3DS2A

Hiv-1 capsid c-terminal domain mutant (y169a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
84
structure length
84
Chain Sequence
TSILDIRQGPKEPFRDYVDRFAKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title Residues in the HIV-1 Capsid Assembly Inhibitor Binding Site Are Essential for Maintaining the Assembly-competent Quaternary Structure of the Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 27
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3ds2A00
3H47A 3DS5A 3DS0A 5HGNA 4U0EA 3DTJA 4M0IA 1QRJA 5JPAA 4U0CA 3G1IA 5HGOA 5DCKA 4XFZA 4XFXA 2JO0A 2JYLA 3DS3A 3DPHA 4WYMA 2XT1A 2M8PA 2L6EA 3MGEA 3NTEA 3DS2A 4U0FA 3DS1A 2M8LA 2KODA 3G1GA 1EOQA 3G0VA 3G28A 3G29A 4QNBA 5HGMA 2XV6A 3H4EA 4XRQA 5HGLA 2LF4A 3DS4A 5I4TG 2EIAA 4U0BA 4XROA 3G26A 3VRLC 4COPA 1BAJA 1EIAA 4U0DA 4PH0A 3P05A 2BUOA 4PH1A 1D1DA 1A43A 2JYGA 1AUMA 4U0AA 3G21A 4XFYA 1A8OA 3LRYA 4COCA 2XXMA 2ONTA 2M8NA 1E6JP 4IPYA
chains in the Genus database with same CATH superfamily
2QA4P 1NJIQ 4XFXA 3DPHA 2XT1A 3NTEA 1YITP 3G28A 5HGMA 3G4SP 2LL8A 3OW2O 3Q20A 2DGYA 2M5RA 2MVVA 4PH1A 2FHSC 2AF8A 3GKLC 2VLNA 2ONTA 2LMLA 5HGNA 4U0EA 2JU1A 4PWVB 3GZMA 3CCSP 2CQ8A 2KG6A 4COPA 2BUOA 2GZEA 2JYGA 2GZFA 2XZ1C 4IPYA 1W2BO 1VQPP 1AF8A 1HY8A 2CNRA 1Q81Q 5EJDA 2K2QA 2VSQA 2N5IA 1KD1Q 3DS1A 2CG5B 2MR8A 4H2YC 2LIWA 2FQ2A 2EIAA 2CWOA 3P05A 4U0AA 1M6NA 1RO2A 2FAEA 3DS0A 1EMVA 3G6EP 1YJNP 2LIUA 3B4QA 1X3OA 2XZ0D 1CEIA 1M90Q 1VQ4P 3G29A 2LF4A 2MY5A 1MZ8A 2L22A 2GYKA 1NQ4A 2JQ4A 3G21A 2FVAA 2VLOA 1Q7YQ 1VQMP 2GZGA 3CD6P 3CMEP 2XV6A 2KORA 1Z6MA 1VQ6P 2EHTA 5DCKA 1K30A 3LMOA 3CCVP 2K5XA 3G0VA 3CC4P 2PY8A 2KGDA 3CCMP 1Q86Q 2AFEA 2K94A 4PH0A 1AUMA 4HKGA 1E6JP 1YI2P 4M0IA 1ZNVA 2KR5A 2JYLA 2LKIA 2GZJA 2Z45A 4GR6A 2KW2A 2AVAA 2KOPA 1FR2A 2QEXP 5F2KA 4XROA 1UNKA 2EG5A 1A43A 2Z46A 3HYBA 2OTJP 1VKUA 1A8OA 2N6ZA 4BPHA 1M1KQ 1F80D 2K0DX 3RG2A 4U0CA 5HGOA 3CC7P 3CC2P 1M6EX 2PEIA 4NEOA 1K8AQ 3B5IA 1RO0A 3G1GA 2QNWA 3I55P 2KWLA 2JB0A 3VRLC 4CA3A 1BAJA 1EIAA 2GDWA 1VQKP 1E0HA 2FVEA 5F2OA 3CXCO 4H2XC 2VLQA 4R0MA 1Q82Q 5CZDB 1YIJP 1QVFO 1KQSO 2L4BA 4XFYA 2XXMA 2MF4A 3DTJA 1GPJA 2PEQA 2AFDA 2MR7A 2VLPA 2NO8A 2CGQA 1T8KA 1ZMBA 2L6EA 5KP8B 2K0XA 1IUQA 3WBHA 2PEJA 1HQBA 2KG8A 2FVFA 2X2BA 3NY7B 2JU2A 2KG9A 1S72P 1VQ9P 1QRJA 1DNYA 2EHSA 3G1IA 3CCLP 2L9FA 2M8PA 3MGEA 1QVGO 2OARA 3EJEA 3DS4A 2JAZA 3EJDA 4U0DA 3EJBA 1K9MQ 5BS1A 3CMAP 4QKOA 3DS5A 2LPKA 3CCQP 5JPAA 4UHPB 4XFZA 2JGPA 1RNIA 2K0YA 4IZ6A 3DS2A 3CCEP 2PEOA 1BXIA 2N50A 3HZQA 3CCRP 2L0QA 1D1DA 3U43A 2GZIA 2ROQA 1ACPA 2MVUA 3M1MA 1DV5A 3G71P 5HV8A 1VQ7P 2N98A 1UJZA 2Z44A 4BPGA 2OTLP 2FQ0A 2KGCA 5I4TG 3GZLA 4PXHB 2FACA 1YJ9P 1VQ8P 1M74A 1OR5A 1L0HA 1IMPA 2PEMA 3LRYA 2DNWA 5KP7B 3H47A 4DG9A 3I56P 2JO0A 2FQ1A 2P9XA 4BPFA 1VQNP 4MRTC 3CCJP 3CE7A 2K92A 5EW5E 1AYIA 3H4EA 2KOOA 1GXGA 1N8RQ 3CCUP 3G26A 5HVCA 2JBGA 5F2NA 4GR2A 2FADA 1VQLP 2KGEA 1VHNA 3RG6C 1JJ2O 2KGAA 4WYMA 7CEIA 2E1MA 2LTEA 1YJWP 2KOSA 2GDYA 4U0FA 2PEKA 2KODA 1EOQA 4QNBA 1KLPA 2LOLA 1KC8Q 2PENA 3CPWO 1YHQP 3E2DA 2MD9A 1VQ5P 2N5HA 4F37A 2M8NA 4H2WC 1VQOP 2BHVA 2K93A 3DS3A 2M8LA 1K73Q 1L0IA 2WPTA 2ERHA 1IMQA 3H0DA 4XRQA 2PNGA 5HGLA 2EFJA 4U0BA 1GXHA 5KP6B 5BS2A 3GJNA 4COCA 2GDXA 2KOQA 2N6YA
chains in the Genus database with same CATH topology
3M1MA 1Q7YQ 3G71P 5F2OA 1VQMP 3CXCO 2QA4P 1NJIQ 4XFXA 3DPHA 1VQ7P 3CD6P 2XT1A 2Z44A 2OTLP 3NTEA 1Q82Q 1YITP 3CMEP 3G28A 5HGMA 3G4SP 2XV6A 1YIJP 5I4TG 1QVFO 3OW2O 1YJ9P 1KQSO 3Q20A 2DGYA 1VQ8P 1M74A 4PH1A 4XFYA 3LRYA 2PEMA 2XXMA 2ONTA 1VQ6P 3H47A 5HGNA 4U0EA 3DTJA 2PEQA 3I56P 5DCKA 2JO0A 2P9XA 1VQNP 1ZMBA 1K30A 2L6EA 3CCJP 1IUQA 3CCVP 3G0VA 3CC4P 2PY8A 3H4EA 3WBHA 3CCSP 1N8RQ 2PEJA 3CCUP 3CCMP 3G26A 4COPA 1Q86Q 4PH0A 2BUOA 5F2NA 4GR2A 2JYGA 1AUMA 1VQLP 1E6JP 4IPYA 1YI2P 3RG6C 1JJ2O 1S72P 4M0IA 1VQ9P 1QRJA 1W2BO 3G1IA 3CCLP 1VQPP 2JYLA 4WYMA 2E1MA 2Z45A 4GR6A 2M8PA 3MGEA 1Q81Q 1KD1Q 1YJWP 4U0FA 2PEKA 3DS1A 2KODA 1EOQA 1QVGO 4QNBA 2QEXP 2OARA 5F2KA 3DS4A 2EIAA 1KC8Q 2PENA 4XROA 3CPWO 2CWOA 2EG5A 1YHQP 4U0DA 3P05A 1K9MQ 1A43A 2Z46A 3HYBA 2OTJP 4U0AA 1A8OA 3E2DA 1VQ5P 2M8NA 1M6NA 1RO2A 5BS1A 3CMAP 1M1KQ 3DS5A 3DS0A 1VQOP 3CCQP 2BHVA 5JPAA 4U0CA 5HGOA 3CC7P 3G6EP 4XFZA 3CC2P 1M6EX 3DS3A 1YJNP 1RNIA 2PEIA 1K8AQ 3DS2A 3B5IA 2M8LA 1K73Q 1M90Q 1RO0A 2PEOA 3G1GA 3CCEP 3H0DA 1VQ4P 3G29A 4XRQA 5HGLA 2EFJA 2LF4A 3HZQA 3I55P 4U0BA 3VRLC 1BAJA 1EIAA 5BS2A 3CCRP 1D1DA 3G21A 4COCA 1VQKP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H47 A;  3DS5 A;  3DS0 A;  5HGN A;  4U0E A;  3DTJ A;  4M0I A;  1QRJ A;  5JPA A;  4U0C A;  3G1I A;  5HGO A;  5DCK A;  4XFZ A;  4XFX A;  2JO0 A;  2JYL A;  3DS3 A;  3DPH A;  4WYM A;  2XT1 A;  2M8P A;  2L6E A;  3MGE A;  3NTE A;  3DS2 A;  4U0F A;  3DS1 A;  2M8L A;  2KOD A;  3G1G A;  1EOQ A;  3G0V A;  3G28 A;  3G29 A;  4QNB A;  5HGM A;  2XV6 A;  3H4E A;  4XRQ A;  5HGL A;  2LF4 A;  3DS4 A;  5I4T G;  2EIA A;  4U0B A;  4XRO A;  3G26 A;  3VRL C;  4COP A;  1BAJ A;  1EIA A;  4U0D A;  4PH0 A;  3P05 A;  2BUO A;  4PH1 A;  1D1D A;  1A43 A;  2JYG A;  1AUM A;  4U0A A;  3G21 A;  4XFY A;  1A8O A;  3LRY A;  4COC A;  2XXM A;  2ONT A;  2M8N A;  1E6J P;  4IPY A; 
#chains in the Genus database with same CATH topology
 2QA4 P;  1NJI Q;  4XFX A;  3DPH A;  2XT1 A;  3NTE A;  1YIT P;  3G28 A;  5HGM A;  3G4S P;  2LL8 A;  3OW2 O;  3Q20 A;  2DGY A;  2M5R A;  2MVV A;  4PH1 A;  2FHS C;  2AF8 A;  3GKL C;  2VLN A;  2ONT A;  2LML A;  5HGN A;  4U0E A;  2JU1 A;  4PWV B;  3GZM A;  3CCS P;  2CQ8 A;  2KG6 A;  4COP A;  2BUO A;  2GZE A;  2JYG A;  2GZF A;  2XZ1 C;  4IPY A;  1W2B O;  1VQP P;  1AF8 A;  1HY8 A;  2CNR A;  1Q81 Q;  5EJD A;  2K2Q A;  2VSQ A;  2N5I A;  1KD1 Q;  3DS1 A;  2CG5 B;  2MR8 A;  4H2Y C;  2LIW A;  2FQ2 A;  2EIA A;  2CWO A;  3P05 A;  4U0A A;  1M6N A;  1RO2 A;  2FAE A;  3DS0 A;  1EMV A;  3G6E P;  1YJN P;  2LIU A;  3B4Q A;  1X3O A;  2XZ0 D;  1CEI A;  1M90 Q;  1VQ4 P;  3G29 A;  2LF4 A;  2MY5 A;  1MZ8 A;  2L22 A;  2GYK A;  1NQ4 A;  2JQ4 A;  3G21 A;  2FVA A;  2VLO A;  1Q7Y Q;  1VQM P;  2GZG A;  3CD6 P;  3CME P;  2XV6 A;  2KOR A;  1Z6M A;  1VQ6 P;  2EHT A;  5DCK A;  1K30 A;  3LMO A;  3CCV P;  2K5X A;  3G0V A;  3CC4 P;  2PY8 A;  2KGD A;  3CCM P;  1Q86 Q;  2AFE A;  2K94 A;  4PH0 A;  1AUM A;  4HKG A;  1E6J P;  1YI2 P;  4M0I A;  1ZNV A;  2KR5 A;  2JYL A;  2LKI A;  2GZJ A;  2Z45 A;  4GR6 A;  2KW2 A;  2AVA A;  2KOP A;  1FR2 A;  2QEX P;  5F2K A;  4XRO A;  1UNK A;  2EG5 A;  1A43 A;  2Z46 A;  3HYB A;  2OTJ P;  1VKU A;  1A8O A;  2N6Z A;  4BPH A;  1M1K Q;  1F80 D;  2K0D X;  3RG2 A;  4U0C A;  5HGO A;  3CC7 P;  3CC2 P;  1M6E X;  2PEI A;  4NEO A;  1K8A Q;  3B5I A;  1RO0 A;  3G1G A;  2QNW A;  3I55 P;  2KWL A;  2JB0 A;  3VRL C;  4CA3 A;  1BAJ A;  1EIA A;  2GDW A;  1VQK P;  1E0H A;  2FVE A;  5F2O A;  3CXC O;  4H2X C;  2VLQ A;  4R0M A;  1Q82 Q;  5CZD B;  1YIJ P;  1QVF O;  1KQS O;  2L4B A;  4XFY A;  2XXM A;  2MF4 A;  3DTJ A;  1GPJ A;  2PEQ A;  2AFD A;  2MR7 A;  2VLP A;  2NO8 A;  2CGQ A;  1T8K A;  1ZMB A;  2L6E A;  5KP8 B;  2K0X A;  1IUQ A;  3WBH A;  2PEJ A;  1HQB A;  2KG8 A;  2FVF A;  2X2B A;  3NY7 B;  2JU2 A;  2KG9 A;  1S72 P;  1VQ9 P;  1QRJ A;  1DNY A;  2EHS A;  3G1I A;  3CCL P;  2L9F A;  2M8P A;  3MGE A;  1QVG O;  2OAR A;  3EJE A;  3DS4 A;  2JAZ A;  3EJD A;  4U0D A;  3EJB A;  1K9M Q;  5BS1 A;  3CMA P;  4QKO A;  3DS5 A;  2LPK A;  3CCQ P;  5JPA A;  4UHP B;  4XFZ A;  2JGP A;  1RNI A;  2K0Y A;  4IZ6 A;  3DS2 A;  3CCE P;  2PEO A;  1BXI A;  2N50 A;  3HZQ A;  3CCR P;  2L0Q A;  1D1D A;  3U43 A;  2GZI A;  2ROQ A;  1ACP A;  2MVU A;  3M1M A;  1DV5 A;  3G71 P;  5HV8 A;  1VQ7 P;  2N98 A;  1UJZ A;  2Z44 A;  4BPG A;  2OTL P;  2FQ0 A;  2KGC A;  5I4T G;  3GZL A;  4PXH B;  2FAC A;  1YJ9 P;  1VQ8 P;  1M74 A;  1OR5 A;  1L0H A;  1IMP A;  2PEM A;  3LRY A;  2DNW A;  5KP7 B;  3H47 A;  4DG9 A;  3I56 P;  2JO0 A;  2FQ1 A;  2P9X A;  4BPF A;  1VQN P;  4MRT C;  3CCJ P;  3CE7 A;  2K92 A;  5EW5 E;  1AYI A;  3H4E A;  2KOO A;  1GXG A;  1N8R Q;  3CCU P;  3G26 A;  5HVC A;  2JBG A;  5F2N A;  4GR2 A;  2FAD A;  1VQL P;  2KGE A;  1VHN A;  3RG6 C;  1JJ2 O;  2KGA A;  4WYM A;  7CEI A;  2E1M A;  2LTE A;  1YJW P;  2KOS A;  2GDY A;  4U0F A;  2PEK A;  2KOD A;  1EOQ A;  4QNB A;  1KLP A;  2LOL A;  1KC8 Q;  2PEN A;  3CPW O;  1YHQ P;  3E2D A;  2MD9 A;  1VQ5 P;  2N5H A;  4F37 A;  2M8N A;  4H2W C;  1VQO P;  2BHV A;  2K93 A;  3DS3 A;  2M8L A;  1K73 Q;  1L0I A;  2WPT A;  2ERH A;  1IMQ A;  3H0D A;  4XRQ A;  2PNG A;  5HGL A;  2EFJ A;  4U0B A;  1GXH A;  5KP6 B;  5BS2 A;  3GJN A;  4COC A;  2GDX A;  2KOQ A;  2N6Y A; 
#chains in the Genus database with same CATH homology
 3M1M A;  1Q7Y Q;  3G71 P;  5F2O A;  1VQM P;  3CXC O;  2QA4 P;  1NJI Q;  4XFX A;  3DPH A;  1VQ7 P;  3CD6 P;  2XT1 A;  2Z44 A;  2OTL P;  3NTE A;  1Q82 Q;  1YIT P;  3CME P;  3G28 A;  5HGM A;  3G4S P;  2XV6 A;  1YIJ P;  5I4T G;  1QVF O;  3OW2 O;  1YJ9 P;  1KQS O;  3Q20 A;  2DGY A;  1VQ8 P;  1M74 A;  4PH1 A;  4XFY A;  3LRY A;  2PEM A;  2XXM A;  2ONT A;  1VQ6 P;  3H47 A;  5HGN A;  4U0E A;  3DTJ A;  2PEQ A;  3I56 P;  5DCK A;  2JO0 A;  2P9X A;  1VQN P;  1ZMB A;  1K30 A;  2L6E A;  3CCJ P;  1IUQ A;  3CCV P;  3G0V A;  3CC4 P;  2PY8 A;  3H4E A;  3WBH A;  3CCS P;  1N8R Q;  2PEJ A;  3CCU P;  3CCM P;  3G26 A;  4COP A;  1Q86 Q;  4PH0 A;  2BUO A;  5F2N A;  4GR2 A;  2JYG A;  1AUM A;  1VQL P;  1E6J P;  4IPY A;  1YI2 P;  3RG6 C;  1JJ2 O;  1S72 P;  4M0I A;  1VQ9 P;  1QRJ A;  1W2B O;  3G1I A;  3CCL P;  1VQP P;  2JYL A;  4WYM A;  2E1M A;  2Z45 A;  4GR6 A;  2M8P A;  3MGE A;  1Q81 Q;  1KD1 Q;  1YJW P;  4U0F A;  2PEK A;  3DS1 A;  2KOD A;  1EOQ A;  1QVG O;  4QNB A;  2QEX P;  2OAR A;  5F2K A;  3DS4 A;  2EIA A;  1KC8 Q;  2PEN A;  4XRO A;  3CPW O;  2CWO A;  2EG5 A;  1YHQ P;  4U0D A;  3P05 A;  1K9M Q;  1A43 A;  2Z46 A;  3HYB A;  2OTJ P;  4U0A A;  1A8O A;  3E2D A;  1VQ5 P;  2M8N A;  1M6N A;  1RO2 A;  5BS1 A;  3CMA P;  1M1K Q;  3DS5 A;  3DS0 A;  1VQO P;  3CCQ P;  2BHV A;  5JPA A;  4U0C A;  5HGO A;  3CC7 P;  3G6E P;  4XFZ A;  3CC2 P;  1M6E X;  3DS3 A;  1YJN P;  1RNI A;  2PEI A;  1K8A Q;  3DS2 A;  3B5I A;  2M8L A;  1K73 Q;  1M90 Q;  1RO0 A;  2PEO A;  3G1G A;  3CCE P;  3H0D A;  1VQ4 P;  3G29 A;  4XRQ A;  5HGL A;  2EFJ A;  2LF4 A;  3HZQ A;  3I55 P;  4U0B A;  3VRL C;  1BAJ A;  1EIA A;  5BS2 A;  3CCR P;  1D1D A;  3G21 A;  4COC A;  1VQK P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...