2L0QA

Nmr solution structure of vibrio harveyi acyl carrier protein (acp)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
b'GIPLSNIEERVKKIIVEQLGVDEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYVNSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl carrier protein
publication title NMR solution structure and biophysical characterization of Vibrio harveyi acyl carrier protein A75H: effects of divalent metal ions.
pubmed doi rcsb
source organism Vibrio harveyi 1da3
molecule tags Lipid binding protein
total genus 17
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 2l0qA00
2AFEA 2FACA 2N98A 2JGPA 2KGCA 2CGQA 2KG8A 4NEOA 1L0HA 2KGEA 2JU2A 2K0XA 2KW2A 4IZ6A 1HY8A 2AFDA 1HQBA 2MR8A 2LPKA 3GZMA 2K2QA 2M5RA 2FADA 2N6YA 4BPGA 5KP6B 2LIUA 2QNWA 2K94A 1L0IA 2KG9A 2XZ0D 2LMLA 3NY7B 3EJBA 2FVFA 2FVAA 2GDXA 3GZLA 2KOSA 4PXHB 3RG2A 1AF8A 4H2YC 2KOPA 2CNRA 4MRTC 5HVCA 2FVEA 4DG9A 4R0MA 1X3OA 4CA3A 3CE7A 2L0QA 2JU1A 5CZDB 2EHSA 2KGAA 2AF8A 2MVVA 2L22A 3EJEA 5EJDA 5KP8B 3LMOA 2PNGA 2MVUA 1KLPA 2CQ8A 3EJDA 1F80D 2N5IA 4H2XC 2JQ4A 2FHSC 2N50A 4H2WC 1DNYA 2MD9A 2K92A 2EHTA 4BPHA 2VSQA 1ACPA 2FQ0A 2KR5A 2GDYA 2N6ZA 2KORA 2KG6A 2AVAA 2FQ2A 5HV8A 2LKIA 2L4BA 2FQ1A 2LIWA 2MY5A 2KOOA 5KP7B 1T8KA 2KGDA 1VKUA 2KWLA 2DNWA 2LOLA 2ROQA 2CG5B 2L9FA 2X2BA 2LL8A 2N5HA 1DV5A 1NQ4A 2GDWA 4BPFA 4PWVB 2K93A 2XZ1C 2MR7A 1OR5A 2MF4A 2FAEA 4HKGA 2KOQA 2LTEA 2K0YA
chains in the Genus database with same CATH superfamily
2AFEA 1IMPA 2N98A 2JGPA 3DS1A 4NEOA 2MR8A 1A43A 1AUMA 3G1GA 5KP6B 3CCEP 1VQ7P 1M6EX 3G28A 2Z44A 2XZ0D 2Z45A 3EJBA 2OTLP 3CCUP 1KC8Q 3DPHA 2ERHA 1QVFO 4H2YC 3OW2O 5EW5E 2FVEA 1A8OA 2WPTA 1X3OA 1VQNP 2BUOA 1QVGO 3GKLC 3CXCO 3P05A 1YJ9P 2GYKA 2PEQA 5HGLA 2EFJA 2K5XA 5HGOA 5KP8B 3G71P 3U43A 3H47A 2JAZA 1F80D 3CCQP 1YHQP 3E2DA 1K73Q 2N50A 1IUQA 4U0AA 2MD9A 2K92A 3DTJA 4BPHA 4GR2A 1GPJA 5BS2A 1K30A 3MGEA 1Q7YQ 3G6EP 3RG6C 2M8PA 4XRQA 2KGDA 5F2KA 2DNWA 2ROQA 3CCSP 2CG5B 3H4EA 2X2BA 3I56P 2N5HA 4XFXA 2XZ1C 2MR7A 1UNKA 3CC4P 1GXHA 2OTJP 2CWOA 1N8RQ 2GZGA 2KOQA 3CCJP 4QNBA 2K0YA 5F2OA 1M1KQ 1M6NA 3LRYA 2KGEA 2K0XA 4IZ6A 4UHPB 2LPKA 2K2QA 2N6YA 1W2BO 2QNWA 2K94A 1L0IA 3NY7B 2FVFA 1AYIA 2PY8A 3G26A 3HYBA 3Q20A 2KOSA 2L6EA 4PXHB 1RO2A 2ONTA 2KOPA 2CNRA 2JO0A 4MRTC 4R0MA 4CA3A 3CE7A 2JU1A 5CZDB 2KGAA 1YI2P 3CCVP 2OARA 3LMOA 4U0EA 1M90Q 2EG5A 1D1DA 4WYMA 2QEXP 2GZIA 1VQ6P 4H2WC 2EIAA 1DNYA 2EHTA 2K0DX 4U0CA 1M74A 2GDYA 2N6ZA 2XV6A 1KQSO 2FQ2A 2FQ1A 2MY5A 2KOOA 5KP7B 1T8KA 1Q82Q 1VKUA 4U0BA 1UJZA 1K8AQ 2Z46A 1DV5A 2P9XA 3G21A 3HZQA 1EOQA 2GDWA 4BPFA 1OR5A 2FAEA 2DGYA 4QKOA 2VLOA 7CEIA 1L0HA 2VLNA 2JU2A 2AFDA 2M5RA 2FADA 1Q86Q 1S72P 2PEKA 1GXGA 2KG9A 4COCA 3DS3A 4U0FA 1NJIQ 2GZJA 2GDXA 1VQ9P 3GZLA 3CMEP 1JJ2O 2NO8A 3DS5A 1BAJA 3H0DA 2XT1A 4IPYA 5HVCA 4DG9A 1VQ4P 3B4QA 2PEIA 3VRLC 2VLQA 2E1MA 2AF8A 2JYLA 2MVVA 3B5IA 3G29A 2M8NA 2BHVA 1KLPA 3G0VA 5F2NA 2N5IA 2JQ4A 2FHSC 1CEIA 4F37A 3CMAP 1BXIA 2VSQA 1ACPA 2KR5A 2JBGA 2KORA 1QRJA 2AVAA 5HV8A 1YIJP 1ZMBA 2LIWA 2GZEA 2PEOA 5BS1A 2JYGA 2KWLA 2L9FA 2LL8A 2VLPA 2PEJA 1EMVA 3I55P 1YITP 4PWVB 2MF4A 3DS2A 3CD6P 2KGCA 2FACA 1VQKP 2LF4A 1Q81Q 2CGQA 2KG8A 1Z6MA 2KW2A 1HY8A 1HQBA 1VHNA 3CPWO 3GZMA 1VQLP 4BPGA 5HGMA 2LIUA 1RO0A 1EIAA 2XXMA 3DS4A 1VQMP 2LMLA 2FVAA 4PH0A 4GR6A 1VQ8P 2KODA 1E0HA 1VQPP 4XROA 3RG2A 1AF8A 4U0DA 1KD1Q 3DS0A 2L0QA 5I4TG 2EHSA 1YJWP 4XFYA 3CCRP 2L22A 3G4SP 2PEMA 3EJEA 5EJDA 3GJNA 2PNGA 2MVUA 2CQ8A 3CCMP 1E6JP 3EJDA 4H2XC 4XFZA 3CC7P 1MZ8A 2GZFA 2FQ0A 3M1MA 2M8LA 3CC2P 1YJNP 2KG6A 1VQOP 2LKIA 2L4BA 5DCKA 1IMQA 1FR2A 4PH1A 2JB0A 1RNIA 2LOLA 1ZNVA 4M0IA 1K9MQ 1VQ5P 1NQ4A 3G1IA 2K93A 5HGNA 3NTEA 3WBHA 3CCLP 4COPA 2PENA 4HKGA 2QA4P 5JPAA 2LTEA
chains in the Genus database with same CATH topology
2AFEA 2FACA 2N98A 2JGPA 2KGCA 2CGQA 2KG8A 4NEOA 1L0HA 2KGEA 2JU2A 2K0XA 2KW2A 4IZ6A 1HY8A 2AFDA 1HQBA 2MR8A 2LPKA 3GZMA 2K2QA 2M5RA 2FADA 2N6YA 4BPGA 5KP6B 2LIUA 2QNWA 2K94A 1L0IA 2KG9A 2XZ0D 2LMLA 3NY7B 3EJBA 2FVFA 2FVAA 2GDXA 3GZLA 2KOSA 4PXHB 3RG2A 1AF8A 4H2YC 2KOPA 2CNRA 4MRTC 5HVCA 2FVEA 4DG9A 4R0MA 1X3OA 4CA3A 3CE7A 2L0QA 2JU1A 5CZDB 2EHSA 2KGAA 2AF8A 2MVVA 2L22A 3EJEA 5EJDA 5KP8B 3LMOA 2PNGA 2MVUA 1KLPA 2CQ8A 3EJDA 1F80D 2N5IA 4H2XC 2JQ4A 2FHSC 2N50A 4H2WC 1DNYA 2MD9A 2K92A 2EHTA 4BPHA 2VSQA 1ACPA 2FQ0A 2KR5A 2GDYA 2N6ZA 2KORA 2KG6A 2AVAA 2FQ2A 5HV8A 2LKIA 2L4BA 2FQ1A 2LIWA 2MY5A 2KOOA 5KP7B 1T8KA 2KGDA 1VKUA 2KWLA 2DNWA 2LOLA 2ROQA 2CG5B 2L9FA 2X2BA 2LL8A 2N5HA 1DV5A 1NQ4A 2GDWA 4BPFA 4PWVB 2K93A 2XZ1C 2MR7A 1OR5A 2MF4A 2FAEA 4HKGA 2KOQA 2LTEA 2K0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFE A;  2FAC A;  2N98 A;  2JGP A;  2KGC A;  2CGQ A;  2KG8 A;  4NEO A;  1L0H A;  2KGE A;  2JU2 A;  2K0X A;  2KW2 A;  4IZ6 A;  1HY8 A;  2AFD A;  1HQB A;  2MR8 A;  2LPK A;  3GZM A;  2K2Q A;  2M5R A;  2FAD A;  2N6Y A;  4BPG A;  5KP6 B;  2LIU A;  2QNW A;  2K94 A;  1L0I A;  2KG9 A;  2XZ0 D;  2LML A;  3NY7 B;  3EJB A;  2FVF A;  2FVA A;  2GDX A;  3GZL A;  2KOS A;  4PXH B;  3RG2 A;  1AF8 A;  4H2Y C;  2KOP A;  2CNR A;  4MRT C;  5HVC A;  2FVE A;  4DG9 A;  4R0M A;  1X3O A;  4CA3 A;  3CE7 A;  2L0Q A;  2JU1 A;  5CZD B;  2EHS A;  2KGA A;  2AF8 A;  2MVV A;  2L22 A;  3EJE A;  5EJD A;  5KP8 B;  3LMO A;  2PNG A;  2MVU A;  1KLP A;  2CQ8 A;  3EJD A;  1F80 D;  2N5I A;  4H2X C;  2JQ4 A;  2FHS C;  2N50 A;  4H2W C;  1DNY A;  2MD9 A;  2K92 A;  2EHT A;  4BPH A;  2VSQ A;  1ACP A;  2FQ0 A;  2KR5 A;  2GDY A;  2N6Z A;  2KOR A;  2KG6 A;  2AVA A;  2FQ2 A;  5HV8 A;  2LKI A;  2L4B A;  2FQ1 A;  2LIW A;  2MY5 A;  2KOO A;  5KP7 B;  1T8K A;  2KGD A;  1VKU A;  2KWL A;  2DNW A;  2LOL A;  2ROQ A;  2CG5 B;  2L9F A;  2X2B A;  2LL8 A;  2N5H A;  1DV5 A;  1NQ4 A;  2GDW A;  4BPF A;  4PWV B;  2K93 A;  2XZ1 C;  2MR7 A;  1OR5 A;  2MF4 A;  2FAE A;  4HKG A;  2KOQ A;  2LTE A;  2K0Y A; 
#chains in the Genus database with same CATH topology
 2AFE A;  1IMP A;  2N98 A;  2JGP A;  3DS1 A;  4NEO A;  2MR8 A;  1A43 A;  1AUM A;  3G1G A;  5KP6 B;  3CCE P;  1VQ7 P;  1M6E X;  3G28 A;  2Z44 A;  2XZ0 D;  2Z45 A;  3EJB A;  2OTL P;  3CCU P;  1KC8 Q;  3DPH A;  2ERH A;  1QVF O;  4H2Y C;  3OW2 O;  5EW5 E;  2FVE A;  1A8O A;  2WPT A;  1X3O A;  1VQN P;  2BUO A;  1QVG O;  3GKL C;  3CXC O;  3P05 A;  1YJ9 P;  2GYK A;  2PEQ A;  5HGL A;  2EFJ A;  2K5X A;  5HGO A;  5KP8 B;  3G71 P;  3U43 A;  3H47 A;  2JAZ A;  1F80 D;  3CCQ P;  1YHQ P;  3E2D A;  1K73 Q;  2N50 A;  1IUQ A;  4U0A A;  2MD9 A;  2K92 A;  3DTJ A;  4BPH A;  4GR2 A;  1GPJ A;  5BS2 A;  1K30 A;  3MGE A;  1Q7Y Q;  3G6E P;  3RG6 C;  2M8P A;  4XRQ A;  2KGD A;  5F2K A;  2DNW A;  2ROQ A;  3CCS P;  2CG5 B;  3H4E A;  2X2B A;  3I56 P;  2N5H A;  4XFX A;  2XZ1 C;  2MR7 A;  1UNK A;  3CC4 P;  1GXH A;  2OTJ P;  2CWO A;  1N8R Q;  2GZG A;  2KOQ A;  3CCJ P;  4QNB A;  2K0Y A;  5F2O A;  1M1K Q;  1M6N A;  3LRY A;  2KGE A;  2K0X A;  4IZ6 A;  4UHP B;  2LPK A;  2K2Q A;  2N6Y A;  1W2B O;  2QNW A;  2K94 A;  1L0I A;  3NY7 B;  2FVF A;  1AYI A;  2PY8 A;  3G26 A;  3HYB A;  3Q20 A;  2KOS A;  2L6E A;  4PXH B;  1RO2 A;  2ONT A;  2KOP A;  2CNR A;  2JO0 A;  4MRT C;  4R0M A;  4CA3 A;  3CE7 A;  2JU1 A;  5CZD B;  2KGA A;  1YI2 P;  3CCV P;  2OAR A;  3LMO A;  4U0E A;  1M90 Q;  2EG5 A;  1D1D A;  4WYM A;  2QEX P;  2GZI A;  1VQ6 P;  4H2W C;  2EIA A;  1DNY A;  2EHT A;  2K0D X;  4U0C A;  1M74 A;  2GDY A;  2N6Z A;  2XV6 A;  1KQS O;  2FQ2 A;  2FQ1 A;  2MY5 A;  2KOO A;  5KP7 B;  1T8K A;  1Q82 Q;  1VKU A;  4U0B A;  1UJZ A;  1K8A Q;  2Z46 A;  1DV5 A;  2P9X A;  3G21 A;  3HZQ A;  1EOQ A;  2GDW A;  4BPF A;  1OR5 A;  2FAE A;  2DGY A;  4QKO A;  2VLO A;  7CEI A;  1L0H A;  2VLN A;  2JU2 A;  2AFD A;  2M5R A;  2FAD A;  1Q86 Q;  1S72 P;  2PEK A;  1GXG A;  2KG9 A;  4COC A;  3DS3 A;  4U0F A;  1NJI Q;  2GZJ A;  2GDX A;  1VQ9 P;  3GZL A;  3CME P;  1JJ2 O;  2NO8 A;  3DS5 A;  1BAJ A;  3H0D A;  2XT1 A;  4IPY A;  5HVC A;  4DG9 A;  1VQ4 P;  3B4Q A;  2PEI A;  3VRL C;  2VLQ A;  2E1M A;  2AF8 A;  2JYL A;  2MVV A;  3B5I A;  3G29 A;  2M8N A;  2BHV A;  1KLP A;  3G0V A;  5F2N A;  2N5I A;  2JQ4 A;  2FHS C;  1CEI A;  4F37 A;  3CMA P;  1BXI A;  2VSQ A;  1ACP A;  2KR5 A;  2JBG A;  2KOR A;  1QRJ A;  2AVA A;  5HV8 A;  1YIJ P;  1ZMB A;  2LIW A;  2GZE A;  2PEO A;  5BS1 A;  2JYG A;  2KWL A;  2L9F A;  2LL8 A;  2VLP A;  2PEJ A;  1EMV A;  3I55 P;  1YIT P;  4PWV B;  2MF4 A;  3DS2 A;  3CD6 P;  2KGC A;  2FAC A;  1VQK P;  2LF4 A;  1Q81 Q;  2CGQ A;  2KG8 A;  1Z6M A;  2KW2 A;  1HY8 A;  1HQB A;  1VHN A;  3CPW O;  3GZM A;  1VQL P;  4BPG A;  5HGM A;  2LIU A;  1RO0 A;  1EIA A;  2XXM A;  3DS4 A;  1VQM P;  2LML A;  2FVA A;  4PH0 A;  4GR6 A;  1VQ8 P;  2KOD A;  1E0H A;  1VQP P;  4XRO A;  3RG2 A;  1AF8 A;  4U0D A;  1KD1 Q;  3DS0 A;  2L0Q A;  5I4T G;  2EHS A;  1YJW P;  4XFY A;  3CCR P;  2L22 A;  3G4S P;  2PEM A;  3EJE A;  5EJD A;  3GJN A;  2PNG A;  2MVU A;  2CQ8 A;  3CCM P;  1E6J P;  3EJD A;  4H2X C;  4XFZ A;  3CC7 P;  1MZ8 A;  2GZF A;  2FQ0 A;  3M1M A;  2M8L A;  3CC2 P;  1YJN P;  2KG6 A;  1VQO P;  2LKI A;  2L4B A;  5DCK A;  1IMQ A;  1FR2 A;  4PH1 A;  2JB0 A;  1RNI A;  2LOL A;  1ZNV A;  4M0I A;  1K9M Q;  1VQ5 P;  1NQ4 A;  3G1I A;  2K93 A;  5HGN A;  3NTE A;  3WBH A;  3CCL P;  4COP A;  2PEN A;  4HKG A;  2QA4 P;  5JPA A;  2LTE A; 
#chains in the Genus database with same CATH homology
 2AFE A;  2FAC A;  2N98 A;  2JGP A;  2KGC A;  2CGQ A;  2KG8 A;  4NEO A;  1L0H A;  2KGE A;  2JU2 A;  2K0X A;  2KW2 A;  4IZ6 A;  1HY8 A;  2AFD A;  1HQB A;  2MR8 A;  2LPK A;  3GZM A;  2K2Q A;  2M5R A;  2FAD A;  2N6Y A;  4BPG A;  5KP6 B;  2LIU A;  2QNW A;  2K94 A;  1L0I A;  2KG9 A;  2XZ0 D;  2LML A;  3NY7 B;  3EJB A;  2FVF A;  2FVA A;  2GDX A;  3GZL A;  2KOS A;  4PXH B;  3RG2 A;  1AF8 A;  4H2Y C;  2KOP A;  2CNR A;  4MRT C;  5HVC A;  2FVE A;  4DG9 A;  4R0M A;  1X3O A;  4CA3 A;  3CE7 A;  2L0Q A;  2JU1 A;  5CZD B;  2EHS A;  2KGA A;  2AF8 A;  2MVV A;  2L22 A;  3EJE A;  5EJD A;  5KP8 B;  3LMO A;  2PNG A;  2MVU A;  1KLP A;  2CQ8 A;  3EJD A;  1F80 D;  2N5I A;  4H2X C;  2JQ4 A;  2FHS C;  2N50 A;  4H2W C;  1DNY A;  2MD9 A;  2K92 A;  2EHT A;  4BPH A;  2VSQ A;  1ACP A;  2FQ0 A;  2KR5 A;  2GDY A;  2N6Z A;  2KOR A;  2KG6 A;  2AVA A;  2FQ2 A;  5HV8 A;  2LKI A;  2L4B A;  2FQ1 A;  2LIW A;  2MY5 A;  2KOO A;  5KP7 B;  1T8K A;  2KGD A;  1VKU A;  2KWL A;  2DNW A;  2LOL A;  2ROQ A;  2CG5 B;  2L9F A;  2X2B A;  2LL8 A;  2N5H A;  1DV5 A;  1NQ4 A;  2GDW A;  4BPF A;  4PWV B;  2K93 A;  2XZ1 C;  2MR7 A;  1OR5 A;  2MF4 A;  2FAE A;  4HKG A;  2KOQ A;  2LTE A;  2K0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...