2L0QA

Nmr solution structure of vibrio harveyi acyl carrier protein (acp)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
GIPLSNIEERVKKIIVEQLGVDEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYVNSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title NMR solution structure and biophysical characterization of Vibrio harveyi acyl carrier protein A75H: effects of divalent metal ions.
pubmed doi rcsb
source organism Vibrio harveyi 1da3
molecule tags Lipid binding protein
total genus 17
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2l0qA00
2ROQA 1OR5A 2FHSC 2KGCA 2K0XA 2N6ZA 2MY5A 2MF4A 3EJEA 1ACPA 2KGAA 2CG5B 2AVAA 2LIUA 4H2XC 4PXHB 2L9FA 2FQ1A 4MRTC 3RG2A 1F80D 2KG9A 2K93A 1NQ4A 4H2YC 2AFEA 2CQ8A 2KOSA 2L0QA 2MR8A 2PNGA 2L22A 2KW2A 1T8KA 2LMLA 2M5RA 4BPGA 1HQBA 5KP8B 4CA3A 4IZ6A 2AF8A 5EJDA 1VKUA 2XZ0D 2MR7A 2MD9A 2FAEA 3NY7B 2AFDA 2EHSA 2KOPA 5KP6B 4BPHA 2DNWA 2N5IA 2LPKA 1KLPA 2FVAA 2LIWA 3CE7A 2K0YA 2FADA 3GZLA 2FACA 2GDWA 2KORA 1HY8A 2KR5A 5KP7B 2X2BA 4PWVB 2FVEA 2LTEA 4DG9A 2K92A 5CZDB 2JQ4A 1AF8A 2KGEA 2VSQA 2FVFA 4NEOA 2CGQA 3GZMA 2LL8A 4HKGA 2KGDA 2FQ0A 2JU2A 2L4BA 2K2QA 3EJDA 3EJBA 2LOLA 2JU1A 4H2WC 4BPFA 2N5HA 2CNRA 2QNWA 3LMOA 2N50A 1L0HA 2JGPA 2MVUA 2LKIA 1DV5A 4R0MA 2K94A 2XZ1C 2GDXA 2KG8A 2MVVA 2N98A 2GDYA 1DNYA 5HV8A 1L0IA 5HVCA 1X3OA 2FQ2A 2KWLA 2EHTA 2N6YA 2KOQA 2KG6A 2KOOA
chains in the Genus database with same CATH superfamily
4XRQA 1OR5A 2K0XA 2MY5A 2PENA 2OTJP 1M6EX 1AYIA 4H2XC 4PXHB 3H4EA 3CCVP 2L9FA 1RO2A 4M0IA 3RG2A 3CMAP 1Q82Q 4F37A 1QVGO 1F80D 2GZGA 4U0DA 1UJZA 1NQ4A 2CQ8A 2L0QA 1HQBA 3GKLC 4CA3A 2JBGA 2AF8A 5EJDA 2XZ0D 1GPJA 2EG5A 4U0AA 4BPHA 2WPTA 2DNWA 3DS1A 3DPHA 2JYGA 2K0YA 1IMPA 2FACA 1JJ2O 2KORA 1HY8A 1KQSO 2VLPA 5KP7B 4PWVB 4DG9A 2JQ4A 1AF8A 2VSQA 2FVFA 2KGDA 2JU2A 4U0BA 3CCQP 3CC4P 3DS4A 2LOLA 3DS2A 4BPFA 2QNWA 1AUMA 1L0HA 1DV5A 3U43A 2K94A 1M1KQ 2GDYA 1EIAA 3HZQA 3CD6P 2VLQA 1VQ4P 1X3OA 2L6EA 3E2DA 2JAZA 3G28A 2ROQA 2PEOA 2N6ZA 2MF4A 1ACPA 2CG5B 3G26A 4QNBA 1QVFO 5HGLA 3H47A 4IPYA 3VRLC 3CCRP 2KOSA 2M8NA 1Q86Q 2L22A 1K8AQ 1T8KA 2LMLA 1VHNA 5F2KA 3DS3A 1GXGA 4IZ6A 5HGMA 2MR7A 3M1MA 2QA4P 2MD9A 5EW5E 3G1IA 1KD1Q 1YITP 2AFDA 3CC7P 2EFJA 3DTJA 3G21A 2PY8A 1MZ8A 1VQ7P 1IUQA 1Z6MA 2QEXP 1VQOP 2BHVA 1YI2P 4COCA 1A43A 5CZDB 2KGEA 3GZMA 1K73Q 4HKGA 2K2QA 1ZMBA 1E6JP 2OARA 3EJBA 2GZIA 2BUOA 3LMOA 2LF4A 2N98A 1UNKA 3G29A 1RO0A 5HV8A 2CWOA 3CCJP 1L0IA 5HVCA 2XV6A 2FQ2A 2PEJA 1A8OA 1YJ9P 4COPA 5BS2A 3G1GA 5F2OA 2FHSC 2DGYA 2KGCA 3CCMP 2KODA 3EJEA 5HGNA 2KGAA 2AVAA 2VLNA 2GZEA 2Z46A 4XROA 2KG9A 2K93A 2M8LA 2AFEA 2KOOA 3RG6C 2PNGA 5F2NA 2VLOA 4U0FA 2KW2A 1CEIA 3P05A 2M8PA 2M5RA 1YJNP 1N8RQ 1Q7YQ 4BPGA 2P9XA 2XT1A 1VQ8P 3G6EP 1BAJA 3B5IA 5HGOA 5KP8B 2Z45A 1QRJA 3I55P 1EOQA 4GR6A 2FAEA 3NY7B 2JB0A 4PH0A 2KOPA 5KP6B 1VQPP 3B4QA 1S72P 3DS0A 2LPKA 2Z44A 2K5XA 1ZNVA 3HYBA 3CE7A 1YHQP 2FADA 3GZLA 3CCEP 2GDWA 2GZFA 5I4TG 4XFXA 1BXIA 1RNIA 2PEIA 1VQ6P 2OTLP 4QKOA 1VQNP 1W2BO 3DS5A 2GZJA 4NEOA 3CCUP 1E0HA 3OW2O 2L4BA 3CC2P 1Q81Q 2N5HA 2N50A 3GJNA 2JGPA 2LKIA 1M74A 2XZ1C 3WBHA 2ONTA 2KOQA 2KG6A 1GXHA 4GR2A 1IMQA 1NJIQ 7CEIA 2EIAA 2XXMA 2LIUA 3G71P 4WYMA 2FQ1A 4MRTC 1VQ5P 4U0CA 4H2YC 2JYLA 3CXCO 3H0DA 2MR8A 4U0EA 2PEQA 3MGEA 3CCSP 3I56P 1VQLP 4UHPB 1K30A 2PEKA 2NO8A 1VKUA 3CCLP 3Q20A 1YJWP 1YIJP 2EHSA 4PH1A 2N5IA 1M6NA 1D1DA 1KLPA 2FVAA 2LIWA 4XFZA 1VQ9P 1M90Q 2KR5A 2X2BA 2FVEA 2LTEA 1VQKP 3CPWO 4XFYA 2K92A 5DCKA 3G0VA 3CMEP 1FR2A 2K0DX 2GYKA 2CGQA 1KC8Q 3LRYA 3NTEA 2LL8A 2FQ0A 5JPAA 3EJDA 2JU1A 4H2WC 3G4SP 2CNRA 2E1MA 2MVUA 4R0MA 2GDXA 2KG8A 2MVVA 1DNYA 5BS1A 2ERHA 2JO0A 1VQMP 2KWLA 2EHTA 2N6YA 1EMVA 1K9MQ 2PEMA
chains in the Genus database with same CATH topology
2ROQA 1OR5A 2FHSC 2KGCA 2K0XA 2N6ZA 2MY5A 2MF4A 3EJEA 1ACPA 2KGAA 2CG5B 2AVAA 2LIUA 4H2XC 4PXHB 2L9FA 2FQ1A 4MRTC 3RG2A 1F80D 2KG9A 2K93A 1NQ4A 4H2YC 2AFEA 2CQ8A 2KOSA 2L0QA 2MR8A 2PNGA 2L22A 2KW2A 1T8KA 2LMLA 2M5RA 4BPGA 1HQBA 5KP8B 4CA3A 4IZ6A 2AF8A 5EJDA 1VKUA 2XZ0D 2MR7A 2MD9A 2FAEA 3NY7B 2AFDA 2EHSA 2KOPA 5KP6B 4BPHA 2DNWA 2N5IA 2LPKA 1KLPA 2FVAA 2LIWA 3CE7A 2K0YA 2FADA 3GZLA 2FACA 2GDWA 2KORA 1HY8A 2KR5A 5KP7B 2X2BA 4PWVB 2FVEA 2LTEA 4DG9A 2K92A 5CZDB 2JQ4A 1AF8A 2KGEA 2VSQA 2FVFA 4NEOA 2CGQA 3GZMA 2LL8A 4HKGA 2KGDA 2FQ0A 2JU2A 2L4BA 2K2QA 3EJDA 3EJBA 2LOLA 2JU1A 4H2WC 4BPFA 2N5HA 2CNRA 2QNWA 3LMOA 2N50A 1L0HA 2JGPA 2MVUA 2LKIA 1DV5A 4R0MA 2K94A 2XZ1C 2GDXA 2KG8A 2MVVA 2N98A 2GDYA 1DNYA 5HV8A 1L0IA 5HVCA 1X3OA 2FQ2A 2KWLA 2EHTA 2N6YA 2KOQA 2KG6A 2KOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ROQ A;  1OR5 A;  2FHS C;  2KGC A;  2K0X A;  2N6Z A;  2MY5 A;  2MF4 A;  3EJE A;  1ACP A;  2KGA A;  2CG5 B;  2AVA A;  2LIU A;  4H2X C;  4PXH B;  2L9F A;  2FQ1 A;  4MRT C;  3RG2 A;  1F80 D;  2KG9 A;  2K93 A;  1NQ4 A;  4H2Y C;  2AFE A;  2CQ8 A;  2KOS A;  2L0Q A;  2MR8 A;  2PNG A;  2L22 A;  2KW2 A;  1T8K A;  2LML A;  2M5R A;  4BPG A;  1HQB A;  5KP8 B;  4CA3 A;  4IZ6 A;  2AF8 A;  5EJD A;  1VKU A;  2XZ0 D;  2MR7 A;  2MD9 A;  2FAE A;  3NY7 B;  2AFD A;  2EHS A;  2KOP A;  5KP6 B;  4BPH A;  2DNW A;  2N5I A;  2LPK A;  1KLP A;  2FVA A;  2LIW A;  3CE7 A;  2K0Y A;  2FAD A;  3GZL A;  2FAC A;  2GDW A;  2KOR A;  1HY8 A;  2KR5 A;  5KP7 B;  2X2B A;  4PWV B;  2FVE A;  2LTE A;  4DG9 A;  2K92 A;  5CZD B;  2JQ4 A;  1AF8 A;  2KGE A;  2VSQ A;  2FVF A;  4NEO A;  2CGQ A;  3GZM A;  2LL8 A;  4HKG A;  2KGD A;  2FQ0 A;  2JU2 A;  2L4B A;  2K2Q A;  3EJD A;  3EJB A;  2LOL A;  2JU1 A;  4H2W C;  4BPF A;  2N5H A;  2CNR A;  2QNW A;  3LMO A;  2N50 A;  1L0H A;  2JGP A;  2MVU A;  2LKI A;  1DV5 A;  4R0M A;  2K94 A;  2XZ1 C;  2GDX A;  2KG8 A;  2MVV A;  2N98 A;  2GDY A;  1DNY A;  5HV8 A;  1L0I A;  5HVC A;  1X3O A;  2FQ2 A;  2KWL A;  2EHT A;  2N6Y A;  2KOQ A;  2KG6 A;  2KOO A; 
#chains in the Genus database with same CATH topology
 4XRQ A;  1OR5 A;  2K0X A;  2MY5 A;  2PEN A;  2OTJ P;  1M6E X;  1AYI A;  4H2X C;  4PXH B;  3H4E A;  3CCV P;  2L9F A;  1RO2 A;  4M0I A;  3RG2 A;  3CMA P;  1Q82 Q;  4F37 A;  1QVG O;  1F80 D;  2GZG A;  4U0D A;  1UJZ A;  1NQ4 A;  2CQ8 A;  2L0Q A;  1HQB A;  3GKL C;  4CA3 A;  2JBG A;  2AF8 A;  5EJD A;  2XZ0 D;  1GPJ A;  2EG5 A;  4U0A A;  4BPH A;  2WPT A;  2DNW A;  3DS1 A;  3DPH A;  2JYG A;  2K0Y A;  1IMP A;  2FAC A;  1JJ2 O;  2KOR A;  1HY8 A;  1KQS O;  2VLP A;  5KP7 B;  4PWV B;  4DG9 A;  2JQ4 A;  1AF8 A;  2VSQ A;  2FVF A;  2KGD A;  2JU2 A;  4U0B A;  3CCQ P;  3CC4 P;  3DS4 A;  2LOL A;  3DS2 A;  4BPF A;  2QNW A;  1AUM A;  1L0H A;  1DV5 A;  3U43 A;  2K94 A;  1M1K Q;  2GDY A;  1EIA A;  3HZQ A;  3CD6 P;  2VLQ A;  1VQ4 P;  1X3O A;  2L6E A;  3E2D A;  2JAZ A;  3G28 A;  2ROQ A;  2PEO A;  2N6Z A;  2MF4 A;  1ACP A;  2CG5 B;  3G26 A;  4QNB A;  1QVF O;  5HGL A;  3H47 A;  4IPY A;  3VRL C;  3CCR P;  2KOS A;  2M8N A;  1Q86 Q;  2L22 A;  1K8A Q;  1T8K A;  2LML A;  1VHN A;  5F2K A;  3DS3 A;  1GXG A;  4IZ6 A;  5HGM A;  2MR7 A;  3M1M A;  2QA4 P;  2MD9 A;  5EW5 E;  3G1I A;  1KD1 Q;  1YIT P;  2AFD A;  3CC7 P;  2EFJ A;  3DTJ A;  3G21 A;  2PY8 A;  1MZ8 A;  1VQ7 P;  1IUQ A;  1Z6M A;  2QEX P;  1VQO P;  2BHV A;  1YI2 P;  4COC A;  1A43 A;  5CZD B;  2KGE A;  3GZM A;  1K73 Q;  4HKG A;  2K2Q A;  1ZMB A;  1E6J P;  2OAR A;  3EJB A;  2GZI A;  2BUO A;  3LMO A;  2LF4 A;  2N98 A;  1UNK A;  3G29 A;  1RO0 A;  5HV8 A;  2CWO A;  3CCJ P;  1L0I A;  5HVC A;  2XV6 A;  2FQ2 A;  2PEJ A;  1A8O A;  1YJ9 P;  4COP A;  5BS2 A;  3G1G A;  5F2O A;  2FHS C;  2DGY A;  2KGC A;  3CCM P;  2KOD A;  3EJE A;  5HGN A;  2KGA A;  2AVA A;  2VLN A;  2GZE A;  2Z46 A;  4XRO A;  2KG9 A;  2K93 A;  2M8L A;  2AFE A;  2KOO A;  3RG6 C;  2PNG A;  5F2N A;  2VLO A;  4U0F A;  2KW2 A;  1CEI A;  3P05 A;  2M8P A;  2M5R A;  1YJN P;  1N8R Q;  1Q7Y Q;  4BPG A;  2P9X A;  2XT1 A;  1VQ8 P;  3G6E P;  1BAJ A;  3B5I A;  5HGO A;  5KP8 B;  2Z45 A;  1QRJ A;  3I55 P;  1EOQ A;  4GR6 A;  2FAE A;  3NY7 B;  2JB0 A;  4PH0 A;  2KOP A;  5KP6 B;  1VQP P;  3B4Q A;  1S72 P;  3DS0 A;  2LPK A;  2Z44 A;  2K5X A;  1ZNV A;  3HYB A;  3CE7 A;  1YHQ P;  2FAD A;  3GZL A;  3CCE P;  2GDW A;  2GZF A;  5I4T G;  4XFX A;  1BXI A;  1RNI A;  2PEI A;  1VQ6 P;  2OTL P;  4QKO A;  1VQN P;  1W2B O;  3DS5 A;  2GZJ A;  4NEO A;  3CCU P;  1E0H A;  3OW2 O;  2L4B A;  3CC2 P;  1Q81 Q;  2N5H A;  2N50 A;  3GJN A;  2JGP A;  2LKI A;  1M74 A;  2XZ1 C;  3WBH A;  2ONT A;  2KOQ A;  2KG6 A;  1GXH A;  4GR2 A;  1IMQ A;  1NJI Q;  7CEI A;  2EIA A;  2XXM A;  2LIU A;  3G71 P;  4WYM A;  2FQ1 A;  4MRT C;  1VQ5 P;  4U0C A;  4H2Y C;  2JYL A;  3CXC O;  3H0D A;  2MR8 A;  4U0E A;  2PEQ A;  3MGE A;  3CCS P;  3I56 P;  1VQL P;  4UHP B;  1K30 A;  2PEK A;  2NO8 A;  1VKU A;  3CCL P;  3Q20 A;  1YJW P;  1YIJ P;  2EHS A;  4PH1 A;  2N5I A;  1M6N A;  1D1D A;  1KLP A;  2FVA A;  2LIW A;  4XFZ A;  1VQ9 P;  1M90 Q;  2KR5 A;  2X2B A;  2FVE A;  2LTE A;  1VQK P;  3CPW O;  4XFY A;  2K92 A;  5DCK A;  3G0V A;  3CME P;  1FR2 A;  2K0D X;  2GYK A;  2CGQ A;  1KC8 Q;  3LRY A;  3NTE A;  2LL8 A;  2FQ0 A;  5JPA A;  3EJD A;  2JU1 A;  4H2W C;  3G4S P;  2CNR A;  2E1M A;  2MVU A;  4R0M A;  2GDX A;  2KG8 A;  2MVV A;  1DNY A;  5BS1 A;  2ERH A;  2JO0 A;  1VQM P;  2KWL A;  2EHT A;  2N6Y A;  1EMV A;  1K9M Q;  2PEM A; 
#chains in the Genus database with same CATH homology
 2ROQ A;  1OR5 A;  2FHS C;  2KGC A;  2K0X A;  2N6Z A;  2MY5 A;  2MF4 A;  3EJE A;  1ACP A;  2KGA A;  2CG5 B;  2AVA A;  2LIU A;  4H2X C;  4PXH B;  2L9F A;  2FQ1 A;  4MRT C;  3RG2 A;  1F80 D;  2KG9 A;  2K93 A;  1NQ4 A;  4H2Y C;  2AFE A;  2CQ8 A;  2KOS A;  2L0Q A;  2MR8 A;  2PNG A;  2L22 A;  2KW2 A;  1T8K A;  2LML A;  2M5R A;  4BPG A;  1HQB A;  5KP8 B;  4CA3 A;  4IZ6 A;  2AF8 A;  5EJD A;  1VKU A;  2XZ0 D;  2MR7 A;  2MD9 A;  2FAE A;  3NY7 B;  2AFD A;  2EHS A;  2KOP A;  5KP6 B;  4BPH A;  2DNW A;  2N5I A;  2LPK A;  1KLP A;  2FVA A;  2LIW A;  3CE7 A;  2K0Y A;  2FAD A;  3GZL A;  2FAC A;  2GDW A;  2KOR A;  1HY8 A;  2KR5 A;  5KP7 B;  2X2B A;  4PWV B;  2FVE A;  2LTE A;  4DG9 A;  2K92 A;  5CZD B;  2JQ4 A;  1AF8 A;  2KGE A;  2VSQ A;  2FVF A;  4NEO A;  2CGQ A;  3GZM A;  2LL8 A;  4HKG A;  2KGD A;  2FQ0 A;  2JU2 A;  2L4B A;  2K2Q A;  3EJD A;  3EJB A;  2LOL A;  2JU1 A;  4H2W C;  4BPF A;  2N5H A;  2CNR A;  2QNW A;  3LMO A;  2N50 A;  1L0H A;  2JGP A;  2MVU A;  2LKI A;  1DV5 A;  4R0M A;  2K94 A;  2XZ1 C;  2GDX A;  2KG8 A;  2MVV A;  2N98 A;  2GDY A;  1DNY A;  5HV8 A;  1L0I A;  5HVC A;  1X3O A;  2FQ2 A;  2KWL A;  2EHT A;  2N6Y A;  2KOQ A;  2KG6 A;  2KOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...