4M0IA

Crystal structure of synthetic hiv-1 capsid c-terminal domain (ctd) c198s mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
71
structure length
71
Chain Sequence
SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDSKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title Molecular basis of disulfide bonding-regulated HIV-1 capsid assembly
rcsb
molecule tags Viral protein
total genus 24
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4m0iA00
4XFZA 3LRYA 5JPAA 3DS4A 5HGMA 1AUMA 5HGOA 1E6JP 2BUOA 3G26A 4U0EA 2KODA 5HGLA 5I4TG 2JYGA 3DS3A 2XXMA 3DS5A 4XROA 2XV6A 4PH0A 1D1DA 1BAJA 3G1GA 2JYLA 4COPA 3G21A 3DTJA 4WYMA 1A43A 5DCKA 4U0CA 4QNBA 2M8LA 2EIAA 4M0IA 4U0BA 3H4EA 4COCA 2M8NA 3MGEA 4IPYA 4PH1A 3VRLC 3H47A 3G0VA 3NTEA 4XFXA 1A8OA 3DS1A 2JO0A 2M8PA 3G28A 3DPHA 3G1IA 5HGNA 4U0AA 4U0FA 1EOQA 2LF4A 2XT1A 3DS2A 3G29A 4U0DA 4XFYA 4XRQA 1QRJA 3P05A 2L6EA 1EIAA 2ONTA 3DS0A
chains in the Genus database with same CATH superfamily
2MVUA 5HGOA 2BUOA 2LTEA 2JQ4A 2EHTA 1BAJA 2JAZA 3I55P 2L0QA 2K2QA 1Q7YQ 2AFEA 2JBGA 2M8NA 3H47A 2PEOA 2XZ1C 3G29A 4U0DA 2VSQA 2CG5B 3CMEP 4QKOA 1Q82Q 1OR5A 2FQ1A 1AF8A 5I4TG 3DS3A 2DGYA 2JU1A 1RO2A 3G4SP 7CEIA 2JB0A 2EIAA 1IUQA 1NJIQ 3DS1A 5HVCA 2LF4A 3HYBA 3CC2P 1QVGO 1UNKA 3GZMA 2KGCA 2BHVA 1HY8A 2Z45A 3LMOA 3EJDA 1VQPP 2FACA 1L0IA 4DG9A 4U0CA 1YITP 1VQ4P 2PEQA 2GZJA 1GPJA 4GR6A 2KORA 2M5RA 2MF4A 3M1MA 2QNWA 1M90Q 1JJ2O 3WBHA 3CC7P 5KP7B 1GXGA 2KODA 3B5IA 1VQOP 2KR5A 3G21A 1K30A 1NQ4A 2GZEA 2GZGA 1IMQA 2NO8A 2DNWA 1MZ8A 2ROQA 2CGQA 3DPHA 1YJNP 4PWVB 3OW2O 1BXIA 2EFJA 3P05A 1CEIA 1VQLP 4GR2A 3G1GA 2JYLA 1K73Q 2KGAA 3U43A 2OARA 1FR2A 1KD1Q 1Z6MA 4MRTC 1A8OA 1KC8Q 4HKGA 4U0AA 2VLPA 1QRJA 5BS1A 2K93A 1HQBA 2KG6A 1AUMA 1YJWP 4PH0A 1D1DA 1M74A 1N8RQ 4CA3A 2GDWA 3CXCO 4COCA 1KLPA 2E1MA 2N50A 2VLOA 2QA4P 1EIAA 2K0YA 1ZMBA 1X3OA 3CE7A 1YIJP 3DS4A 5F2KA 3I56P 2LIUA 4U0EA 5BS2A 2K5XA 2VLQA 1VQNP 2PEMA 4PH1A 2CWOA 1S72P 4R0MA 2AF8A 3G28A 2FQ2A 1AYIA 2L22A 2PEIA 3CPWO 4XRQA 1Q81Q 2JGPA 2GDXA 2KOPA 1VQ7P 5HGMA 1YHQP 3G26A 2FAEA 3DTJA 2N6ZA 2OTLP 4M0IA 2Z44A 4F37A 3CMAP 4U0FA 1EMVA 1EOQA 1M6NA 3DS2A 2MD9A 2VLNA 5HGLA 3B4QA 4H2YC 3CCEP 3CCRP 2FHSC 4U0BA 3NTEA 2MR7A 2K0DX 3GZLA 3CCUP 1VKUA 3G6EP 2L6EA 3DS0A 3G0VA 3Q20A 1E6JP 1VQMP 5HV8A 2K92A 3CCSP 2QEXP 1RNIA 4UHPB 2XZ0D 5F2OA 3H4EA 1Q86Q 1YI2P 4XFXA 5EW5E 2XT1A 1VHNA 2FQ0A 3CC4P 2ONTA 2EHSA 2JYGA 3HZQA 1KQSO 2FVFA 2FVAA 4BPGA 1VQ6P 4PXHB 2JO0A 2MVVA 1VQ8P 2FVEA 1E0HA 2LL8A 4BPHA 4NEOA 1GXHA 1VQ5P 2MY5A 3H0DA 3E2DA 1RO0A 1UJZA 1DV5A 4BPFA 3RG2A 4H2WC 1L0HA 2K0XA 3VRLC 2KGDA 2WPTA 1ACPA 2LOLA 5CZDB 2KOSA 3G71P 4IZ6A 2N5HA 2GDYA 2GZFA 2CNRA 2XXMA 2ERHA 2N6YA 3EJBA 2GYKA 1K9MQ 1T8KA 3EJEA 4COPA 3CCJP 3CCMP 4WYMA 1K8AQ 1M1KQ 2LPKA 2LIWA 2LKIA 2PNGA 3MGEA 4IPYA 2PENA 3CCLP 3CCVP 2GZIA 2M8PA 1VQKP 1F80D 5EJDA 2AVAA 1VQ9P 2KW2A 2FADA 3GKLC 2P9XA 2L9FA 1DNYA 4XROA 2KOOA 2PEJA 2XV6A 2Z46A 2PEKA 1A43A 2L4BA 3RG6C 4QNBA 2M8LA 3CCQP 2KG8A 2CQ8A 5HGNA 2JU2A 4H2XC 4XFYA 3LRYA 2K94A 2MR8A 1YJ9P 1W2BO 5F2NA 2AFDA 1QVFO 3CD6P 5KP8B 2KOQA 2N5IA 2N98A 4XFZA 5JPAA 3DS5A 3GJNA 5DCKA 5KP6B 2LMLA 2PY8A 2X2BA 3NY7B 2OTJP 2KG9A 1IMPA 2KGEA 2KWLA 3G1IA 1M6EX 1ZNVA 2EG5A
chains in the Genus database with same CATH topology
5HGOA 2BUOA 5HGLA 2XXMA 1K9MQ 4GR2A 1BAJA 3G1GA 2JYLA 3CCEP 4COPA 3CCJP 3CCMP 4WYMA 1K73Q 1K8AQ 3I55P 1M1KQ 3CCRP 1Q7YQ 4U0BA 2OARA 1KD1Q 2M8NA 3MGEA 2PENA 4IPYA 3CCLP 3CCVP 3H47A 3NTEA 1A8OA 1KC8Q 2PEOA 2M8PA 4U0AA 3G29A 4U0DA 3CCUP 1VQKP 3CMEP 1QRJA 5BS1A 2L6EA 3G6EP 1VQ9P 1Q82Q 3G0VA 3DS0A 1AUMA 3Q20A 1E6JP 2P9XA 1VQMP 5I4TG 3DS3A 4XROA 1YJWP 2DGYA 2PEJA 2XV6A 4PH0A 1D1DA 3CCSP 1M74A 2QEXP 1RNIA 2PEKA 1RO2A 2Z46A 3G4SP 1N8RQ 1A43A 3RG6C 4QNBA 2M8LA 5F2OA 3CXCO 2EIAA 3H4EA 4COCA 1Q86Q 3CCQP 1IUQA 1NJIQ 2E1MA 1YI2P 4XFXA 3DS1A 5HGNA 2XT1A 2LF4A 3HYBA 4XFYA 2QA4P 3CC2P 3CC4P 1QVGO 1EIAA 2ONTA 1ZMBA 1YIJP 3LRYA 3DS4A 5F2KA 3I56P 4U0EA 2JYGA 2BHVA 5BS2A 3HZQA 2Z45A 1KQSO 1YJ9P 1VQPP 1W2BO 4U0CA 5F2NA 1YITP 1VQNP 1VQ6P 1VQ4P 2PEQA 2PEMA 1QVFO 4PH1A 2CWOA 1S72P 3CD6P 4GR6A 2JO0A 3G28A 3M1MA 1VQ8P 1M90Q 1JJ2O 3WBHA 2PEIA 3CPWO 4XRQA 1Q81Q 3CC7P 1VQ5P 4XFZA 5JPAA 3H0DA 1VQ7P 5HGMA 3E2DA 1YHQP 3G26A 2KODA 3DS5A 3B5IA 1RO0A 1VQOP 3G21A 1K30A 3DTJA 5DCKA 2OTLP 2PY8A 4M0IA 3VRLC 2OTJP 2Z44A 3DPHA 3G1IA 3CMAP 1YJNP 4U0FA 1EOQA 1M6EX 1M6NA 3DS2A 3OW2O 2EFJA 3P05A 1VQLP 3G71P 2EG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XFZ A;  3LRY A;  5JPA A;  3DS4 A;  5HGM A;  1AUM A;  5HGO A;  1E6J P;  2BUO A;  3G26 A;  4U0E A;  2KOD A;  5HGL A;  5I4T G;  2JYG A;  3DS3 A;  2XXM A;  3DS5 A;  4XRO A;  2XV6 A;  4PH0 A;  1D1D A;  1BAJ A;  3G1G A;  2JYL A;  4COP A;  3G21 A;  3DTJ A;  4WYM A;  1A43 A;  5DCK A;  4U0C A;  4QNB A;  2M8L A;  2EIA A;  4M0I A;  4U0B A;  3H4E A;  4COC A;  2M8N A;  3MGE A;  4IPY A;  4PH1 A;  3VRL C;  3H47 A;  3G0V A;  3NTE A;  4XFX A;  1A8O A;  3DS1 A;  2JO0 A;  2M8P A;  3G28 A;  3DPH A;  3G1I A;  5HGN A;  4U0A A;  4U0F A;  1EOQ A;  2LF4 A;  2XT1 A;  3DS2 A;  3G29 A;  4U0D A;  4XFY A;  4XRQ A;  1QRJ A;  3P05 A;  2L6E A;  1EIA A;  2ONT A;  3DS0 A; 
#chains in the Genus database with same CATH topology
 2MVU A;  5HGO A;  2BUO A;  2LTE A;  2JQ4 A;  2EHT A;  1BAJ A;  2JAZ A;  3I55 P;  2L0Q A;  2K2Q A;  1Q7Y Q;  2AFE A;  2JBG A;  2M8N A;  3H47 A;  2PEO A;  2XZ1 C;  3G29 A;  4U0D A;  2VSQ A;  2CG5 B;  3CME P;  4QKO A;  1Q82 Q;  1OR5 A;  2FQ1 A;  1AF8 A;  5I4T G;  3DS3 A;  2DGY A;  2JU1 A;  1RO2 A;  3G4S P;  7CEI A;  2JB0 A;  2EIA A;  1IUQ A;  1NJI Q;  3DS1 A;  5HVC A;  2LF4 A;  3HYB A;  3CC2 P;  1QVG O;  1UNK A;  3GZM A;  2KGC A;  2BHV A;  1HY8 A;  2Z45 A;  3LMO A;  3EJD A;  1VQP P;  2FAC A;  1L0I A;  4DG9 A;  4U0C A;  1YIT P;  1VQ4 P;  2PEQ A;  2GZJ A;  1GPJ A;  4GR6 A;  2KOR A;  2M5R A;  2MF4 A;  3M1M A;  2QNW A;  1M90 Q;  1JJ2 O;  3WBH A;  3CC7 P;  5KP7 B;  1GXG A;  2KOD A;  3B5I A;  1VQO P;  2KR5 A;  3G21 A;  1K30 A;  1NQ4 A;  2GZE A;  2GZG A;  1IMQ A;  2NO8 A;  2DNW A;  1MZ8 A;  2ROQ A;  2CGQ A;  3DPH A;  1YJN P;  4PWV B;  3OW2 O;  1BXI A;  2EFJ A;  3P05 A;  1CEI A;  1VQL P;  4GR2 A;  3G1G A;  2JYL A;  1K73 Q;  2KGA A;  3U43 A;  2OAR A;  1FR2 A;  1KD1 Q;  1Z6M A;  4MRT C;  1A8O A;  1KC8 Q;  4HKG A;  4U0A A;  2VLP A;  1QRJ A;  5BS1 A;  2K93 A;  1HQB A;  2KG6 A;  1AUM A;  1YJW P;  4PH0 A;  1D1D A;  1M74 A;  1N8R Q;  4CA3 A;  2GDW A;  3CXC O;  4COC A;  1KLP A;  2E1M A;  2N50 A;  2VLO A;  2QA4 P;  1EIA A;  2K0Y A;  1ZMB A;  1X3O A;  3CE7 A;  1YIJ P;  3DS4 A;  5F2K A;  3I56 P;  2LIU A;  4U0E A;  5BS2 A;  2K5X A;  2VLQ A;  1VQN P;  2PEM A;  4PH1 A;  2CWO A;  1S72 P;  4R0M A;  2AF8 A;  3G28 A;  2FQ2 A;  1AYI A;  2L22 A;  2PEI A;  3CPW O;  4XRQ A;  1Q81 Q;  2JGP A;  2GDX A;  2KOP A;  1VQ7 P;  5HGM A;  1YHQ P;  3G26 A;  2FAE A;  3DTJ A;  2N6Z A;  2OTL P;  4M0I A;  2Z44 A;  4F37 A;  3CMA P;  4U0F A;  1EMV A;  1EOQ A;  1M6N A;  3DS2 A;  2MD9 A;  2VLN A;  5HGL A;  3B4Q A;  4H2Y C;  3CCE P;  3CCR P;  2FHS C;  4U0B A;  3NTE A;  2MR7 A;  2K0D X;  3GZL A;  3CCU P;  1VKU A;  3G6E P;  2L6E A;  3DS0 A;  3G0V A;  3Q20 A;  1E6J P;  1VQM P;  5HV8 A;  2K92 A;  3CCS P;  2QEX P;  1RNI A;  4UHP B;  2XZ0 D;  5F2O A;  3H4E A;  1Q86 Q;  1YI2 P;  4XFX A;  5EW5 E;  2XT1 A;  1VHN A;  2FQ0 A;  3CC4 P;  2ONT A;  2EHS A;  2JYG A;  3HZQ A;  1KQS O;  2FVF A;  2FVA A;  4BPG A;  1VQ6 P;  4PXH B;  2JO0 A;  2MVV A;  1VQ8 P;  2FVE A;  1E0H A;  2LL8 A;  4BPH A;  4NEO A;  1GXH A;  1VQ5 P;  2MY5 A;  3H0D A;  3E2D A;  1RO0 A;  1UJZ A;  1DV5 A;  4BPF A;  3RG2 A;  4H2W C;  1L0H A;  2K0X A;  3VRL C;  2KGD A;  2WPT A;  1ACP A;  2LOL A;  5CZD B;  2KOS A;  3G71 P;  4IZ6 A;  2N5H A;  2GDY A;  2GZF A;  2CNR A;  2XXM A;  2ERH A;  2N6Y A;  3EJB A;  2GYK A;  1K9M Q;  1T8K A;  3EJE A;  4COP A;  3CCJ P;  3CCM P;  4WYM A;  1K8A Q;  1M1K Q;  2LPK A;  2LIW A;  2LKI A;  2PNG A;  3MGE A;  4IPY A;  2PEN A;  3CCL P;  3CCV P;  2GZI A;  2M8P A;  1VQK P;  1F80 D;  5EJD A;  2AVA A;  1VQ9 P;  2KW2 A;  2FAD A;  3GKL C;  2P9X A;  2L9F A;  1DNY A;  4XRO A;  2KOO A;  2PEJ A;  2XV6 A;  2Z46 A;  2PEK A;  1A43 A;  2L4B A;  3RG6 C;  4QNB A;  2M8L A;  3CCQ P;  2KG8 A;  2CQ8 A;  5HGN A;  2JU2 A;  4H2X C;  4XFY A;  3LRY A;  2K94 A;  2MR8 A;  1YJ9 P;  1W2B O;  5F2N A;  2AFD A;  1QVF O;  3CD6 P;  5KP8 B;  2KOQ A;  2N5I A;  2N98 A;  4XFZ A;  5JPA A;  3DS5 A;  3GJN A;  5DCK A;  5KP6 B;  2LML A;  2PY8 A;  2X2B A;  3NY7 B;  2OTJ P;  2KG9 A;  1IMP A;  2KGE A;  2KWL A;  3G1I A;  1M6E X;  1ZNV A;  2EG5 A; 
#chains in the Genus database with same CATH homology
 5HGO A;  2BUO A;  5HGL A;  2XXM A;  1K9M Q;  4GR2 A;  1BAJ A;  3G1G A;  2JYL A;  3CCE P;  4COP A;  3CCJ P;  3CCM P;  4WYM A;  1K73 Q;  1K8A Q;  3I55 P;  1M1K Q;  3CCR P;  1Q7Y Q;  4U0B A;  2OAR A;  1KD1 Q;  2M8N A;  3MGE A;  2PEN A;  4IPY A;  3CCL P;  3CCV P;  3H47 A;  3NTE A;  1A8O A;  1KC8 Q;  2PEO A;  2M8P A;  4U0A A;  3G29 A;  4U0D A;  3CCU P;  1VQK P;  3CME P;  1QRJ A;  5BS1 A;  2L6E A;  3G6E P;  1VQ9 P;  1Q82 Q;  3G0V A;  3DS0 A;  1AUM A;  3Q20 A;  1E6J P;  2P9X A;  1VQM P;  5I4T G;  3DS3 A;  4XRO A;  1YJW P;  2DGY A;  2PEJ A;  2XV6 A;  4PH0 A;  1D1D A;  3CCS P;  1M74 A;  2QEX P;  1RNI A;  2PEK A;  1RO2 A;  2Z46 A;  3G4S P;  1N8R Q;  1A43 A;  3RG6 C;  4QNB A;  2M8L A;  5F2O A;  3CXC O;  2EIA A;  3H4E A;  4COC A;  1Q86 Q;  3CCQ P;  1IUQ A;  1NJI Q;  2E1M A;  1YI2 P;  4XFX A;  3DS1 A;  5HGN A;  2XT1 A;  2LF4 A;  3HYB A;  4XFY A;  2QA4 P;  3CC2 P;  3CC4 P;  1QVG O;  1EIA A;  2ONT A;  1ZMB A;  1YIJ P;  3LRY A;  3DS4 A;  5F2K A;  3I56 P;  4U0E A;  2JYG A;  2BHV A;  5BS2 A;  3HZQ A;  2Z45 A;  1KQS O;  1YJ9 P;  1VQP P;  1W2B O;  4U0C A;  5F2N A;  1YIT P;  1VQN P;  1VQ6 P;  1VQ4 P;  2PEQ A;  2PEM A;  1QVF O;  4PH1 A;  2CWO A;  1S72 P;  3CD6 P;  4GR6 A;  2JO0 A;  3G28 A;  3M1M A;  1VQ8 P;  1M90 Q;  1JJ2 O;  3WBH A;  2PEI A;  3CPW O;  4XRQ A;  1Q81 Q;  3CC7 P;  1VQ5 P;  4XFZ A;  5JPA A;  3H0D A;  1VQ7 P;  5HGM A;  3E2D A;  1YHQ P;  3G26 A;  2KOD A;  3DS5 A;  3B5I A;  1RO0 A;  1VQO P;  3G21 A;  1K30 A;  3DTJ A;  5DCK A;  2OTL P;  2PY8 A;  4M0I A;  3VRL C;  2OTJ P;  2Z44 A;  3DPH A;  3G1I A;  3CMA P;  1YJN P;  4U0F A;  1EOQ A;  1M6E X;  1M6N A;  3DS2 A;  3OW2 O;  2EFJ A;  3P05 A;  1VQL P;  3G71 P;  2EG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...