P 3P05A 5I4TG 1VQ4P 1EOQA 5HGOA 2ONTA 1M74A 2P9XA 3CC4P 3VRLC 3DS2A 1KD1Q 3I56P 3CCRP 1VQ5P 4XRQA 1YJ9P 4M0IA 2JYGA 1EIAA 1RO2A 4U0BA 5HGNA 1YJWP 2PEOA 2M8PA 5HGMA 1S72P 3HYBA 3G1GA 1VQKP 1AUMA 3E2DA 1E6JP 3G28A 3G29A 1VQ6P 2EG5A 2Z46A 3CXCO 1QVFO 3DS3A 2JYLA 2PEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XFZ A;  4PH1 A;  2BUO A;  3P05 A;  5I4T G;  3DPH A;  1EOQ A;  5HGO A;  4U0C A;  2ONT A;  4COP A;  1D1D A;  2XT1 A;  4QNB A;  2EIA A;  3H47 A;  2XXM A;  3DS4 A;  3DS2 A;  3VRL C;  5JPA A;  1A8O A;  3MGE A;  4XRQ A;  2L6E A;  3DS5 A;  2JYG A;  1EIA A;  4M0I A;  2JO0 A;  4U0B A;  3G0V A;  5HGN A;  3LRY A;  4U0D A;  4U0E A;  4U0A A;  4IPY A;  2M8P A;  5HGM A;  1A43 A;  2LF4 A;  3DS0 A;  2XV6 A;  1BAJ A;  3G1G A;  4U0F A;  4XFX A;  4XRO A;  2M8L A;  4COC A;  4PH0 A;  5DCK A;  1AUM A;  3G28 A;  1QRJ A;  1E6J P;  3H4E A;  3G29 A;  5HGL A;  3NTE A;  3DS1 A;  4XFY A;  2KOD A;  3G1I A;  3G21 A;  4WYM A;  3G26 A;  3DS3 A;  2M8N A;  2JYL A;  3DTJ A; 
#chains in the Genus database with same CATH topology
 3CMA P;  2FVE A;  3G6E P;  2CQ8 A;  2XXM A;  1YIJ P;  2JBG A;  1K9M Q;  2JO0 A;  5F2N A;  2N6Z A;  3RG6 C;  2KOR A;  2KOQ A;  4DG9 A;  5BS2 A;  3NTE A;  1VQL P;  3RG2 A;  4GR2 A;  3GJN A;  2VLN A;  3CCV P;  1D1D A;  1EMV A;  1Q81 Q;  1A8O A;  3EJE A;  1IMQ A;  3CCJ P;  3CCU P;  4U0A A;  2WPT A;  1M90 Q;  3DS0 A;  2M8L A;  2GZE A;  1YJN P;  2K94 A;  1VQN P;  1L0H A;  2EIA A;  1VQM P;  1UNK A;  1W2B O;  2BUO A;  1Z6M A;  1ZNV A;  4PWV B;  2JB0 A;  2OTJ P;  1KC8 Q;  1MZ8 A;  1Q82 Q;  1RNI A;  2EHT A;  3LRY A;  1NJI Q;  4U0E A;  5DCK A;  1VQP P;  4UHP B;  5EJD A;  2KOP A;  5HGL A;  5BS1 A;  4PH1 A;  1M1K Q;  3CC7 P;  2FAC A;  5I4T G;  4BPG A;  3LMO A;  3CC4 P;  2GZJ A;  2K92 A;  3DS2 A;  3NY7 B;  2JYG A;  1EIA A;  1RO2 A;  4U0B A;  1IMP A;  2LIW A;  2M8P A;  5HGM A;  3E2D A;  2JQ4 A;  2CGQ A;  1VQ6 P;  2Z46 A;  3DS3 A;  2KOS A;  2K0X A;  2PEM A;  4XFZ A;  2MVV A;  3G71 P;  2GDY A;  3DPH A;  2MR7 A;  3EJD A;  2GDX A;  1HQB A;  2AFE A;  3CPW O;  2MVU A;  2FQ1 A;  1AF8 A;  3GZM A;  1E0H A;  3G0V A;  2PEQ A;  3G4S P;  3HZQ A;  1QVG O;  4PXH B;  3CME P;  1VHN A;  2KG6 A;  4F37 A;  2LOL A;  4QKO A;  1M6E X;  2JU1 A;  1IUQ A;  2N5I A;  3CCS P;  2GDW A;  3U43 A;  4H2Y C;  4U0C A;  2OAR A;  3CCE P;  2L6E A;  2AFD A;  2FQ2 A;  2JGP A;  1KQS O;  2PEI A;  2XV6 A;  2MY5 A;  4HKG A;  3H4E A;  1DV5 A;  1VKU A;  5CZD B;  5KP6 B;  2M8N A;  3G26 A;  1Q86 Q;  3B4Q A;  1VQ9 P;  5KP7 B;  3H47 A;  3CCM P;  2GZF A;  2BHV A;  1YI2 P;  3I55 P;  2XZ1 C;  3CE7 A;  3CC2 P;  2N98 A;  2K5X A;  1BXI A;  2AVA A;  3CCR P;  2KGC A;  1YJ9 P;  5HV8 A;  5HGN A;  1YJW P;  1S72 P;  1VQK P;  3G29 A;  3CXC O;  1FR2 A;  1VQ8 P;  2CG5 B;  1Q7Y Q;  2FVA A;  2MF4 A;  3M1M A;  3CCQ P;  2XT1 A;  2PEK A;  2MR8 A;  3DS4 A;  5JPA A;  1JJ2 O;  2VLQ A;  2KOO A;  2VLP A;  2GZI A;  2N50 A;  3Q20 A;  4IPY A;  2K2Q A;  2KG8 A;  1A43 A;  2KGE A;  2N6Y A;  4XRO A;  5F2O A;  4COC A;  1N8R Q;  2ROQ A;  2QNW A;  3DS1 A;  4R0M A;  3G21 A;  2Z44 A;  1K8A Q;  1GXG A;  2X2B A;  5HVC A;  1VQ7 P;  2LTE A;  4IZ6 A;  1HY8 A;  3CCL P;  1X3O A;  3H0D A;  1F80 D;  3GZL A;  4U0F A;  2CNR A;  2LML A;  5EW5 E;  1QRJ A;  2EFJ A;  2M5R A;  2QEX P;  3EJB A;  5F2K A;  2N5H A;  2DGY A;  2VLO A;  1NQ4 A;  2CWO A;  2ERH A;  2DNW A;  2KG9 A;  2OTL P;  2GYK A;  3GKL C;  5KP8 B;  4XFY A;  2KOD A;  1K73 Q;  1RO0 A;  3DTJ A;  1AYI A;  3P05 A;  1VQ4 P;  1GXH A;  2FVF A;  7CEI A;  1T8K A;  2P9X A;  2VSQ A;  3VRL C;  1KD1 Q;  3I56 P;  1VQ5 P;  2KW2 A;  1DNY A;  3HYB A;  3G1G A;  2EG5 A;  2K0D X;  4CA3 A;  1ACP A;  2KGD A;  4MRT C;  1YIT P;  2FHS C;  4H2X C;  1YHQ P;  4H2W C;  1GPJ A;  2EHS A;  3B5I A;  4BPF A;  2LF4 A;  4XFX A;  2MD9 A;  4PH0 A;  2JAZ A;  2GZG A;  2AF8 A;  2K0Y A;  1M6N A;  4NEO A;  3OW2 O;  2PNG A;  1K30 A;  1VQO P;  3MGE A;  3DS5 A;  2Z45 A;  4U0D A;  2LKI A;  3WBH A;  2LIU A;  3CD6 P;  2L9F A;  2PEN A;  3G1I A;  2L4B A;  4WYM A;  2QA4 P;  2E1M A;  2KGA A;  2LPK A;  1UJZ A;  1ZMB A;  4GR6 A;  4COP A;  2XZ0 D;  2PEJ A;  2K93 A;  2KR5 A;  4QNB A;  2L22 A;  2PY8 A;  2FQ0 A;  1BAJ A;  2FAD A;  4BPH A;  1KLP A;  2KWL A;  2NO8 A;  1EOQ A;  1CEI A;  5HGO A;  2ONT A;  1M74 A;  2FAE A;  4XRQ A;  4M0I A;  2PEO A;  1L0I A;  1AUM A;  3G28 A;  1E6J P;  2L0Q A;  2JU2 A;  2LL8 A;  1QVF O;  1OR5 A;  2JYL A; 
#chains in the Genus database with same CATH homology
 4XFZ A;  3G71 P;  1VQ8 P;  3DPH A;  1YIT P;  3CMA P;  1Q7Y Q;  3G6E P;  3M1M A;  3CCQ P;  1YHQ P;  2XT1 A;  2PEK A;  3CPW O;  2XXM A;  3DS4 A;  1YIJ P;  5JPA A;  1JJ2 O;  1K9M Q;  2JO0 A;  3G0V A;  3Q20 A;  2PEQ A;  5F2N A;  3G4S P;  3B5I A;  4IPY A;  3RG6 C;  1A43 A;  2LF4 A;  3HZQ A;  4XFX A;  4XRO A;  5F2O A;  4COC A;  4PH0 A;  1QVG O;  1N8R Q;  3CME P;  5BS2 A;  3NTE A;  3DS1 A;  3G21 A;  1VQL P;  2Z44 A;  1M6E X;  1M6N A;  1K8A Q;  1IUQ A;  4GR2 A;  3CCS P;  3OW2 O;  1K30 A;  4U0C A;  2OAR A;  3CCV P;  1D1D A;  1Q81 Q;  1VQ7 P;  3CCE P;  1VQO P;  1A8O A;  3MGE A;  2L6E A;  3DS5 A;  2Z45 A;  3CCJ P;  3CCU P;  3CCL P;  4U0D A;  4U0A A;  3WBH A;  1KQS O;  1M90 Q;  3H0D A;  2PEI A;  2XV6 A;  3DS0 A;  4U0F A;  2M8L A;  1QRJ A;  1YJN P;  3CD6 P;  3H4E A;  2PEN A;  1VQN P;  3G1I A;  4WYM A;  2EFJ A;  2QA4 P;  3G26 A;  2M8N A;  2EIA A;  1Q86 Q;  2E1M A;  1VQM P;  5F2K A;  2QEX P;  2BUO A;  1W2B O;  1VQ9 P;  1ZMB A;  2DGY A;  4GR6 A;  4COP A;  2PEJ A;  2OTJ P;  4QNB A;  1KC8 Q;  2CWO A;  3H47 A;  3CCM P;  1Q82 Q;  1RNI A;  2BHV A;  1YI2 P;  2OTL P;  3LRY A;  1NJI Q;  4U0E A;  2PY8 A;  3I55 P;  1BAJ A;  5DCK A;  1VQP P;  4XFY A;  2KOD A;  1K73 Q;  5HGL A;  5BS1 A;  1RO0 A;  3CC2 P;  3DTJ A;  4PH1 A;  1M1K Q;  3CC7 P;  3P05 A;  5I4T G;  1VQ4 P;  1EOQ A;  5HGO A;  2ONT A;  1M74 A;  2P9X A;  3CC4 P;  3VRL C;  3DS2 A;  1KD1 Q;  3I56 P;  3CCR P;  1VQ5 P;  4XRQ A;  1YJ9 P;  4M0I A;  2JYG A;  1EIA A;  1RO2 A;  4U0B A;  5HGN A;  1YJW P;  2PEO A;  2M8P A;  5HGM A;  1S72 P;  3HYB A;  3G1G A;  1VQK P;  1AUM A;  3E2D A;  1E6J P;  3G28 A;  3G29 A;  1VQ6 P;  2EG5 A;  2Z46 A;  3CXC O;  1QVF O;  3DS3 A;  2JYL A;  2PEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...