2PY8A

Rbcx
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
120
structure length
120
Chain Sequence
QTKHIAQATVKVLQSYLTYQAVLRIQSELGETNPPQAIWLNQYLASHSIQNGETFLTELLDENKELVLRILAVREDIAESVLDFLPGMTRNSLAESNIAHRRHLLERLTRTVAEVDNFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Hypothetical protein rbcX
publication title Structure of the RuBisCO chaperone RbcX from Synechocystis sp. PCC6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 50
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2py8A00
2Z46A 3RG6C 5BS2A 2PY8A 4GR2A 4GR6A 2Z45A 3Q20A 5BS1A 2PEJA 2PEOA 2PEQA 3HYBA 2PEMA 2PEIA 2PEKA 2Z44A 2PENA
chains in the Genus database with same CATH superfamily
1F80D 2AVAA 4GR2A 3HYBA 3CCEP 2KR5A 4QKOA 2XZ0D 1K30A 2FAEA 3DS4A 1VQ6P 2QA4P 1YJWP 2MF4A 2PY8A 3DPHA 1RO2A 3CCRP 3EJDA 3E2DA 2EIAA 3NY7B 3G26A 2MY5A 2PEMA 4F37A 1RNIA 3G4SP 1K8AQ 2FVFA 1GXGA 3CCUP 1VQ5P 3CXCO 4M0IA 3CCMP 1Z6MA 1L0HA 4U0EA 4U0DA 3U43A 2LIWA 3CC7P 4PH1A 2K2QA 1QVFO 1VQ8P 1GXHA 1VQ9P 1EOQA 1VHNA 4UHPB 1VQMP 1N8RQ 2E1MA 2LPKA 2JYLA 2FVEA 3H47A 2K0DX 1UNKA 3CCVP 2K94A 2XV6A 4IZ6A 4WYMA 1VQPP 3MGEA 1KD1Q 4QNBA 2M5RA 2LF4A 1IMQA 1BXIA 2N50A 3I56P 2FQ2A 2KG9A 4XFYA 1M6NA 3DS5A 2L9FA 2GZGA 1YHQP 1ZNVA 2MVUA 2KGDA 4COCA 3CCJP 2XXMA 1IUQA 1DNYA 2EG5A 4U0CA 2N98A 2N6ZA 1GPJA 2MD9A 3G28A 2FQ1A 2PEQA 5JPAA 1L0IA 3GZMA 2GZIA 2ONTA 1KC8Q 4U0BA 1ACPA 3B4QA 2CQ8A 1Q7YQ 2AF8A 1A43A 2M8LA 2AFEA 1RO0A 3I55P 2JYGA 2DNWA 3G71P 1IMPA 4XROA 1KQSO 4BPGA 3H0DA 1M6EX 3VRLC 3DS1A 2KOOA 5KP7B 1K9MQ 2JQ4A 2JU1A 5HGMA 1VQKP 1MZ8A 2Z44A 1M90Q 1VQ7P 2KODA 2N5HA 2QNWA 5F2OA 3G21A 3RG2A 2KWLA 3DS3A 4H2WC 3CMAP 1AF8A 5DCKA 2XZ1C 5EJDA 3HZQA 2GZFA 4GR6A 2WPTA 1AUMA 2EFJA 1VQLP 2PENA 1T8KA 2X2BA 2MR7A 1AYIA 2KOPA 3M1MA 1OR5A 3CE7A 3G1GA 1VKUA 2GZJA 1YI2P 2K0YA 2KOQA 2GDWA 2JAZA 2NO8A 1S72P 2JGPA 2BHVA 3OW2O 2FHSC 5HVCA 3RG6C 5F2KA 2CWOA 2JU2A 7CEIA 2DGYA 2MR8A 5HGLA 3G0VA 4MRTC 5BS1A 1EMVA 4PXHB 3G29A 3DS0A 4XFXA 2ERHA 1ZMBA 1M74A 5EW5E 3CCLP 2LTEA 3GZLA 4PWVB 2LL8A 1K73Q 4PH0A 2L6EA 2GYKA 2LKIA 4IPYA 2EHSA 1D1DA 3G1IA 2CGQA 1BAJA 2K92A 4XFZA 2PNGA 2FACA 1HQBA 2KGEA 4H2YC 2VLQA 1CEIA 4R0MA 2VLOA 3DTJA 4H2XC 2Z46A 1VQ4P 2FVAA 3EJBA 2CNRA 4HKGA 2CG5B 3CCSP 2FADA 1X3OA 3CC4P 5F2NA 2P9XA 2PEJA 2KORA 3LRYA 1Q86Q 2OTLP 2ROQA 4CA3A 2N6YA 1NQ4A 3WBHA 3NTEA 2VLNA 3H4EA 3Q20A 2KG6A 1VQNP 5HV8A 2KW2A 5HGNA 3CPWO 5I4TG 4COPA 3EJEA 2M8NA 1E6JP 2GDXA 2K5XA 4BPFA 2LOLA 2BUOA 4XRQA 3CC2P 1E0HA 2JB0A 1YIJP 1NJIQ 1QRJA 2OTJP 2K0XA 1A8OA 5HGOA 2GZEA 2Z45A 2M8PA 1UJZA 2JO0A 2KGAA 1JJ2O 3DS2A 2PEKA 2MVVA 4BPHA 2LIUA 1M1KQ 1W2BO 2AFDA 1HY8A 2OARA 2N5IA 2VSQA 1Q81Q 2KOSA 3B5IA 5KP6B 1FR2A 2K93A 3GKLC 3GJNA 2QEXP 3CD6P 2FQ0A 1YJNP 1EIAA 2KGCA 1VQOP 4DG9A 1QVGO 5CZDB 2VLPA 5BS2A 4NEOA 2PEOA 3CCQP 3P05A 2PEIA 5KP8B 3G6EP 2EHTA 1DV5A 1KLPA 2KG8A 2JBGA 2L0QA 1YJ9P 2L4BA 2LMLA 2L22A 4U0FA 1YITP 3LMOA 3CMEP 2XT1A 4U0AA 1Q82Q 2GDYA
chains in the Genus database with same CATH topology
1S72P 1VQNP 4GR2A 2BHVA 2EG5A 3HYBA 4U0CA 3OW2O 3CCEP 3RG6C 3G28A 5HGNA 5F2KA 2CWOA 2PEQA 3CPWO 1K30A 2DGYA 5HGLA 4COPA 5I4TG 3DS4A 5JPAA 2M8NA 1E6JP 2QA4P 1YJWP 1VQ6P 3G0VA 2BUOA 4XRQA 2PY8A 3DPHA 1RO2A 2ONTA 1KC8Q 5BS1A 3CCRP 3CC2P 1YIJP 4U0BA 3E2DA 2EIAA 1Q7YQ 3G26A 3G29A 1NJIQ 2PEMA 1A43A 1QRJA 2OTJP 3DS0A 1A8OA 1RNIA 2M8LA 4XFXA 5HGOA 3G4SP 3CCUP 1VQ5P 1K8AQ 1RO0A 2Z45A 2JYGA 2JO0A 2M8PA 4M0IA 3I55P 3CXCO 3CCMP 1JJ2O 4U0EA 3G71P 1ZMBA 4U0DA 1M74A 3DS2A 4XROA 3CC7P 4PH1A 2PEKA 3CCLP 1KQSO 1QVFO 1VQ8P 1K73Q 1VQ9P 4PH0A 1EOQA 2L6EA 1VQMP 3H0DA 1M6EX 1N8RQ 1D1DA 4IPYA 3DS1A 3VRLC 1M1KQ 3G1IA 2E1MA 1W2BO 1K9MQ 2JYLA 5HGMA 3H47A 1BAJA 2OARA 4XFZA 3CCVP 1VQKP 2Z44A 1Q81Q 3B5IA 1M90Q 1VQ7P 2KODA 2XV6A 2QEXP 5F2OA 3DTJA 4WYMA 3G21A 2Z46A 3CD6P 1VQPP 3MGEA 1KD1Q 1VQ4P 1YJNP 4QNBA 1EIAA 3DS3A 1VQOP 1QVGO 3CMAP 5BS2A 5DCKA 2PEOA 2LF4A 3CCQP 3P05A 3HZQA 3I56P 4GR6A 4XFYA 3CCSP 1M6NA 2PEIA 1AUMA 2EFJA 1VQLP 3CC4P 2PENA 5F2NA 2P9XA 3G6EP 3DS5A 2PEJA 1YHQP 3LRYA 1Q86Q 2OTLP 1YJ9P 3M1MA 3G1GA 4U0FA 3WBHA 1YITP 3NTEA 4COCA 1YI2P 3CCJP 3H4EA 3CMEP 3Q20A 2XT1A 4U0AA 2XXMA 1IUQA 1Q82Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z46 A;  3RG6 C;  5BS2 A;  2PY8 A;  4GR2 A;  4GR6 A;  2Z45 A;  3Q20 A;  5BS1 A;  2PEJ A;  2PEO A;  2PEQ A;  3HYB A;  2PEM A;  2PEI A;  2PEK A;  2Z44 A;  2PEN A; 
#chains in the Genus database with same CATH topology
 1F80 D;  2AVA A;  4GR2 A;  3HYB A;  3CCE P;  2KR5 A;  4QKO A;  2XZ0 D;  1K30 A;  2FAE A;  3DS4 A;  1VQ6 P;  2QA4 P;  1YJW P;  2MF4 A;  2PY8 A;  3DPH A;  1RO2 A;  3CCR P;  3EJD A;  3E2D A;  2EIA A;  3NY7 B;  3G26 A;  2MY5 A;  2PEM A;  4F37 A;  1RNI A;  3G4S P;  1K8A Q;  2FVF A;  1GXG A;  3CCU P;  1VQ5 P;  3CXC O;  4M0I A;  3CCM P;  1Z6M A;  1L0H A;  4U0E A;  4U0D A;  3U43 A;  2LIW A;  3CC7 P;  4PH1 A;  2K2Q A;  1QVF O;  1VQ8 P;  1GXH A;  1VQ9 P;  1EOQ A;  1VHN A;  4UHP B;  1VQM P;  1N8R Q;  2E1M A;  2LPK A;  2JYL A;  2FVE A;  3H47 A;  2K0D X;  1UNK A;  3CCV P;  2K94 A;  2XV6 A;  4IZ6 A;  4WYM A;  1VQP P;  3MGE A;  1KD1 Q;  4QNB A;  2M5R A;  2LF4 A;  1IMQ A;  1BXI A;  2N50 A;  3I56 P;  2FQ2 A;  2KG9 A;  4XFY A;  1M6N A;  3DS5 A;  2L9F A;  2GZG A;  1YHQ P;  1ZNV A;  2MVU A;  2KGD A;  4COC A;  3CCJ P;  2XXM A;  1IUQ A;  1DNY A;  2EG5 A;  4U0C A;  2N98 A;  2N6Z A;  1GPJ A;  2MD9 A;  3G28 A;  2FQ1 A;  2PEQ A;  5JPA A;  1L0I A;  3GZM A;  2GZI A;  2ONT A;  1KC8 Q;  4U0B A;  1ACP A;  3B4Q A;  2CQ8 A;  1Q7Y Q;  2AF8 A;  1A43 A;  2M8L A;  2AFE A;  1RO0 A;  3I55 P;  2JYG A;  2DNW A;  3G71 P;  1IMP A;  4XRO A;  1KQS O;  4BPG A;  3H0D A;  1M6E X;  3VRL C;  3DS1 A;  2KOO A;  5KP7 B;  1K9M Q;  2JQ4 A;  2JU1 A;  5HGM A;  1VQK P;  1MZ8 A;  2Z44 A;  1M90 Q;  1VQ7 P;  2KOD A;  2N5H A;  2QNW A;  5F2O A;  3G21 A;  3RG2 A;  2KWL A;  3DS3 A;  4H2W C;  3CMA P;  1AF8 A;  5DCK A;  2XZ1 C;  5EJD A;  3HZQ A;  2GZF A;  4GR6 A;  2WPT A;  1AUM A;  2EFJ A;  1VQL P;  2PEN A;  1T8K A;  2X2B A;  2MR7 A;  1AYI A;  2KOP A;  3M1M A;  1OR5 A;  3CE7 A;  3G1G A;  1VKU A;  2GZJ A;  1YI2 P;  2K0Y A;  2KOQ A;  2GDW A;  2JAZ A;  2NO8 A;  1S72 P;  2JGP A;  2BHV A;  3OW2 O;  2FHS C;  5HVC A;  3RG6 C;  5F2K A;  2CWO A;  2JU2 A;  7CEI A;  2DGY A;  2MR8 A;  5HGL A;  3G0V A;  4MRT C;  5BS1 A;  1EMV A;  4PXH B;  3G29 A;  3DS0 A;  4XFX A;  2ERH A;  1ZMB A;  1M74 A;  5EW5 E;  3CCL P;  2LTE A;  3GZL A;  4PWV B;  2LL8 A;  1K73 Q;  4PH0 A;  2L6E A;  2GYK A;  2LKI A;  4IPY A;  2EHS A;  1D1D A;  3G1I A;  2CGQ A;  1BAJ A;  2K92 A;  4XFZ A;  2PNG A;  2FAC A;  1HQB A;  2KGE A;  4H2Y C;  2VLQ A;  1CEI A;  4R0M A;  2VLO A;  3DTJ A;  4H2X C;  2Z46 A;  1VQ4 P;  2FVA A;  3EJB A;  2CNR A;  4HKG A;  2CG5 B;  3CCS P;  2FAD A;  1X3O A;  3CC4 P;  5F2N A;  2P9X A;  2PEJ A;  2KOR A;  3LRY A;  1Q86 Q;  2OTL P;  2ROQ A;  4CA3 A;  2N6Y A;  1NQ4 A;  3WBH A;  3NTE A;  2VLN A;  3H4E A;  3Q20 A;  2KG6 A;  1VQN P;  5HV8 A;  2KW2 A;  5HGN A;  3CPW O;  5I4T G;  4COP A;  3EJE A;  2M8N A;  1E6J P;  2GDX A;  2K5X A;  4BPF A;  2LOL A;  2BUO A;  4XRQ A;  3CC2 P;  1E0H A;  2JB0 A;  1YIJ P;  1NJI Q;  1QRJ A;  2OTJ P;  2K0X A;  1A8O A;  5HGO A;  2GZE A;  2Z45 A;  2M8P A;  1UJZ A;  2JO0 A;  2KGA A;  1JJ2 O;  3DS2 A;  2PEK A;  2MVV A;  4BPH A;  2LIU A;  1M1K Q;  1W2B O;  2AFD A;  1HY8 A;  2OAR A;  2N5I A;  2VSQ A;  1Q81 Q;  2KOS A;  3B5I A;  5KP6 B;  1FR2 A;  2K93 A;  3GKL C;  3GJN A;  2QEX P;  3CD6 P;  2FQ0 A;  1YJN P;  1EIA A;  2KGC A;  1VQO P;  4DG9 A;  1QVG O;  5CZD B;  2VLP A;  5BS2 A;  4NEO A;  2PEO A;  3CCQ P;  3P05 A;  2PEI A;  5KP8 B;  3G6E P;  2EHT A;  1DV5 A;  1KLP A;  2KG8 A;  2JBG A;  2L0Q A;  1YJ9 P;  2L4B A;  2LML A;  2L22 A;  4U0F A;  1YIT P;  3LMO A;  3CME P;  2XT1 A;  4U0A A;  1Q82 Q;  2GDY A; 
#chains in the Genus database with same CATH homology
 1S72 P;  1VQN P;  4GR2 A;  2BHV A;  2EG5 A;  3HYB A;  4U0C A;  3OW2 O;  3CCE P;  3RG6 C;  3G28 A;  5HGN A;  5F2K A;  2CWO A;  2PEQ A;  3CPW O;  1K30 A;  2DGY A;  5HGL A;  4COP A;  5I4T G;  3DS4 A;  5JPA A;  2M8N A;  1E6J P;  2QA4 P;  1YJW P;  1VQ6 P;  3G0V A;  2BUO A;  4XRQ A;  2PY8 A;  3DPH A;  1RO2 A;  2ONT A;  1KC8 Q;  5BS1 A;  3CCR P;  3CC2 P;  1YIJ P;  4U0B A;  3E2D A;  2EIA A;  1Q7Y Q;  3G26 A;  3G29 A;  1NJI Q;  2PEM A;  1A43 A;  1QRJ A;  2OTJ P;  3DS0 A;  1A8O A;  1RNI A;  2M8L A;  4XFX A;  5HGO A;  3G4S P;  3CCU P;  1VQ5 P;  1K8A Q;  1RO0 A;  2Z45 A;  2JYG A;  2JO0 A;  2M8P A;  4M0I A;  3I55 P;  3CXC O;  3CCM P;  1JJ2 O;  4U0E A;  3G71 P;  1ZMB A;  4U0D A;  1M74 A;  3DS2 A;  4XRO A;  3CC7 P;  4PH1 A;  2PEK A;  3CCL P;  1KQS O;  1QVF O;  1VQ8 P;  1K73 Q;  1VQ9 P;  4PH0 A;  1EOQ A;  2L6E A;  1VQM P;  3H0D A;  1M6E X;  1N8R Q;  1D1D A;  4IPY A;  3DS1 A;  3VRL C;  1M1K Q;  3G1I A;  2E1M A;  1W2B O;  1K9M Q;  2JYL A;  5HGM A;  3H47 A;  1BAJ A;  2OAR A;  4XFZ A;  3CCV P;  1VQK P;  2Z44 A;  1Q81 Q;  3B5I A;  1M90 Q;  1VQ7 P;  2KOD A;  2XV6 A;  2QEX P;  5F2O A;  3DTJ A;  4WYM A;  3G21 A;  2Z46 A;  3CD6 P;  1VQP P;  3MGE A;  1KD1 Q;  1VQ4 P;  1YJN P;  4QNB A;  1EIA A;  3DS3 A;  1VQO P;  1QVG O;  3CMA P;  5BS2 A;  5DCK A;  2PEO A;  2LF4 A;  3CCQ P;  3P05 A;  3HZQ A;  3I56 P;  4GR6 A;  4XFY A;  3CCS P;  1M6N A;  2PEI A;  1AUM A;  2EFJ A;  1VQL P;  3CC4 P;  2PEN A;  5F2N A;  2P9X A;  3G6E P;  3DS5 A;  2PEJ A;  1YHQ P;  3LRY A;  1Q86 Q;  2OTL P;  1YJ9 P;  3M1M A;  3G1G A;  4U0F A;  3WBH A;  1YIT P;  3NTE A;  4COC A;  1YI2 P;  3CCJ P;  3H4E A;  3CME P;  3Q20 A;  2XT1 A;  4U0A A;  2XXM A;  1IUQ A;  1Q82 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...