1GXGA

Non-cognate protein-protein interactions: the nmr structure of the colicin e8 inhibitor protein im8 and its interaction with the dnase domain of colicin e9
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
85
structure length
85
Chain Sequence
MELKNSISDYTETEFKKIIEDIINCEGDEKKQDDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAANGKSGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN E8 IMMUNITY PROTEIN
publication title Non-Cognate Protein-Protein Interaction: The NMR Structure of the Colicin E8 Inhibitor Protein Im8 and its Interaction with the DNase Domain of Colicin E9
rcsb
source organism Escherichia coli
molecule tags Inhibitor
total genus 36
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1gxgA00
2GYKA 2K5XA 2WPTA 1ZNVA 7CEIA 1BXIA 1CEIA 2JB0A 2VLNA 4F37A 1E0HA 1AYIA 1UNKA 1IMPA 2VLOA 1EMVA 2GZJA 2JBGA 1GXGA 4QKOA 2JAZA 1UJZA 3GJNA 2VLPA 2NO8A 2ERHA 2GZEA 3U43A 3GKLC 2K0DX 2GZIA 4UHPB 1FR2A 2GZGA 5EW5E 1IMQA 2GZFA 2VLQA 1GXHA 1MZ8A
chains in the Genus database with same CATH superfamily
2JQ4A 2JB0A 3MGEA 3DTJA 1M74A 1M90Q 4GR6A 3NY7B 2ONTA 2PNGA 1VQ5P 2GDYA 2L9FA 2K2QA 2KOQA 1KLPA 2MR8A 5HGNA 2M8LA 2VLQA 1AUMA 1YI2P 4WYMA 1GXGA 2QNWA 3CCJP 3G71P 1UJZA 1DNYA 4BPHA 4U0FA 3VRLC 2K0XA 3CMAP 2FHSC 5BS2A 3EJBA 1M6EX 1CEIA 4PH0A 3LMOA 2OTJP 2LPKA 4U0EA 2N6ZA 4QKOA 2KG9A 2NO8A 1K73Q 4COPA 3DS5A 1EMVA 3RG6C 2N98A 3G26A 1Q7YQ 4U0DA 1EOQA 2EHTA 1BAJA 5HGOA 1E0HA 1RO2A 5F2KA 2XT1A 2CWOA 2FQ0A 3CE7A 2GZEA 2CG5B 1W2BO 2P9XA 2N6YA 2PEKA 5EW5E 1YIJP 5HGLA 1S72P 2AF8A 2KGEA 3LRYA 2LL8A 2CQ8A 2VLNA 2JGPA 4H2YC 2Z45A 5DCKA 1DV5A 4IPYA 2FVFA 4HKGA 1F80D 2QA4P 4XFZA 2VSQA 3H47A 3HZQA 2LOLA 3G29A 2Z46A 1QVFO 2GYKA 2N5IA 3G4SP 1HQBA 1RNIA 2LF4A 5HV8A 1IMPA 5JPAA 2PEOA 3CCMP 2KOOA 3CCEP 1YJWP 1KD1Q 2Z44A 1OR5A 3U43A 2QEXP 2PENA 5KP6B 3Q20A 2LIWA 4NEOA 1GXHA 2AFDA 4CA3A 2MR7A 3NTEA 2PEIA 2L22A 4BPFA 3G1GA 1YITP 2JO0A 2X2BA 1ZMBA 4M0IA 2ERHA 1FR2A 5CZDB 1NQ4A 2GDWA 3EJDA 2FVEA 1KC8Q 1A8OA 1NJIQ 1VQ7P 2LIUA 1K30A 2K93A 2KGCA 5KP7B 1VQ8P 2EFJA 2XXMA 3GZLA 2FVAA 2KGAA 3I56P 2EIAA 5BS1A 5I4TG 3G6EP 2GZFA 2FQ2A 3E2DA 1Q81Q 2L4BA 1IUQA 2JYLA 1VQ9P 4GR2A 2KORA 2EG5A 4R0MA 2AVAA 5EJDA 1AYIA 4XFYA 4XRQA 2K92A 4COCA 1ACPA 3CCSP 2PEJA 2M8PA 2BUOA 3GKLC 1VHNA 3OW2O 3CD6P 2XZ1C 4IZ6A 2PY8A 3CCRP 1VQ4P 1BXIA 2FADA 3H0DA 3EJEA 4PXHB 4H2XC 4QNBA 2KWLA 2AFEA 2VLPA 1A43A 2LMLA 2GZGA 2BHVA 1QRJA 4MRTC 3DPHA 1GPJA 2FQ1A 4H2WC 1Q86Q 2K94A 3CMEP 2ROQA 3CCUP 1RO0A 2JU1A 3GZMA 2KG8A 1YJ9P 2OTLP 1VQ6P 1VQLP 1Z6MA 2K0DX 2KODA 3H4EA 4UHPB 2MY5A 2WPTA 1ZNVA 7CEIA 3CCLP 5HVCA 2OARA 1T8KA 3CCQP 1M1KQ 1QVGO 2KGDA 3G0VA 2VLOA 2N50A 2XZ0D 4U0AA 1YHQP 3RG2A 2XV6A 2DGYA 3B5IA 3CC2P 2EHSA 1N8RQ 1L0IA 3HYBA 1AF8A 4PWVB 1MZ8A 2K5XA 3DS3A 4PH1A 4BPGA 2L0QA 4F37A 2FACA 3G28A 1KQSO 2MVUA 2K0YA 4U0BA 4XROA 3DS0A 1E6JP 1X3OA 1HY8A 3I55P 3CPWO 1EIAA 3B4QA 2GZIA 5KP8B 2LTEA 1VQKP 2KW2A 2KOSA 1YJNP 3DS4A 2PEQA 2JU2A 3CCVP 2CGQA 1K8AQ 1L0HA 2FAEA 1VKUA 3WBHA 2GZJA 3GJNA 3CC7P 2JYGA 1VQOP 3DS1A 1VQPP 2M5RA 1M6NA 3G1IA 3DS2A 2M8NA 2E1MA 3CC4P 2GDXA 2KG6A 5HGMA 1UNKA 5F2NA 2DNWA 2JAZA 2MVVA 3CXCO 2KR5A 2L6EA 1K9MQ 1IMQA 3P05A 2MD9A 3M1MA 1Q82Q 4U0CA 1VQNP 5F2OA 1D1DA 2JBGA 2KOPA 2CNRA 1JJ2O 2LKIA 2PEMA 2MF4A 2N5HA 3G21A 4XFXA 4DG9A 1VQMP
chains in the Genus database with same CATH topology
2GYKA 2K5XA 2WPTA 1ZNVA 7CEIA 1BXIA 1CEIA 2JB0A 2VLNA 4F37A 1E0HA 1AYIA 1UNKA 1IMPA 2VLOA 1EMVA 2GZJA 2JBGA 1GXGA 4QKOA 2JAZA 1UJZA 3GJNA 2VLPA 2NO8A 2ERHA 2GZEA 3U43A 3GKLC 2K0DX 2GZIA 4UHPB 1FR2A 2GZGA 5EW5E 1IMQA 2GZFA 2VLQA 1GXHA 1MZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GYK A;  2K5X A;  2WPT A;  1ZNV A;  7CEI A;  1BXI A;  1CEI A;  2JB0 A;  2VLN A;  4F37 A;  1E0H A;  1AYI A;  1UNK A;  1IMP A;  2VLO A;  1EMV A;  2GZJ A;  2JBG A;  1GXG A;  4QKO A;  2JAZ A;  1UJZ A;  3GJN A;  2VLP A;  2NO8 A;  2ERH A;  2GZE A;  3U43 A;  3GKL C;  2K0D X;  2GZI A;  4UHP B;  1FR2 A;  2GZG A;  5EW5 E;  1IMQ A;  2GZF A;  2VLQ A;  1GXH A;  1MZ8 A; 
#chains in the Genus database with same CATH topology
 2JQ4 A;  2JB0 A;  3MGE A;  3DTJ A;  1M74 A;  1M90 Q;  4GR6 A;  3NY7 B;  2ONT A;  2PNG A;  1VQ5 P;  2GDY A;  2L9F A;  2K2Q A;  2KOQ A;  1KLP A;  2MR8 A;  5HGN A;  2M8L A;  2VLQ A;  1AUM A;  1YI2 P;  4WYM A;  1GXG A;  2QNW A;  3CCJ P;  3G71 P;  1UJZ A;  1DNY A;  4BPH A;  4U0F A;  3VRL C;  2K0X A;  3CMA P;  2FHS C;  5BS2 A;  3EJB A;  1M6E X;  1CEI A;  4PH0 A;  3LMO A;  2OTJ P;  2LPK A;  4U0E A;  2N6Z A;  4QKO A;  2KG9 A;  2NO8 A;  1K73 Q;  4COP A;  3DS5 A;  1EMV A;  3RG6 C;  2N98 A;  3G26 A;  1Q7Y Q;  4U0D A;  1EOQ A;  2EHT A;  1BAJ A;  5HGO A;  1E0H A;  1RO2 A;  5F2K A;  2XT1 A;  2CWO A;  2FQ0 A;  3CE7 A;  2GZE A;  2CG5 B;  1W2B O;  2P9X A;  2N6Y A;  2PEK A;  5EW5 E;  1YIJ P;  5HGL A;  1S72 P;  2AF8 A;  2KGE A;  3LRY A;  2LL8 A;  2CQ8 A;  2VLN A;  2JGP A;  4H2Y C;  2Z45 A;  5DCK A;  1DV5 A;  4IPY A;  2FVF A;  4HKG A;  1F80 D;  2QA4 P;  4XFZ A;  2VSQ A;  3H47 A;  3HZQ A;  2LOL A;  3G29 A;  2Z46 A;  1QVF O;  2GYK A;  2N5I A;  3G4S P;  1HQB A;  1RNI A;  2LF4 A;  5HV8 A;  1IMP A;  5JPA A;  2PEO A;  3CCM P;  2KOO A;  3CCE P;  1YJW P;  1KD1 Q;  2Z44 A;  1OR5 A;  3U43 A;  2QEX P;  2PEN A;  5KP6 B;  3Q20 A;  2LIW A;  4NEO A;  1GXH A;  2AFD A;  4CA3 A;  2MR7 A;  3NTE A;  2PEI A;  2L22 A;  4BPF A;  3G1G A;  1YIT P;  2JO0 A;  2X2B A;  1ZMB A;  4M0I A;  2ERH A;  1FR2 A;  5CZD B;  1NQ4 A;  2GDW A;  3EJD A;  2FVE A;  1KC8 Q;  1A8O A;  1NJI Q;  1VQ7 P;  2LIU A;  1K30 A;  2K93 A;  2KGC A;  5KP7 B;  1VQ8 P;  2EFJ A;  2XXM A;  3GZL A;  2FVA A;  2KGA A;  3I56 P;  2EIA A;  5BS1 A;  5I4T G;  3G6E P;  2GZF A;  2FQ2 A;  3E2D A;  1Q81 Q;  2L4B A;  1IUQ A;  2JYL A;  1VQ9 P;  4GR2 A;  2KOR A;  2EG5 A;  4R0M A;  2AVA A;  5EJD A;  1AYI A;  4XFY A;  4XRQ A;  2K92 A;  4COC A;  1ACP A;  3CCS P;  2PEJ A;  2M8P A;  2BUO A;  3GKL C;  1VHN A;  3OW2 O;  3CD6 P;  2XZ1 C;  4IZ6 A;  2PY8 A;  3CCR P;  1VQ4 P;  1BXI A;  2FAD A;  3H0D A;  3EJE A;  4PXH B;  4H2X C;  4QNB A;  2KWL A;  2AFE A;  2VLP A;  1A43 A;  2LML A;  2GZG A;  2BHV A;  1QRJ A;  4MRT C;  3DPH A;  1GPJ A;  2FQ1 A;  4H2W C;  1Q86 Q;  2K94 A;  3CME P;  2ROQ A;  3CCU P;  1RO0 A;  2JU1 A;  3GZM A;  2KG8 A;  1YJ9 P;  2OTL P;  1VQ6 P;  1VQL P;  1Z6M A;  2K0D X;  2KOD A;  3H4E A;  4UHP B;  2MY5 A;  2WPT A;  1ZNV A;  7CEI A;  3CCL P;  5HVC A;  2OAR A;  1T8K A;  3CCQ P;  1M1K Q;  1QVG O;  2KGD A;  3G0V A;  2VLO A;  2N50 A;  2XZ0 D;  4U0A A;  1YHQ P;  3RG2 A;  2XV6 A;  2DGY A;  3B5I A;  3CC2 P;  2EHS A;  1N8R Q;  1L0I A;  3HYB A;  1AF8 A;  4PWV B;  1MZ8 A;  2K5X A;  3DS3 A;  4PH1 A;  4BPG A;  2L0Q A;  4F37 A;  2FAC A;  3G28 A;  1KQS O;  2MVU A;  2K0Y A;  4U0B A;  4XRO A;  3DS0 A;  1E6J P;  1X3O A;  1HY8 A;  3I55 P;  3CPW O;  1EIA A;  3B4Q A;  2GZI A;  5KP8 B;  2LTE A;  1VQK P;  2KW2 A;  2KOS A;  1YJN P;  3DS4 A;  2PEQ A;  2JU2 A;  3CCV P;  2CGQ A;  1K8A Q;  1L0H A;  2FAE A;  1VKU A;  3WBH A;  2GZJ A;  3GJN A;  3CC7 P;  2JYG A;  1VQO P;  3DS1 A;  1VQP P;  2M5R A;  1M6N A;  3G1I A;  3DS2 A;  2M8N A;  2E1M A;  3CC4 P;  2GDX A;  2KG6 A;  5HGM A;  1UNK A;  5F2N A;  2DNW A;  2JAZ A;  2MVV A;  3CXC O;  2KR5 A;  2L6E A;  1K9M Q;  1IMQ A;  3P05 A;  2MD9 A;  3M1M A;  1Q82 Q;  4U0C A;  1VQN P;  5F2O A;  1D1D A;  2JBG A;  2KOP A;  2CNR A;  1JJ2 O;  2LKI A;  2PEM A;  2MF4 A;  2N5H A;  3G21 A;  4XFX A;  4DG9 A;  1VQM P; 
#chains in the Genus database with same CATH homology
 2GYK A;  2K5X A;  2WPT A;  1ZNV A;  7CEI A;  1BXI A;  1CEI A;  2JB0 A;  2VLN A;  4F37 A;  1E0H A;  1AYI A;  1UNK A;  1IMP A;  2VLO A;  1EMV A;  2GZJ A;  2JBG A;  1GXG A;  4QKO A;  2JAZ A;  1UJZ A;  3GJN A;  2VLP A;  2NO8 A;  2ERH A;  2GZE A;  3U43 A;  3GKL C;  2K0D X;  2GZI A;  4UHP B;  1FR2 A;  2GZG A;  5EW5 E;  1IMQ A;  2GZF A;  2VLQ A;  1GXH A;  1MZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...