4M0IA

Crystal structure of synthetic hiv-1 capsid c-terminal domain (ctd) c198s mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
71
structure length
71
Chain Sequence
SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDSKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords HIV-1 CAPSID PROTEIN
publication title Molecular basis of disulfide bonding-regulated HIV-1 capsid assembly
rcsb
total genus 24
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4m0iA00
3DS0A 3DS4A 3G1IA 4XFYA 4XROA 4PH1A 2XXMA 1AUMA 1BAJA 1A43A 3G28A 3DTJA 3G1GA 4XRQA 2M8NA 5JPAA 4U0AA 4U0EA 5HGOA 3VRLC 3H4EA 4COPA 4U0BA 3DPHA 3DS1A 2M8PA 5HGMA 3DS2A 3MGEA 3H47A 2KODA 5HGNA 2ONTA 2JO0A 1EIAA 5HGLA 5I4TG 2XT1A 2XV6A 1A8OA 3DS5A 3G21A 3P05A 2L6EA 2JYLA 1E6JP 2BUOA 3DS3A 1EOQA 3LRYA 4U0DA 4WYMA 4XFZA 4IPYA 4QNBA 1QRJA 4PH0A 1D1DA 4U0CA 2JYGA 2M8LA 2LF4A 4U0FA 3G29A 4COCA 3NTEA 3G0VA 4XFXA 5DCKA 2EIAA 4M0IA 3G26A
chains in the Genus database with same CATH superfamily
1VKUA 5CZDB 2N5IA 2FQ0A 3E2DA 2KOPA 2KG6A 3CC7P 2CWOA 2JU1A 1GXGA 1UNKA 2Z44A 3G4SP 2JBGA 1M1KQ 1QVFO 2K93A 1KC8Q 2KG8A 3I56P 2KOSA 1UJZA 2BHVA 2KWLA 1W2BO 2JU2A 2MVVA 2PENA 1VQOP 2LL8A 2M8NA 5JPAA 4UHPB 3I55P 1ZNVA 3EJDA 3GZMA 1Q86Q 1YIJP 3H0DA 2KODA 5EJDA 2XT1A 5BS2A 4WYMA 4QNBA 5HV8A 2FQ2A 2OTLP 2XZ1C 1RNIA 1BXIA 1BAJA 3DTJA 3CCJP 1AYIA 2K0YA 3CMEP 1VQ7P 2LKIA 1RO2A 2M8PA 3H47A 3CCVP 2LIUA 2K5XA 2GZJA 2AFDA 2FVAA 1E6JP 2EHSA 2L4BA 2FVEA 2GZGA 2MY5A 1E0HA 2QNWA 1HQBA 1T8KA 1ACPA 2EIAA 3G26A 4GR2A 1VQPP 1A43A 4U0AA 2GDXA 5KP7B 2KOQA 1VQMP 2LIWA 1NQ4A 1YJWP 2NO8A 4IPYA 1QRJA 1VQ8P 1DV5A 2EG5A 2GYKA 1L0HA 3B5IA 3CCLP 5BS1A 4M0IA 4XFYA 1IMQA 4XRQA 2DGYA 3B4QA 2K94A 2FVFA 3DPHA 2CG5B 1VQLP 5HGNA 3CC2P 2GZFA 1A8OA 2XZ0D 2AVAA 3G71P 2N50A 2PNGA 3NTEA 5F2NA 2FADA 1OR5A 1ZMBA 2M5RA 2ROQA 3CMAP 2PEKA 3G6EP 3HZQA 2ERHA 4HKGA 2E1MA 1YITP 3HYBA 1KD1Q 3CXCO 3G0VA 2WPTA 1Q7YQ 2X2BA 3CCSP 3G1IA 2GDYA 2KOOA 1IUQA 2P9XA 2ONTA 5I4TG 2PY8A 2GDWA 3DS3A 3CCQP 3LRYA 3VRLC 2KG9A 2VLPA 1DNYA 1X3OA 5DCKA 1M90Q 1VQ9P 5KP8B 1QVGO 4BPGA 1IMPA 3DS1A 2XV6A 4PH1A 4QKOA 4U0DA 2BUOA 1N8RQ 1KLPA 2PEQA 2LF4A 2PEIA 2FACA 1M6NA 2Z46A 5EW5E 1YHQP 2MVUA 5KP6B 3RG2A 1FR2A 4GR6A 3CD6P 3DS2A 4H2XC 2JO0A 5HGLA 2KGCA 1VQ4P 3OW2O 1VQNP 4PWVB 3DS4A 3CCUP 1M6EX 1M74A 4COPA 3M1MA 2MF4A 2KGAA 2MR8A 3P05A 3GZLA 1D1DA 2JYGA 2CNRA 1CEIA 3G29A 2JGPA 2LTEA 3DS0A 4XROA 1K30A 1YJ9P 5HGOA 2N6ZA 2CQ8A 5HGMA 1VQ5P 2MD9A 2GZIA 3DS5A 7CEIA 4PXHB 2L6EA 3CE7A 2QA4P 4F37A 4U0CA 2CGQA 4CA3A 1K8AQ 5F2OA 2L0QA 3RG6C 1RO0A 1K9MQ 1MZ8A 3LMOA 4H2WC 1Q81Q 1EIAA 2N6YA 3U43A 5HVCA 3CCEP 2PEOA 1KQSO 4XFZA 2PEJA 4PH0A 1VHNA 4U0FA 2VLOA 4DG9A 4MRTC 3NY7B 1Z6MA 2N5HA 1AUMA 3G28A 2KORA 2MR7A 4R0MA 1AF8A 4BPFA 2L22A 1Q82Q 1YI2P 2K0DX 1L0IA 2LOLA 2VSQA 3EJEA 3GJNA 2GZEA 3Q20A 2AF8A 2KGEA 3G1GA 2K92A 2JAZA 2N98A 2KW2A 3H4EA 2JQ4A 2LMLA 1GPJA 1VQ6P 3CCRP 2EFJA 2LPKA 2Z45A 3G21A 2FHSC 1NJIQ 4COCA 2KGDA 1S72P 2VLNA 1VQKP 2K2QA 2XXMA 3WBHA 2PEMA 4U0EA 4U0BA 5F2KA 1JJ2O 1F80D 1K73Q 2EHTA 2JYLA 2FAEA 3CCMP 3CPWO 4NEOA 2M8LA 1GXHA 2VLQA 2KR5A 2DNWA 2FQ1A 1YJNP 3CC4P 1HY8A 2AFEA 3GKLC 1EMVA 3MGEA 2L9FA 2QEXP 2OTJP 4H2YC 3EJBA 4BPHA 1EOQA 2JB0A 4IZ6A 2K0XA 2OARA 4XFXA
chains in the Genus database with same CATH topology
1YHQP 1AUMA 3G28A 4XRQA 2DGYA 3E2DA 3CCLP 4GR6A 3DPHA 3CD6P 3CC7P 3DS2A 2CWOA 1VQLP 5HGNA 2JO0A 5HGLA 2Z44A 3G4SP 1Q82Q 1M1KQ 3CC2P 1QVFO 1A8OA 1KC8Q 3I56P 1YI2P 1VQ4P 3G71P 2BHVA 3OW2O 1W2BO 3NTEA 1VQNP 2PENA 5F2NA 3DS4A 3Q20A 1ZMBA 1VQOP 3G1GA 3CMAP 2M8NA 5JPAA 3CCUP 1M6EX 2PEKA 3I55P 1M74A 3H4EA 4COPA 1Q86Q 1YIJP 3M1MA 2KODA 3H0DA 1VQ6P 3CCRP 3G6EP 2EFJA 3HZQA 4M0IA 2XT1A 2Z45A 3P05A 3G21A 5BS2A 4WYMA 1NJIQ 2E1MA 4QNBA 1YITP 1D1DA 3HYBA 1KD1Q 2JYGA 3CXCO 3G29A 2OTLP 4COCA 3G0VA 1Q7YQ 1RNIA 3CCSP 1S72P 3DS0A 3G1IA 4XROA 1VQKP 1K30A 1BAJA 2XXMA 3WBHA 2PEMA 3DTJA 3CCJP 1YJ9P 3CMEP 4U0EA 5HGOA 1VQ7P 1IUQA 1RO2A 4U0BA 5F2KA 1JJ2O 2M8PA 5HGMA 2P9XA 1VQ5P 3H47A 1K73Q 2ONTA 3CCVP 5I4TG 3DS5A 2PY8A 2L6EA 2JYLA 1E6JP 3DS3A 3LRYA 3VRLC 3CCQP 3CCMP 2QA4P 3CPWO 4U0CA 2M8LA 1K8AQ 5DCKA 2EIAA 1M90Q 3G26A 4GR2A 4XFYA 1VQ9P 1YJNP 5F2OA 1VQPP 3CC4P 3RG6C 1A43A 1RO0A 1QVGO 1K9MQ 4U0AA 3DS1A 3MGEA 1Q81Q 1EIAA 1VQMP 3CCEP 2QEXP 2XV6A 4PH1A 2OTJP 4U0DA 2PEOA 1KQSO 2BUOA 1EOQA 1YJWP 4XFZA 2PEJA 4IPYA 1QRJA 4PH0A 1N8RQ 1VQ8P 2OARA 2PEQA 2EG5A 2LF4A 4U0FA 2PEIA 3B5IA 4XFXA 1M6NA 5BS1A 2Z46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS0 A;  3DS4 A;  3G1I A;  4XFY A;  4XRO A;  4PH1 A;  2XXM A;  1AUM A;  1BAJ A;  1A43 A;  3G28 A;  3DTJ A;  3G1G A;  4XRQ A;  2M8N A;  5JPA A;  4U0A A;  4U0E A;  5HGO A;  3VRL C;  3H4E A;  4COP A;  4U0B A;  3DPH A;  3DS1 A;  2M8P A;  5HGM A;  3DS2 A;  3MGE A;  3H47 A;  2KOD A;  5HGN A;  2ONT A;  2JO0 A;  1EIA A;  5HGL A;  5I4T G;  2XT1 A;  2XV6 A;  1A8O A;  3DS5 A;  3G21 A;  3P05 A;  2L6E A;  2JYL A;  1E6J P;  2BUO A;  3DS3 A;  1EOQ A;  3LRY A;  4U0D A;  4WYM A;  4XFZ A;  4IPY A;  4QNB A;  1QRJ A;  4PH0 A;  1D1D A;  4U0C A;  2JYG A;  2M8L A;  2LF4 A;  4U0F A;  3G29 A;  4COC A;  3NTE A;  3G0V A;  4XFX A;  5DCK A;  2EIA A;  4M0I A;  3G26 A; 
#chains in the Genus database with same CATH topology
 1VKU A;  5CZD B;  2N5I A;  2FQ0 A;  3E2D A;  2KOP A;  2KG6 A;  3CC7 P;  2CWO A;  2JU1 A;  1GXG A;  1UNK A;  2Z44 A;  3G4S P;  2JBG A;  1M1K Q;  1QVF O;  2K93 A;  1KC8 Q;  2KG8 A;  3I56 P;  2KOS A;  1UJZ A;  2BHV A;  2KWL A;  1W2B O;  2JU2 A;  2MVV A;  2PEN A;  1VQO P;  2LL8 A;  2M8N A;  5JPA A;  4UHP B;  3I55 P;  1ZNV A;  3EJD A;  3GZM A;  1Q86 Q;  1YIJ P;  3H0D A;  2KOD A;  5EJD A;  2XT1 A;  5BS2 A;  4WYM A;  4QNB A;  5HV8 A;  2FQ2 A;  2OTL P;  2XZ1 C;  1RNI A;  1BXI A;  1BAJ A;  3DTJ A;  3CCJ P;  1AYI A;  2K0Y A;  3CME P;  1VQ7 P;  2LKI A;  1RO2 A;  2M8P A;  3H47 A;  3CCV P;  2LIU A;  2K5X A;  2GZJ A;  2AFD A;  2FVA A;  1E6J P;  2EHS A;  2L4B A;  2FVE A;  2GZG A;  2MY5 A;  1E0H A;  2QNW A;  1HQB A;  1T8K A;  1ACP A;  2EIA A;  3G26 A;  4GR2 A;  1VQP P;  1A43 A;  4U0A A;  2GDX A;  5KP7 B;  2KOQ A;  1VQM P;  2LIW A;  1NQ4 A;  1YJW P;  2NO8 A;  4IPY A;  1QRJ A;  1VQ8 P;  1DV5 A;  2EG5 A;  2GYK A;  1L0H A;  3B5I A;  3CCL P;  5BS1 A;  4M0I A;  4XFY A;  1IMQ A;  4XRQ A;  2DGY A;  3B4Q A;  2K94 A;  2FVF A;  3DPH A;  2CG5 B;  1VQL P;  5HGN A;  3CC2 P;  2GZF A;  1A8O A;  2XZ0 D;  2AVA A;  3G71 P;  2N50 A;  2PNG A;  3NTE A;  5F2N A;  2FAD A;  1OR5 A;  1ZMB A;  2M5R A;  2ROQ A;  3CMA P;  2PEK A;  3G6E P;  3HZQ A;  2ERH A;  4HKG A;  2E1M A;  1YIT P;  3HYB A;  1KD1 Q;  3CXC O;  3G0V A;  2WPT A;  1Q7Y Q;  2X2B A;  3CCS P;  3G1I A;  2GDY A;  2KOO A;  1IUQ A;  2P9X A;  2ONT A;  5I4T G;  2PY8 A;  2GDW A;  3DS3 A;  3CCQ P;  3LRY A;  3VRL C;  2KG9 A;  2VLP A;  1DNY A;  1X3O A;  5DCK A;  1M90 Q;  1VQ9 P;  5KP8 B;  1QVG O;  4BPG A;  1IMP A;  3DS1 A;  2XV6 A;  4PH1 A;  4QKO A;  4U0D A;  2BUO A;  1N8R Q;  1KLP A;  2PEQ A;  2LF4 A;  2PEI A;  2FAC A;  1M6N A;  2Z46 A;  5EW5 E;  1YHQ P;  2MVU A;  5KP6 B;  3RG2 A;  1FR2 A;  4GR6 A;  3CD6 P;  3DS2 A;  4H2X C;  2JO0 A;  5HGL A;  2KGC A;  1VQ4 P;  3OW2 O;  1VQN P;  4PWV B;  3DS4 A;  3CCU P;  1M6E X;  1M74 A;  4COP A;  3M1M A;  2MF4 A;  2KGA A;  2MR8 A;  3P05 A;  3GZL A;  1D1D A;  2JYG A;  2CNR A;  1CEI A;  3G29 A;  2JGP A;  2LTE A;  3DS0 A;  4XRO A;  1K30 A;  1YJ9 P;  5HGO A;  2N6Z A;  2CQ8 A;  5HGM A;  1VQ5 P;  2MD9 A;  2GZI A;  3DS5 A;  7CEI A;  4PXH B;  2L6E A;  3CE7 A;  2QA4 P;  4F37 A;  4U0C A;  2CGQ A;  4CA3 A;  1K8A Q;  5F2O A;  2L0Q A;  3RG6 C;  1RO0 A;  1K9M Q;  1MZ8 A;  3LMO A;  4H2W C;  1Q81 Q;  1EIA A;  2N6Y A;  3U43 A;  5HVC A;  3CCE P;  2PEO A;  1KQS O;  4XFZ A;  2PEJ A;  4PH0 A;  1VHN A;  4U0F A;  2VLO A;  4DG9 A;  4MRT C;  3NY7 B;  1Z6M A;  2N5H A;  1AUM A;  3G28 A;  2KOR A;  2MR7 A;  4R0M A;  1AF8 A;  4BPF A;  2L22 A;  1Q82 Q;  1YI2 P;  2K0D X;  1L0I A;  2LOL A;  2VSQ A;  3EJE A;  3GJN A;  2GZE A;  3Q20 A;  2AF8 A;  2KGE A;  3G1G A;  2K92 A;  2JAZ A;  2N98 A;  2KW2 A;  3H4E A;  2JQ4 A;  2LML A;  1GPJ A;  1VQ6 P;  3CCR P;  2EFJ A;  2LPK A;  2Z45 A;  3G21 A;  2FHS C;  1NJI Q;  4COC A;  2KGD A;  1S72 P;  2VLN A;  1VQK P;  2K2Q A;  2XXM A;  3WBH A;  2PEM A;  4U0E A;  4U0B A;  5F2K A;  1JJ2 O;  1F80 D;  1K73 Q;  2EHT A;  2JYL A;  2FAE A;  3CCM P;  3CPW O;  4NEO A;  2M8L A;  1GXH A;  2VLQ A;  2KR5 A;  2DNW A;  2FQ1 A;  1YJN P;  3CC4 P;  1HY8 A;  2AFE A;  3GKL C;  1EMV A;  3MGE A;  2L9F A;  2QEX P;  2OTJ P;  4H2Y C;  3EJB A;  4BPH A;  1EOQ A;  2JB0 A;  4IZ6 A;  2K0X A;  2OAR A;  4XFX A; 
#chains in the Genus database with same CATH homology
 1YHQ P;  1AUM A;  3G28 A;  4XRQ A;  2DGY A;  3E2D A;  3CCL P;  4GR6 A;  3DPH A;  3CD6 P;  3CC7 P;  3DS2 A;  2CWO A;  1VQL P;  5HGN A;  2JO0 A;  5HGL A;  2Z44 A;  3G4S P;  1Q82 Q;  1M1K Q;  3CC2 P;  1QVF O;  1A8O A;  1KC8 Q;  3I56 P;  1YI2 P;  1VQ4 P;  3G71 P;  2BHV A;  3OW2 O;  1W2B O;  3NTE A;  1VQN P;  2PEN A;  5F2N A;  3DS4 A;  3Q20 A;  1ZMB A;  1VQO P;  3G1G A;  3CMA P;  2M8N A;  5JPA A;  3CCU P;  1M6E X;  2PEK A;  3I55 P;  1M74 A;  3H4E A;  4COP A;  1Q86 Q;  1YIJ P;  3M1M A;  2KOD A;  3H0D A;  1VQ6 P;  3CCR P;  3G6E P;  2EFJ A;  3HZQ A;  4M0I A;  2XT1 A;  2Z45 A;  3P05 A;  3G21 A;  5BS2 A;  4WYM A;  1NJI Q;  2E1M A;  4QNB A;  1YIT P;  1D1D A;  3HYB A;  1KD1 Q;  2JYG A;  3CXC O;  3G29 A;  2OTL P;  4COC A;  3G0V A;  1Q7Y Q;  1RNI A;  3CCS P;  1S72 P;  3DS0 A;  3G1I A;  4XRO A;  1VQK P;  1K30 A;  1BAJ A;  2XXM A;  3WBH A;  2PEM A;  3DTJ A;  3CCJ P;  1YJ9 P;  3CME P;  4U0E A;  5HGO A;  1VQ7 P;  1IUQ A;  1RO2 A;  4U0B A;  5F2K A;  1JJ2 O;  2M8P A;  5HGM A;  2P9X A;  1VQ5 P;  3H47 A;  1K73 Q;  2ONT A;  3CCV P;  5I4T G;  3DS5 A;  2PY8 A;  2L6E A;  2JYL A;  1E6J P;  3DS3 A;  3LRY A;  3VRL C;  3CCQ P;  3CCM P;  2QA4 P;  3CPW O;  4U0C A;  2M8L A;  1K8A Q;  5DCK A;  2EIA A;  1M90 Q;  3G26 A;  4GR2 A;  4XFY A;  1VQ9 P;  1YJN P;  5F2O A;  1VQP P;  3CC4 P;  3RG6 C;  1A43 A;  1RO0 A;  1QVG O;  1K9M Q;  4U0A A;  3DS1 A;  3MGE A;  1Q81 Q;  1EIA A;  1VQM P;  3CCE P;  2QEX P;  2XV6 A;  4PH1 A;  2OTJ P;  4U0D A;  2PEO A;  1KQS O;  2BUO A;  1EOQ A;  1YJW P;  4XFZ A;  2PEJ A;  4IPY A;  1QRJ A;  4PH0 A;  1N8R Q;  1VQ8 P;  2OAR A;  2PEQ A;  2EG5 A;  2LF4 A;  4U0F A;  2PEI A;  3B5I A;  4XFX A;  1M6N A;  5BS1 A;  2Z46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...