1GXGA

Non-cognate protein-protein interactions: the nmr structure of the colicin e8 inhibitor protein im8 and its interaction with the dnase domain of colicin e9
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
85
structure length
85
Chain Sequence
MELKNSISDYTETEFKKIIEDIINCEGDEKKQDDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAANGKSGFKQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Inhibitor
molecule keywords COLICIN E8 IMMUNITY PROTEIN
publication title Non-Cognate Protein-Protein Interaction: The NMR Structure of the Colicin E8 Inhibitor Protein Im8 and its Interaction with the DNase Domain of Colicin E9
rcsb
source organism Escherichia coli
total genus 36
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 1gxgA00
1E0HA 2GZJA 7CEIA 1GXGA 2ERHA 1MZ8A 2GZGA 2WPTA 3GKLC 5EW5E 2K5XA 2JBGA 4UHPB 1BXIA 2GZEA 1EMVA 2GZIA 2K0DX 2NO8A 2JB0A 2VLOA 1UJZA 4F37A 2VLQA 3U43A 4QKOA 3GJNA 2GZFA 1IMPA 1ZNVA 2VLPA 1IMQA 1UNKA 2JAZA 1AYIA 1CEIA 2GYKA 1GXHA 1FR2A 2VLNA
chains in the Genus database with same CATH superfamily
1AF8A 2KG6A 2L22A 2L6EA 5F2NA 1ACPA 2JU2A 2KW2A 2M8PA 2N6ZA 2PEOA 3EJEA 2OARA 2XZ1C 4R0MA 1L0IA 5BS2A 5EJDA 3CCRP 2M5RA 2FVFA 3CCLP 3G71P 2P9XA 2N6YA 1MZ8A 4XFYA 5JPAA 2FVEA 1YITP 2NO8A 2JU1A 1VQ6P 2LPKA 2FADA 2N98A 4BPGA 2BUOA 1UJZA 2FQ1A 2GZFA 2L9FA 3CCMP 3HZQA 5KP8B 1GXHA 1D1DA 3H0DA 2M8NA 1E0HA 3CE7A 1X3OA 4PH1A 4HKGA 1L0HA 2KOPA 5KP6B 1NQ4A 2JB0A 4XFXA 5CZDB 2Z44A 5KP7B 4XFZA 2CG5B 3G1IA 1YJWP 4PWVB 3DPHA 1NJIQ 2ERHA 1K8AQ 1N8RQ 2DNWA 2PY8A 3G26A 1K30A 2MR7A 2XT1A 3GJNA 4BPFA 3CCEP 3RG2A 2PEJA 2Z46A 1VQ7P 2GZGA 2M8LA 3EJBA 4U0AA 3G28A 3B4QA 1EOQA 2GZEA 4GR6A 1DV5A 2EG5A 3NY7B 1K73Q 2LIUA 1M74A 1VQLP 4QKOA 2X2BA 3OW2O 3CCQP 2JAZA 1QRJA 1VQKP 2GYKA 2ROQA 2VLNA 4QNBA 7CEIA 2Z45A 2WPTA 4U0DA 3H47A 2L0QA 3CCVP 3CC2P 3DS1A 2XV6A 2LKIA 1IMPA 3Q20A 1A8OA 3G1GA 4PH0A 1OR5A 1K9MQ 2LIWA 1YHQP 2PEIA 5F2KA 2K93A 5HV8A 2JBGA 2JGPA 4COPA 2OTJP 4U0EA 1A43A 2AF8A 3B5IA 2EHTA 5HGOA 2VLQA 3U43A 3DS3A 4U0CA 2DGYA 1VQ4P 1ZNVA 1UNKA 1DNYA 1BAJA 1CEIA 1FR2A 2N50A 2K0YA 2KR5A 3CCJP 3HYBA 1HQBA 4UHPB 2KOQA 2N5IA 1VQ9P 1RO2A 3MGEA 1KC8Q 2LF4A 3M1MA 4DG9A 2KORA 1EIAA 1YIJP 1W2BO 2PENA 4IPYA 1VQMP 2PEMA 5I4TG 2JYLA 3I55P 3CMEP 2MY5A 3I56P 3GKLC 2JQ4A 2JYGA 2MVVA 1GPJA 2FAEA 1VQ8P 2GDWA 1IMQA 2CNRA 1KQSO 2K2QA 1VQPP 2GDXA 1E6JP 4NEOA 1Q86Q 2PEQA 2MF4A 2K5XA 1VQ5P 1BXIA 2VLOA 4H2YC 4GR2A 1T8KA 5BS1A 2K94A 5HGNA 2KOOA 4XRQA 3P05A 2LL8A 4IZ6A 2GZJA 1KD1Q 3DS2A 5EW5E 3LRYA 3VRLC 1ZMBA 3CCSP 3GZLA 4COCA 1M6EX 2OTLP 1VQOP 3G21A 3DS5A 1QVFO 5HGMA 2VSQA 3G4SP 4BPHA 4H2WC 1YJ9P 1AUMA 2XZ0D 3DS4A 3GZMA 2MD9A 2FQ0A 1GXGA 2PNGA 2BHVA 1VKUA 2K92A 1QVGO 2EHSA 1Q81Q 2FHSC 1Q7YQ 2N5HA 2KG9A 2ONTA 3WBHA 3CC7P 2AFEA 2K0XA 1AYIA 3CC4P 2KOSA 2AFDA 3G6EP 2QEXP 2XXMA 2FQ2A 4XROA 2PEKA 3RG6C 2CGQA 1F80D 2AVAA 3DS0A 4H2XC 5HGLA 2FACA 4CA3A 4M0IA 2L4BA 3CPWO 2JO0A 4PXHB 1Q82Q 3LMOA 1IUQA 2KGCA 2KG8A 2MR8A 3CXCO 1HY8A 3E2DA 1EMVA 1Z6MA 2GZIA 1JJ2O 1S72P 3G0VA 2LTEA 4MRTC 2KODA 2QNWA 2LMLA 2KGDA 1VQNP 3G29A 2QA4P 5F2OA 2KGAA 3CD6P 1M6NA 2EFJA 2K0DX 1RO0A 4U0FA 4U0BA 2CQ8A 1YI2P 2CWOA 3H4EA 1M90Q 2EIAA 2KWLA 2KGEA 3EJDA 2LOLA 2GDYA 3DTJA 4WYMA 1KLPA 2E1MA 5DCKA 2FVAA 2MVUA 5HVCA 4F37A 3CCUP 1RNIA 3NTEA 3CMAP 2VLPA 1VHNA 1YJNP 1M1KQ
chains in the Genus database with same CATH topology
1E0HA 2GZJA 7CEIA 1GXGA 2ERHA 1MZ8A 2GZGA 2WPTA 3GKLC 5EW5E 2K5XA 2JBGA 4UHPB 1BXIA 2GZEA 1EMVA 2GZIA 2K0DX 2NO8A 2JB0A 2VLOA 1UJZA 4F37A 2VLQA 3U43A 4QKOA 3GJNA 2GZFA 1IMPA 1ZNVA 2VLPA 1IMQA 1UNKA 2JAZA 1AYIA 1CEIA 2GYKA 1GXHA 1FR2A 2VLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E0H A;  2GZJ A;  7CEI A;  1GXG A;  2ERH A;  1MZ8 A;  2GZG A;  2WPT A;  3GKL C;  5EW5 E;  2K5X A;  2JBG A;  4UHP B;  1BXI A;  2GZE A;  1EMV A;  2GZI A;  2K0D X;  2NO8 A;  2JB0 A;  2VLO A;  1UJZ A;  4F37 A;  2VLQ A;  3U43 A;  4QKO A;  3GJN A;  2GZF A;  1IMP A;  1ZNV A;  2VLP A;  1IMQ A;  1UNK A;  2JAZ A;  1AYI A;  1CEI A;  2GYK A;  1GXH A;  1FR2 A;  2VLN A; 
#chains in the Genus database with same CATH topology
 1AF8 A;  2KG6 A;  2L22 A;  2L6E A;  5F2N A;  1ACP A;  2JU2 A;  2KW2 A;  2M8P A;  2N6Z A;  2PEO A;  3EJE A;  2OAR A;  2XZ1 C;  4R0M A;  1L0I A;  5BS2 A;  5EJD A;  3CCR P;  2M5R A;  2FVF A;  3CCL P;  3G71 P;  2P9X A;  2N6Y A;  1MZ8 A;  4XFY A;  5JPA A;  2FVE A;  1YIT P;  2NO8 A;  2JU1 A;  1VQ6 P;  2LPK A;  2FAD A;  2N98 A;  4BPG A;  2BUO A;  1UJZ A;  2FQ1 A;  2GZF A;  2L9F A;  3CCM P;  3HZQ A;  5KP8 B;  1GXH A;  1D1D A;  3H0D A;  2M8N A;  1E0H A;  3CE7 A;  1X3O A;  4PH1 A;  4HKG A;  1L0H A;  2KOP A;  5KP6 B;  1NQ4 A;  2JB0 A;  4XFX A;  5CZD B;  2Z44 A;  5KP7 B;  4XFZ A;  2CG5 B;  3G1I A;  1YJW P;  4PWV B;  3DPH A;  1NJI Q;  2ERH A;  1K8A Q;  1N8R Q;  2DNW A;  2PY8 A;  3G26 A;  1K30 A;  2MR7 A;  2XT1 A;  3GJN A;  4BPF A;  3CCE P;  3RG2 A;  2PEJ A;  2Z46 A;  1VQ7 P;  2GZG A;  2M8L A;  3EJB A;  4U0A A;  3G28 A;  3B4Q A;  1EOQ A;  2GZE A;  4GR6 A;  1DV5 A;  2EG5 A;  3NY7 B;  1K73 Q;  2LIU A;  1M74 A;  1VQL P;  4QKO A;  2X2B A;  3OW2 O;  3CCQ P;  2JAZ A;  1QRJ A;  1VQK P;  2GYK A;  2ROQ A;  2VLN A;  4QNB A;  7CEI A;  2Z45 A;  2WPT A;  4U0D A;  3H47 A;  2L0Q A;  3CCV P;  3CC2 P;  3DS1 A;  2XV6 A;  2LKI A;  1IMP A;  3Q20 A;  1A8O A;  3G1G A;  4PH0 A;  1OR5 A;  1K9M Q;  2LIW A;  1YHQ P;  2PEI A;  5F2K A;  2K93 A;  5HV8 A;  2JBG A;  2JGP A;  4COP A;  2OTJ P;  4U0E A;  1A43 A;  2AF8 A;  3B5I A;  2EHT A;  5HGO A;  2VLQ A;  3U43 A;  3DS3 A;  4U0C A;  2DGY A;  1VQ4 P;  1ZNV A;  1UNK A;  1DNY A;  1BAJ A;  1CEI A;  1FR2 A;  2N50 A;  2K0Y A;  2KR5 A;  3CCJ P;  3HYB A;  1HQB A;  4UHP B;  2KOQ A;  2N5I A;  1VQ9 P;  1RO2 A;  3MGE A;  1KC8 Q;  2LF4 A;  3M1M A;  4DG9 A;  2KOR A;  1EIA A;  1YIJ P;  1W2B O;  2PEN A;  4IPY A;  1VQM P;  2PEM A;  5I4T G;  2JYL A;  3I55 P;  3CME P;  2MY5 A;  3I56 P;  3GKL C;  2JQ4 A;  2JYG A;  2MVV A;  1GPJ A;  2FAE A;  1VQ8 P;  2GDW A;  1IMQ A;  2CNR A;  1KQS O;  2K2Q A;  1VQP P;  2GDX A;  1E6J P;  4NEO A;  1Q86 Q;  2PEQ A;  2MF4 A;  2K5X A;  1VQ5 P;  1BXI A;  2VLO A;  4H2Y C;  4GR2 A;  1T8K A;  5BS1 A;  2K94 A;  5HGN A;  2KOO A;  4XRQ A;  3P05 A;  2LL8 A;  4IZ6 A;  2GZJ A;  1KD1 Q;  3DS2 A;  5EW5 E;  3LRY A;  3VRL C;  1ZMB A;  3CCS P;  3GZL A;  4COC A;  1M6E X;  2OTL P;  1VQO P;  3G21 A;  3DS5 A;  1QVF O;  5HGM A;  2VSQ A;  3G4S P;  4BPH A;  4H2W C;  1YJ9 P;  1AUM A;  2XZ0 D;  3DS4 A;  3GZM A;  2MD9 A;  2FQ0 A;  1GXG A;  2PNG A;  2BHV A;  1VKU A;  2K92 A;  1QVG O;  2EHS A;  1Q81 Q;  2FHS C;  1Q7Y Q;  2N5H A;  2KG9 A;  2ONT A;  3WBH A;  3CC7 P;  2AFE A;  2K0X A;  1AYI A;  3CC4 P;  2KOS A;  2AFD A;  3G6E P;  2QEX P;  2XXM A;  2FQ2 A;  4XRO A;  2PEK A;  3RG6 C;  2CGQ A;  1F80 D;  2AVA A;  3DS0 A;  4H2X C;  5HGL A;  2FAC A;  4CA3 A;  4M0I A;  2L4B A;  3CPW O;  2JO0 A;  4PXH B;  1Q82 Q;  3LMO A;  1IUQ A;  2KGC A;  2KG8 A;  2MR8 A;  3CXC O;  1HY8 A;  3E2D A;  1EMV A;  1Z6M A;  2GZI A;  1JJ2 O;  1S72 P;  3G0V A;  2LTE A;  4MRT C;  2KOD A;  2QNW A;  2LML A;  2KGD A;  1VQN P;  3G29 A;  2QA4 P;  5F2O A;  2KGA A;  3CD6 P;  1M6N A;  2EFJ A;  2K0D X;  1RO0 A;  4U0F A;  4U0B A;  2CQ8 A;  1YI2 P;  2CWO A;  3H4E A;  1M90 Q;  2EIA A;  2KWL A;  2KGE A;  3EJD A;  2LOL A;  2GDY A;  3DTJ A;  4WYM A;  1KLP A;  2E1M A;  5DCK A;  2FVA A;  2MVU A;  5HVC A;  4F37 A;  3CCU P;  1RNI A;  3NTE A;  3CMA P;  2VLP A;  1VHN A;  1YJN P;  1M1K Q; 
#chains in the Genus database with same CATH homology
 1E0H A;  2GZJ A;  7CEI A;  1GXG A;  2ERH A;  1MZ8 A;  2GZG A;  2WPT A;  3GKL C;  5EW5 E;  2K5X A;  2JBG A;  4UHP B;  1BXI A;  2GZE A;  1EMV A;  2GZI A;  2K0D X;  2NO8 A;  2JB0 A;  2VLO A;  1UJZ A;  4F37 A;  2VLQ A;  3U43 A;  4QKO A;  3GJN A;  2GZF A;  1IMP A;  1ZNV A;  2VLP A;  1IMQ A;  1UNK A;  2JAZ A;  1AYI A;  1CEI A;  2GYK A;  1GXH A;  1FR2 A;  2VLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...