2L0QA

Nmr solution structure of vibrio harveyi acyl carrier protein (acp)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
GIPLSNIEERVKKIIVEQLGVDEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYVNSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Acyl carrier protein
publication title NMR solution structure and biophysical characterization of Vibrio harveyi acyl carrier protein A75H: effects of divalent metal ions.
pubmed doi rcsb
source organism Vibrio harveyi 1da3
total genus 17
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2l0qA00
2CQ8A 2X2BA 4BPHA 2LL8A 2LOLA 1NQ4A 2L22A 2KR5A 4NEOA 1OR5A 2EHSA 4H2WC 3GZMA 3CE7A 2FQ0A 2FQ2A 2MD9A 2FADA 2N5IA 2FACA 2N98A 3EJEA 2LKIA 2KGEA 2JGPA 2KOPA 2JQ4A 2KG6A 2XZ1C 2CGQA 4HKGA 4CA3A 2MF4A 4H2YC 5HV8A 2JU2A 3GZLA 4IZ6A 1ACPA 2K2QA 3NY7B 1AF8A 4R0MA 2LIUA 4PWVB 1L0IA 2ROQA 2MR7A 5CZDB 4DG9A 4H2XC 2FAEA 2LTEA 2CG5B 3EJBA 3RG2A 2AFDA 2JU1A 2PNGA 5HVCA 2FVEA 2XZ0D 2K94A 2GDXA 2MY5A 1DV5A 2K93A 2MVUA 2N50A 4MRTC 2KOQA 2K0YA 1X3OA 2LMLA 2FQ1A 2MVVA 4BPFA 2GDYA 2KGAA 2MR8A 2N6YA 4BPGA 2DNWA 2KW2A 1F80D 1VKUA 5KP8B 2KORA 2KOSA 2KG9A 2KG8A 2KOOA 4PXHB 2VSQA 5KP6B 2N6ZA 5KP7B 2K0XA 2M5RA 2L4BA 1KLPA 2L9FA 2EHTA 3LMOA 2L0QA 2LPKA 2FVFA 2LIWA 2N5HA 5EJDA 2GDWA 1T8KA 2KGCA 1HY8A 1DNYA 2AF8A 2QNWA 2KGDA 2KWLA 2K92A 3EJDA 1L0HA 2FHSC 2AVAA 1HQBA 2AFEA 2CNRA 2FVAA
chains in the Genus database with same CATH superfamily
2LL8A 2LOLA 1NQ4A 4XRQA 2KR5A 2PEOA 1YITP 2EHSA 4H2WC 1VQMP 1VQ4P 2N5IA 2FADA 3DS1A 2FACA 1IMQA 1KC8Q 2KG6A 2BUOA 2K0DX 4H2YC 2EIAA 1AUMA 1AF8A 2JAZA 5JPAA 4DG9A 1YIJP 1VQOP 2XV6A 2LTEA 3G28A 3RG2A 1RNIA 1K8AQ 2AFDA 2K94A 2GDXA 3H47A 1W2BO 1DV5A 2K0YA 2M8NA 2PEJA 4F37A 2LMLA 2ERHA 2JYGA 2KGAA 2VLNA 4GR2A 5DCKA 1BXIA 2ONTA 1GXHA 4WYMA 1CEIA 2VLQA 2M5RA 2Z44A 3B4QA 1UJZA 1YJNP 1Q7YQ 2L9FA 5HGNA 2EHTA 3M1MA 4U0BA 1A8OA 2XXMA 5I4TG 2VLOA 3G4SP 5EJDA 3CPWO 4UHPB 2KGCA 3G21A 2JB0A 2Z45A 2KWLA 1EIAA 2X2BA 1Q82Q 3CC2P 3CC7P 1IMPA 1M74A 2L22A 4NEOA 4XFYA 1VQ7P 1Q86Q 1VQLP 2VLPA 2BHVA 3HZQA 4PH0A 3G71P 2JO0A 1JJ2O 1K9MQ 3CCRP 4M0IA 3CCJP 1S72P 1QVFO 4U0EA 4HKGA 1GXGA 2MF4A 5HV8A 3GZLA 1YHQP 2K2QA 2EFJA 4R0MA 2LIUA 2ROQA 1EOQA 2CWOA 5BS1A 3EJBA 2PEIA 5HVCA 2K5XA 2FVEA 1BAJA 5HGMA 1M90Q 3OW2O 2PEKA 3CXCO 1MZ8A 3G1IA 1ZNVA 5EW5E 2MVUA 2KOQA 1YJWP 1X3OA 3DTJA 2OTJP 3I56P 2DNWA 3H0DA 3CMEP 5KP8B 3LRYA 2KORA 3G0VA 1VQPP 2KOOA 2GZIA 3U43A 5KP6B 5F2KA 2OARA 2K0XA 1GPJA 1YJ9P 3DS0A 3DPHA 2L4BA 2GZEA 2PENA 3GKLC 1T8KA 2PEQA 1VQ8P 1DNYA 2QNWA 1D1DA 1KQSO 2EG5A 3MGEA 3GJNA 2FHSC 7CEIA 4QNBA 2AFEA 2FVAA 4U0AA 4COCA 1QRJA 3VRLC 1OR5A 1N8RQ 3GZMA 3CE7A 2FQ0A 2FQ2A 2MD9A 2N98A 1AYIA 3EJEA 2KGEA 2JGPA 4U0DA 2GZFA 3NTEA 2XZ1C 2JU2A 4IZ6A 3NY7B 2GYKA 4PWVB 3DS3A 1L0IA 4H2XC 4XFZA 2FAEA 3G26A 1IUQA 2PEMA 1E0HA 1VQKP 2PY8A 1QVGO 3CC4P 1RO2A 2K93A 3RG6C 4MRTC 2Z46A 3E2DA 3WBHA 2MVVA 4BPFA 2MR8A 4BPGA 2N6YA 3DS4A 1NJIQ 1F80D 1KD1Q 1VQ9P 3CD6P 2QEXP 2KOSA 2KG9A 2KODA 4U0CA 2KG8A 4PXHB 3G1GA 2LF4A 2JBGA 3CCLP 2WPTA 1M6EX 1VQ6P 1VHNA 1KLPA 2GZGA 2XT1A 3I55P 3P05A 3LMOA 2P9XA 2FVFA 2LIWA 3H4EA 2N5HA 4XFXA 3G29A 2GDWA 1VQNP 1YI2P 1VQ5P 3CCQP 1HY8A 4QKOA 3CCVP 2NO8A 2AVAA 1K30A 1HQBA 2CNRA 1Z6MA 1M1KQ 2CQ8A 4BPHA 1E6JP 1ZMBA 3B5IA 2DGYA 1K73Q 2LKIA 2KOPA 2JQ4A 4PH1A 2CGQA 2L6EA 4CA3A 4XROA 5F2NA 1M6NA 1ACPA 3CCMP 2MR7A 5CZDB 2QA4P 2CG5B 2JU1A 2PNGA 2E1MA 2XZ0D 1Q81Q 2GZJA 2MY5A 2M8LA 1FR2A 2N50A 1RO0A 2FQ1A 2GDYA 5F2OA 1EMVA 2KW2A 1VKUA 4U0FA 5HGLA 3DS2A 2VSQA 3DS5A 2N6ZA 5KP7B 3CMAP 4GR6A 5HGOA 3CCEP 3HYBA 3CCSP 1A43A 2L0QA 2LPKA 3Q20A 2OTLP 3G6EP 3CCUP 4COPA 4IPYA 2AF8A 5BS2A 2JYLA 2KGDA 2K92A 2M8PA 3EJDA 1L0HA 1UNKA
chains in the Genus database with same CATH topology
2CQ8A 2X2BA 4BPHA 2LL8A 2LOLA 1NQ4A 2L22A 2KR5A 4NEOA 1OR5A 2EHSA 4H2WC 3GZMA 3CE7A 2FQ0A 2FQ2A 2MD9A 2FADA 2N5IA 2FACA 2N98A 3EJEA 2LKIA 2KGEA 2JGPA 2KOPA 2JQ4A 2KG6A 2XZ1C 2CGQA 4HKGA 4CA3A 2MF4A 4H2YC 5HV8A 2JU2A 3GZLA 4IZ6A 1ACPA 2K2QA 3NY7B 1AF8A 4R0MA 2LIUA 4PWVB 1L0IA 2ROQA 2MR7A 5CZDB 4DG9A 4H2XC 2FAEA 2LTEA 2CG5B 3EJBA 3RG2A 2AFDA 2JU1A 2PNGA 5HVCA 2FVEA 2XZ0D 2K94A 2GDXA 2MY5A 1DV5A 2K93A 2MVUA 2N50A 4MRTC 2KOQA 2K0YA 1X3OA 2LMLA 2FQ1A 2MVVA 4BPFA 2GDYA 2KGAA 2MR8A 2N6YA 4BPGA 2DNWA 2KW2A 1F80D 1VKUA 5KP8B 2KORA 2KOSA 2KG9A 2KG8A 2KOOA 4PXHB 2VSQA 5KP6B 2N6ZA 5KP7B 2K0XA 2M5RA 2L4BA 1KLPA 2L9FA 2EHTA 3LMOA 2L0QA 2LPKA 2FVFA 2LIWA 2N5HA 5EJDA 2GDWA 1T8KA 2KGCA 1HY8A 1DNYA 2AF8A 2QNWA 2KGDA 2KWLA 2K92A 3EJDA 1L0HA 2FHSC 2AVAA 1HQBA 2AFEA 2CNRA 2FVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQ8 A;  2X2B A;  4BPH A;  2LL8 A;  2LOL A;  1NQ4 A;  2L22 A;  2KR5 A;  4NEO A;  1OR5 A;  2EHS A;  4H2W C;  3GZM A;  3CE7 A;  2FQ0 A;  2FQ2 A;  2MD9 A;  2FAD A;  2N5I A;  2FAC A;  2N98 A;  3EJE A;  2LKI A;  2KGE A;  2JGP A;  2KOP A;  2JQ4 A;  2KG6 A;  2XZ1 C;  2CGQ A;  4HKG A;  4CA3 A;  2MF4 A;  4H2Y C;  5HV8 A;  2JU2 A;  3GZL A;  4IZ6 A;  1ACP A;  2K2Q A;  3NY7 B;  1AF8 A;  4R0M A;  2LIU A;  4PWV B;  1L0I A;  2ROQ A;  2MR7 A;  5CZD B;  4DG9 A;  4H2X C;  2FAE A;  2LTE A;  2CG5 B;  3EJB A;  3RG2 A;  2AFD A;  2JU1 A;  2PNG A;  5HVC A;  2FVE A;  2XZ0 D;  2K94 A;  2GDX A;  2MY5 A;  1DV5 A;  2K93 A;  2MVU A;  2N50 A;  4MRT C;  2KOQ A;  2K0Y A;  1X3O A;  2LML A;  2FQ1 A;  2MVV A;  4BPF A;  2GDY A;  2KGA A;  2MR8 A;  2N6Y A;  4BPG A;  2DNW A;  2KW2 A;  1F80 D;  1VKU A;  5KP8 B;  2KOR A;  2KOS A;  2KG9 A;  2KG8 A;  2KOO A;  4PXH B;  2VSQ A;  5KP6 B;  2N6Z A;  5KP7 B;  2K0X A;  2M5R A;  2L4B A;  1KLP A;  2L9F A;  2EHT A;  3LMO A;  2L0Q A;  2LPK A;  2FVF A;  2LIW A;  2N5H A;  5EJD A;  2GDW A;  1T8K A;  2KGC A;  1HY8 A;  1DNY A;  2AF8 A;  2QNW A;  2KGD A;  2KWL A;  2K92 A;  3EJD A;  1L0H A;  2FHS C;  2AVA A;  1HQB A;  2AFE A;  2CNR A;  2FVA A; 
#chains in the Genus database with same CATH topology
 2LL8 A;  2LOL A;  1NQ4 A;  4XRQ A;  2KR5 A;  2PEO A;  1YIT P;  2EHS A;  4H2W C;  1VQM P;  1VQ4 P;  2N5I A;  2FAD A;  3DS1 A;  2FAC A;  1IMQ A;  1KC8 Q;  2KG6 A;  2BUO A;  2K0D X;  4H2Y C;  2EIA A;  1AUM A;  1AF8 A;  2JAZ A;  5JPA A;  4DG9 A;  1YIJ P;  1VQO P;  2XV6 A;  2LTE A;  3G28 A;  3RG2 A;  1RNI A;  1K8A Q;  2AFD A;  2K94 A;  2GDX A;  3H47 A;  1W2B O;  1DV5 A;  2K0Y A;  2M8N A;  2PEJ A;  4F37 A;  2LML A;  2ERH A;  2JYG A;  2KGA A;  2VLN A;  4GR2 A;  5DCK A;  1BXI A;  2ONT A;  1GXH A;  4WYM A;  1CEI A;  2VLQ A;  2M5R A;  2Z44 A;  3B4Q A;  1UJZ A;  1YJN P;  1Q7Y Q;  2L9F A;  5HGN A;  2EHT A;  3M1M A;  4U0B A;  1A8O A;  2XXM A;  5I4T G;  2VLO A;  3G4S P;  5EJD A;  3CPW O;  4UHP B;  2KGC A;  3G21 A;  2JB0 A;  2Z45 A;  2KWL A;  1EIA A;  2X2B A;  1Q82 Q;  3CC2 P;  3CC7 P;  1IMP A;  1M74 A;  2L22 A;  4NEO A;  4XFY A;  1VQ7 P;  1Q86 Q;  1VQL P;  2VLP A;  2BHV A;  3HZQ A;  4PH0 A;  3G71 P;  2JO0 A;  1JJ2 O;  1K9M Q;  3CCR P;  4M0I A;  3CCJ P;  1S72 P;  1QVF O;  4U0E A;  4HKG A;  1GXG A;  2MF4 A;  5HV8 A;  3GZL A;  1YHQ P;  2K2Q A;  2EFJ A;  4R0M A;  2LIU A;  2ROQ A;  1EOQ A;  2CWO A;  5BS1 A;  3EJB A;  2PEI A;  5HVC A;  2K5X A;  2FVE A;  1BAJ A;  5HGM A;  1M90 Q;  3OW2 O;  2PEK A;  3CXC O;  1MZ8 A;  3G1I A;  1ZNV A;  5EW5 E;  2MVU A;  2KOQ A;  1YJW P;  1X3O A;  3DTJ A;  2OTJ P;  3I56 P;  2DNW A;  3H0D A;  3CME P;  5KP8 B;  3LRY A;  2KOR A;  3G0V A;  1VQP P;  2KOO A;  2GZI A;  3U43 A;  5KP6 B;  5F2K A;  2OAR A;  2K0X A;  1GPJ A;  1YJ9 P;  3DS0 A;  3DPH A;  2L4B A;  2GZE A;  2PEN A;  3GKL C;  1T8K A;  2PEQ A;  1VQ8 P;  1DNY A;  2QNW A;  1D1D A;  1KQS O;  2EG5 A;  3MGE A;  3GJN A;  2FHS C;  7CEI A;  4QNB A;  2AFE A;  2FVA A;  4U0A A;  4COC A;  1QRJ A;  3VRL C;  1OR5 A;  1N8R Q;  3GZM A;  3CE7 A;  2FQ0 A;  2FQ2 A;  2MD9 A;  2N98 A;  1AYI A;  3EJE A;  2KGE A;  2JGP A;  4U0D A;  2GZF A;  3NTE A;  2XZ1 C;  2JU2 A;  4IZ6 A;  3NY7 B;  2GYK A;  4PWV B;  3DS3 A;  1L0I A;  4H2X C;  4XFZ A;  2FAE A;  3G26 A;  1IUQ A;  2PEM A;  1E0H A;  1VQK P;  2PY8 A;  1QVG O;  3CC4 P;  1RO2 A;  2K93 A;  3RG6 C;  4MRT C;  2Z46 A;  3E2D A;  3WBH A;  2MVV A;  4BPF A;  2MR8 A;  4BPG A;  2N6Y A;  3DS4 A;  1NJI Q;  1F80 D;  1KD1 Q;  1VQ9 P;  3CD6 P;  2QEX P;  2KOS A;  2KG9 A;  2KOD A;  4U0C A;  2KG8 A;  4PXH B;  3G1G A;  2LF4 A;  2JBG A;  3CCL P;  2WPT A;  1M6E X;  1VQ6 P;  1VHN A;  1KLP A;  2GZG A;  2XT1 A;  3I55 P;  3P05 A;  3LMO A;  2P9X A;  2FVF A;  2LIW A;  3H4E A;  2N5H A;  4XFX A;  3G29 A;  2GDW A;  1VQN P;  1YI2 P;  1VQ5 P;  3CCQ P;  1HY8 A;  4QKO A;  3CCV P;  2NO8 A;  2AVA A;  1K30 A;  1HQB A;  2CNR A;  1Z6M A;  1M1K Q;  2CQ8 A;  4BPH A;  1E6J P;  1ZMB A;  3B5I A;  2DGY A;  1K73 Q;  2LKI A;  2KOP A;  2JQ4 A;  4PH1 A;  2CGQ A;  2L6E A;  4CA3 A;  4XRO A;  5F2N A;  1M6N A;  1ACP A;  3CCM P;  2MR7 A;  5CZD B;  2QA4 P;  2CG5 B;  2JU1 A;  2PNG A;  2E1M A;  2XZ0 D;  1Q81 Q;  2GZJ A;  2MY5 A;  2M8L A;  1FR2 A;  2N50 A;  1RO0 A;  2FQ1 A;  2GDY A;  5F2O A;  1EMV A;  2KW2 A;  1VKU A;  4U0F A;  5HGL A;  3DS2 A;  2VSQ A;  3DS5 A;  2N6Z A;  5KP7 B;  3CMA P;  4GR6 A;  5HGO A;  3CCE P;  3HYB A;  3CCS P;  1A43 A;  2L0Q A;  2LPK A;  3Q20 A;  2OTL P;  3G6E P;  3CCU P;  4COP A;  4IPY A;  2AF8 A;  5BS2 A;  2JYL A;  2KGD A;  2K92 A;  2M8P A;  3EJD A;  1L0H A;  1UNK A; 
#chains in the Genus database with same CATH homology
 2CQ8 A;  2X2B A;  4BPH A;  2LL8 A;  2LOL A;  1NQ4 A;  2L22 A;  2KR5 A;  4NEO A;  1OR5 A;  2EHS A;  4H2W C;  3GZM A;  3CE7 A;  2FQ0 A;  2FQ2 A;  2MD9 A;  2FAD A;  2N5I A;  2FAC A;  2N98 A;  3EJE A;  2LKI A;  2KGE A;  2JGP A;  2KOP A;  2JQ4 A;  2KG6 A;  2XZ1 C;  2CGQ A;  4HKG A;  4CA3 A;  2MF4 A;  4H2Y C;  5HV8 A;  2JU2 A;  3GZL A;  4IZ6 A;  1ACP A;  2K2Q A;  3NY7 B;  1AF8 A;  4R0M A;  2LIU A;  4PWV B;  1L0I A;  2ROQ A;  2MR7 A;  5CZD B;  4DG9 A;  4H2X C;  2FAE A;  2LTE A;  2CG5 B;  3EJB A;  3RG2 A;  2AFD A;  2JU1 A;  2PNG A;  5HVC A;  2FVE A;  2XZ0 D;  2K94 A;  2GDX A;  2MY5 A;  1DV5 A;  2K93 A;  2MVU A;  2N50 A;  4MRT C;  2KOQ A;  2K0Y A;  1X3O A;  2LML A;  2FQ1 A;  2MVV A;  4BPF A;  2GDY A;  2KGA A;  2MR8 A;  2N6Y A;  4BPG A;  2DNW A;  2KW2 A;  1F80 D;  1VKU A;  5KP8 B;  2KOR A;  2KOS A;  2KG9 A;  2KG8 A;  2KOO A;  4PXH B;  2VSQ A;  5KP6 B;  2N6Z A;  5KP7 B;  2K0X A;  2M5R A;  2L4B A;  1KLP A;  2L9F A;  2EHT A;  3LMO A;  2L0Q A;  2LPK A;  2FVF A;  2LIW A;  2N5H A;  5EJD A;  2GDW A;  1T8K A;  2KGC A;  1HY8 A;  1DNY A;  2AF8 A;  2QNW A;  2KGD A;  2KWL A;  2K92 A;  3EJD A;  1L0H A;  2FHS C;  2AVA A;  1HQB A;  2AFE A;  2CNR A;  2FVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...