4M0IA

Crystal structure of synthetic hiv-1 capsid c-terminal domain (ctd) c198s mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
71
structure length
71
Chain Sequence
b'SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDSKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 CAPSID PROTEIN
publication title Molecular basis of disulfide bonding-regulated HIV-1 capsid assembly
rcsb
molecule tags Viral protein
total genus 24
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4m0iA00
1BAJA 1EIAA 1QRJA 5JPAA 1EOQA 3G28A 2L6EA 2JYLA 3G29A 2KODA 1A43A 4XROA 1D1DA 3P05A 3LRYA 5DCKA 3H47A 3DS1A 4IPYA 2M8LA 3MGEA 1AUMA 2JYGA 5HGLA 4XFZA 4COCA 2BUOA 4U0BA 2JO0A 2XV6A 3G21A 3DS3A 3G26A 2M8NA 3G0VA 2XXMA 3G1GA 2LF4A 4WYMA 4XFYA 4COPA 3NTEA 5HGOA 1E6JP 1A8OA 2EIAA 2XT1A 4XFXA 3VRLC 5I4TG 3DS5A 3DTJA 4U0EA 2M8PA 3G1IA 4XRQA 4QNBA 4U0FA 3DS2A 4U0AA 3DS4A 4PH0A 3H4EA 4PH1A 3DPHA 4U0DA 4M0IA 5HGNA 3DS0A 5HGMA 4U0CA 2ONTA
chains in the Genus database with same CATH superfamily
5JPAA 2LOLA 1Q82Q 2MR8A 2VLNA 1M6EX 2KGEA 2VLPA 2PEOA 1KQSO 1KC8Q 2CQ8A 3G0VA 2XZ0D 5EJDA 1RO2A 3H0DA 3RG2A 4DG9A 1KD1Q 1DV5A 4PXHB 3DS2A 1KLPA 2L9FA 3EJDA 3GKLC 2GZFA 4BPGA 2LL8A 1VQLP 3CE7A 2GZGA 3G21A 2MD9A 2GDYA 5HVCA 4QNBA 3DS4A 3CCQP 2JGPA 2KGDA 1Q7YQ 1FR2A 2KOSA 2L0QA 1T8KA 5HGNA 3CCJP 3CC7P 2N5HA 4XFZA 2JO0A 1GXHA 2LPKA 2KR5A 2GDXA 1VQ5P 1EMVA 3CMEP 5I4TG 1MZ8A 1Q81Q 4M0IA 2K93A 5BS1A 2N6YA 2LIUA 1S72P 1JJ2O 2K92A 2AF8A 2JBGA 3LRYA 3U43A 4UHPB 2PEMA 2XV6A 5HV8A 1QVGO 3CXCO 2DGYA 2JB0A 2JU2A 1YIJP 1VQ4P 3DS5A 2FVAA 4BPHA 2PNGA 2KG9A 1M1KQ 3CC4P 3HYBA 5HGMA 3CCMP 1VQNP 1QRJA 3CCLP 3G6EP 2FVEA 2L22A 5CZDB 2CGQA 3GZLA 2XZ1C 2P9XA 1BXIA 1N8RQ 4XFYA 5HGOA 1VQMP 3OW2O 2E1MA 4XRQA 5EW5E 3CCRP 5F2OA 2PENA 4U0CA 1VQ8P 1A43A 1YJNP 2GYKA 2VLOA 1AUMA 2DNWA 5HGLA 1VHNA 5BS2A 1HY8A 2K0YA 2KG6A 1ZMBA 4COPA 1IMPA 2CNRA 1QVFO 1YHQP 1CEIA 1L0HA 1GPJA 3H4EA 4PWVB 3CCEP 1RNIA 1K9MQ 1AF8A 2KG8A 5KP7B 2LKIA 3RG6C 1VKUA 4XFXA 2LMLA 4IZ6A 1OR5A 1VQ9P 2OTLP 1YJ9P 4H2WC 2GZIA 1Z6MA 3E2DA 1BAJA 3I56P 2AVAA 4XROA 2VLQA 3P05A 5DCKA 1M6NA 2PEQA 1VQ7P 2GDWA 1M74A 2LIWA 3CD6P 1IMQA 1Q86Q 2BHVA 4U0FA 2Z45A 2FQ2A 1YJWP 2CWOA 2K5XA 2MVUA 2M8LA 2AFDA 2JQ4A 1NJIQ 1NQ4A 2QEXP 1IUQA 3I55P 1GXGA 3DS0A 2ONTA 2KOOA 1EIAA 4GR2A 3GJNA 3G28A 3B5IA 2KGAA 2FVFA 2JU1A 3DS1A 3MGEA 1VQOP 2FAEA 4WYMA 3NY7B 3NTEA 2FHSC 1VQKP 1A8OA 2EIAA 2MF4A 2PEKA 2KOQA 2NO8A 1X3OA 4PH1A 4U0DA 3CCUP 4R0MA 3DTJA 2K94A 3LMOA 1M90Q 2GZEA 2ROQA 2Z44A 4COCA 5F2NA 1ZNVA 3B4QA 2AFEA 2KWLA 2LTEA 1YITP 2KW2A 2N6ZA 2KGCA 4PH0A 1K8AQ 4MRTC 3G29A 2KODA 2N98A 2L4BA 1E0HA 4IPYA 1F80D 2PY8A 4NEOA 1W2BO 2MVVA 2JAZA 4U0EA 1ACPA 4BPFA 2K0DX 4H2YC 2OTJP 3CMAP 1EOQA 2K2QA 3G71P 2JYLA 3CCSP 1K73Q 1D1DA 1VQ6P 2PEJA 2XXMA 3G1GA 3Q20A 2WPTA 2KORA 1K30A 3EJEA 3WBHA 2OARA 1HQBA 3CCVP 2FQ1A 4HKGA 2QNWA 2BUOA 3M1MA 3DS3A 1L0IA 2M8NA 2N5IA 1AYIA 1RO0A 1E6JP 2X2BA 4GR6A 3EJBA 2EG5A 5KP6B 5KP8B 2ERHA 2L6EA 1UJZA 4F37A 2PEIA 2FACA 2K0XA 2JYGA 1UNKA 7CEIA 3GZMA 2M5RA 3G4SP 3CPWO 4CA3A 2N50A 4H2XC 2XT1A 2GZJA 2M8PA 2MY5A 2FADA 5F2KA 2EHSA 2VSQA 3CC2P 1YI2P 1DNYA 2EHTA 3H47A 4U0BA 2KOPA 2CG5B 2EFJA 3G26A 1VQPP 4QKOA 2LF4A 2MR7A 2QA4P 2FQ0A 3VRLC 3G1IA 4U0AA 2Z46A 3HZQA 3DPHA
chains in the Genus database with same CATH topology
2OTJP 5JPAA 3CMAP 1EOQA 3G71P 3CCLP 1YJWP 2CWOA 3G6EP 2JYLA 3CCSP 1Q82Q 1K73Q 2M8LA 1VQ6P 1D1DA 1M6EX 2PEOA 2PEJA 1KQSO 2P9XA 1KC8Q 1N8RQ 3G0VA 2XXMA 3G1GA 4XFYA 1NJIQ 5HGOA 1RO2A 3OW2O 1VQMP 3H0DA 3Q20A 2QEXP 1KD1Q 1IUQA 2E1MA 1K30A 3WBHA 4XRQA 3DS2A 3I55P 2OARA 5F2OA 3CCRP 3DS0A 2PENA 4U0CA 2ONTA 1EIAA 4GR2A 3CCVP 1VQ8P 3G28A 1A43A 3B5IA 1YJNP 3DS1A 3MGEA 1AUMA 5HGLA 2BUOA 3M1MA 1VQLP 3G21A 5BS2A 3DS3A 1VQOP 2M8NA 4WYMA 1ZMBA 1RO0A 4COPA 3NTEA 1E6JP 1VQKP 1A8OA 2EIAA 1QVFO 1YHQP 2PEKA 4GR6A 4QNBA 3DS4A 3CCQP 3H4EA 4PH1A 2EG5A 4U0DA 3CCUP 3CCEP 3DTJA 1RNIA 1Q7YQ 1K9MQ 1M90Q 2L6EA 2PEIA 4COCA 2Z44A 5HGNA 3CCJP 3CC7P 2JYGA 4XFZA 2JO0A 5F2NA 3G4SP 3CPWO 3RG6C 1VQ5P 3CMEP 1YITP 4XFXA 2XT1A 5I4TG 1Q81Q 2M8PA 1VQ9P 2OTLP 4PH0A 1YJ9P 4M0IA 5BS1A 3E2DA 1BAJA 5F2KA 3I56P 1S72P 1K8AQ 1JJ2O 3CC2P 1YI2P 3G29A 2KODA 4XROA 3P05A 3LRYA 5DCKA 3H47A 4IPYA 2PEMA 4U0BA 1M6NA 2XV6A 2EFJA 3G26A 1VQPP 1QVGO 2PY8A 2PEQA 1VQ7P 1M74A 1W2BO 2LF4A 3CXCO 2DGYA 1YIJP 2QA4P 3VRLC 1VQ4P 3DS5A 3CD6P 4U0EA 3G1IA 1Q86Q 1M1KQ 2BHVA 4U0FA 3CC4P 4U0AA 2Z46A 2Z45A 3HZQA 3DPHA 3HYBA 5HGMA 3CCMP 1VQNP 1QRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAJ A;  1EIA A;  1QRJ A;  5JPA A;  1EOQ A;  3G28 A;  2L6E A;  2JYL A;  3G29 A;  2KOD A;  1A43 A;  4XRO A;  1D1D A;  3P05 A;  3LRY A;  5DCK A;  3H47 A;  3DS1 A;  4IPY A;  2M8L A;  3MGE A;  1AUM A;  2JYG A;  5HGL A;  4XFZ A;  4COC A;  2BUO A;  4U0B A;  2JO0 A;  2XV6 A;  3G21 A;  3DS3 A;  3G26 A;  2M8N A;  3G0V A;  2XXM A;  3G1G A;  2LF4 A;  4WYM A;  4XFY A;  4COP A;  3NTE A;  5HGO A;  1E6J P;  1A8O A;  2EIA A;  2XT1 A;  4XFX A;  3VRL C;  5I4T G;  3DS5 A;  3DTJ A;  4U0E A;  2M8P A;  3G1I A;  4XRQ A;  4QNB A;  4U0F A;  3DS2 A;  4U0A A;  3DS4 A;  4PH0 A;  3H4E A;  4PH1 A;  3DPH A;  4U0D A;  4M0I A;  5HGN A;  3DS0 A;  5HGM A;  4U0C A;  2ONT A; 
#chains in the Genus database with same CATH topology
 5JPA A;  2LOL A;  1Q82 Q;  2MR8 A;  2VLN A;  1M6E X;  2KGE A;  2VLP A;  2PEO A;  1KQS O;  1KC8 Q;  2CQ8 A;  3G0V A;  2XZ0 D;  5EJD A;  1RO2 A;  3H0D A;  3RG2 A;  4DG9 A;  1KD1 Q;  1DV5 A;  4PXH B;  3DS2 A;  1KLP A;  2L9F A;  3EJD A;  3GKL C;  2GZF A;  4BPG A;  2LL8 A;  1VQL P;  3CE7 A;  2GZG A;  3G21 A;  2MD9 A;  2GDY A;  5HVC A;  4QNB A;  3DS4 A;  3CCQ P;  2JGP A;  2KGD A;  1Q7Y Q;  1FR2 A;  2KOS A;  2L0Q A;  1T8K A;  5HGN A;  3CCJ P;  3CC7 P;  2N5H A;  4XFZ A;  2JO0 A;  1GXH A;  2LPK A;  2KR5 A;  2GDX A;  1VQ5 P;  1EMV A;  3CME P;  5I4T G;  1MZ8 A;  1Q81 Q;  4M0I A;  2K93 A;  5BS1 A;  2N6Y A;  2LIU A;  1S72 P;  1JJ2 O;  2K92 A;  2AF8 A;  2JBG A;  3LRY A;  3U43 A;  4UHP B;  2PEM A;  2XV6 A;  5HV8 A;  1QVG O;  3CXC O;  2DGY A;  2JB0 A;  2JU2 A;  1YIJ P;  1VQ4 P;  3DS5 A;  2FVA A;  4BPH A;  2PNG A;  2KG9 A;  1M1K Q;  3CC4 P;  3HYB A;  5HGM A;  3CCM P;  1VQN P;  1QRJ A;  3CCL P;  3G6E P;  2FVE A;  2L22 A;  5CZD B;  2CGQ A;  3GZL A;  2XZ1 C;  2P9X A;  1BXI A;  1N8R Q;  4XFY A;  5HGO A;  1VQM P;  3OW2 O;  2E1M A;  4XRQ A;  5EW5 E;  3CCR P;  5F2O A;  2PEN A;  4U0C A;  1VQ8 P;  1A43 A;  1YJN P;  2GYK A;  2VLO A;  1AUM A;  2DNW A;  5HGL A;  1VHN A;  5BS2 A;  1HY8 A;  2K0Y A;  2KG6 A;  1ZMB A;  4COP A;  1IMP A;  2CNR A;  1QVF O;  1YHQ P;  1CEI A;  1L0H A;  1GPJ A;  3H4E A;  4PWV B;  3CCE P;  1RNI A;  1K9M Q;  1AF8 A;  2KG8 A;  5KP7 B;  2LKI A;  3RG6 C;  1VKU A;  4XFX A;  2LML A;  4IZ6 A;  1OR5 A;  1VQ9 P;  2OTL P;  1YJ9 P;  4H2W C;  2GZI A;  1Z6M A;  3E2D A;  1BAJ A;  3I56 P;  2AVA A;  4XRO A;  2VLQ A;  3P05 A;  5DCK A;  1M6N A;  2PEQ A;  1VQ7 P;  2GDW A;  1M74 A;  2LIW A;  3CD6 P;  1IMQ A;  1Q86 Q;  2BHV A;  4U0F A;  2Z45 A;  2FQ2 A;  1YJW P;  2CWO A;  2K5X A;  2MVU A;  2M8L A;  2AFD A;  2JQ4 A;  1NJI Q;  1NQ4 A;  2QEX P;  1IUQ A;  3I55 P;  1GXG A;  3DS0 A;  2ONT A;  2KOO A;  1EIA A;  4GR2 A;  3GJN A;  3G28 A;  3B5I A;  2KGA A;  2FVF A;  2JU1 A;  3DS1 A;  3MGE A;  1VQO P;  2FAE A;  4WYM A;  3NY7 B;  3NTE A;  2FHS C;  1VQK P;  1A8O A;  2EIA A;  2MF4 A;  2PEK A;  2KOQ A;  2NO8 A;  1X3O A;  4PH1 A;  4U0D A;  3CCU P;  4R0M A;  3DTJ A;  2K94 A;  3LMO A;  1M90 Q;  2GZE A;  2ROQ A;  2Z44 A;  4COC A;  5F2N A;  1ZNV A;  3B4Q A;  2AFE A;  2KWL A;  2LTE A;  1YIT P;  2KW2 A;  2N6Z A;  2KGC A;  4PH0 A;  1K8A Q;  4MRT C;  3G29 A;  2KOD A;  2N98 A;  2L4B A;  1E0H A;  4IPY A;  1F80 D;  2PY8 A;  4NEO A;  1W2B O;  2MVV A;  2JAZ A;  4U0E A;  1ACP A;  4BPF A;  2K0D X;  4H2Y C;  2OTJ P;  3CMA P;  1EOQ A;  2K2Q A;  3G71 P;  2JYL A;  3CCS P;  1K73 Q;  1D1D A;  1VQ6 P;  2PEJ A;  2XXM A;  3G1G A;  3Q20 A;  2WPT A;  2KOR A;  1K30 A;  3EJE A;  3WBH A;  2OAR A;  1HQB A;  3CCV P;  2FQ1 A;  4HKG A;  2QNW A;  2BUO A;  3M1M A;  3DS3 A;  1L0I A;  2M8N A;  2N5I A;  1AYI A;  1RO0 A;  1E6J P;  2X2B A;  4GR6 A;  3EJB A;  2EG5 A;  5KP6 B;  5KP8 B;  2ERH A;  2L6E A;  1UJZ A;  4F37 A;  2PEI A;  2FAC A;  2K0X A;  2JYG A;  1UNK A;  7CEI A;  3GZM A;  2M5R A;  3G4S P;  3CPW O;  4CA3 A;  2N50 A;  4H2X C;  2XT1 A;  2GZJ A;  2M8P A;  2MY5 A;  2FAD A;  5F2K A;  2EHS A;  2VSQ A;  3CC2 P;  1YI2 P;  1DNY A;  2EHT A;  3H47 A;  4U0B A;  2KOP A;  2CG5 B;  2EFJ A;  3G26 A;  1VQP P;  4QKO A;  2LF4 A;  2MR7 A;  2QA4 P;  2FQ0 A;  3VRL C;  3G1I A;  4U0A A;  2Z46 A;  3HZQ A;  3DPH A; 
#chains in the Genus database with same CATH homology
 2OTJ P;  5JPA A;  3CMA P;  1EOQ A;  3G71 P;  3CCL P;  1YJW P;  2CWO A;  3G6E P;  2JYL A;  3CCS P;  1Q82 Q;  1K73 Q;  2M8L A;  1VQ6 P;  1D1D A;  1M6E X;  2PEO A;  2PEJ A;  1KQS O;  2P9X A;  1KC8 Q;  1N8R Q;  3G0V A;  2XXM A;  3G1G A;  4XFY A;  1NJI Q;  5HGO A;  1RO2 A;  3OW2 O;  1VQM P;  3H0D A;  3Q20 A;  2QEX P;  1KD1 Q;  1IUQ A;  2E1M A;  1K30 A;  3WBH A;  4XRQ A;  3DS2 A;  3I55 P;  2OAR A;  5F2O A;  3CCR P;  3DS0 A;  2PEN A;  4U0C A;  2ONT A;  1EIA A;  4GR2 A;  3CCV P;  1VQ8 P;  3G28 A;  1A43 A;  3B5I A;  1YJN P;  3DS1 A;  3MGE A;  1AUM A;  5HGL A;  2BUO A;  3M1M A;  1VQL P;  3G21 A;  5BS2 A;  3DS3 A;  1VQO P;  2M8N A;  4WYM A;  1ZMB A;  1RO0 A;  4COP A;  3NTE A;  1E6J P;  1VQK P;  1A8O A;  2EIA A;  1QVF O;  1YHQ P;  2PEK A;  4GR6 A;  4QNB A;  3DS4 A;  3CCQ P;  3H4E A;  4PH1 A;  2EG5 A;  4U0D A;  3CCU P;  3CCE P;  3DTJ A;  1RNI A;  1Q7Y Q;  1K9M Q;  1M90 Q;  2L6E A;  2PEI A;  4COC A;  2Z44 A;  5HGN A;  3CCJ P;  3CC7 P;  2JYG A;  4XFZ A;  2JO0 A;  5F2N A;  3G4S P;  3CPW O;  3RG6 C;  1VQ5 P;  3CME P;  1YIT P;  4XFX A;  2XT1 A;  5I4T G;  1Q81 Q;  2M8P A;  1VQ9 P;  2OTL P;  4PH0 A;  1YJ9 P;  4M0I A;  5BS1 A;  3E2D A;  1BAJ A;  5F2K A;  3I56 P;  1S72 P;  1K8A Q;  1JJ2 O;  3CC2 P;  1YI2 P;  3G29 A;  2KOD A;  4XRO A;  3P05 A;  3LRY A;  5DCK A;  3H47 A;  4IPY A;  2PEM A;  4U0B A;  1M6N A;  2XV6 A;  2EFJ A;  3G26 A;  1VQP P;  1QVG O;  2PY8 A;  2PEQ A;  1VQ7 P;  1M74 A;  1W2B O;  2LF4 A;  3CXC O;  2DGY A;  1YIJ P;  2QA4 P;  3VRL C;  1VQ4 P;  3DS5 A;  3CD6 P;  4U0E A;  3G1I A;  1Q86 Q;  1M1K Q;  2BHV A;  4U0F A;  3CC4 P;  4U0A A;  2Z46 A;  2Z45 A;  3HZQ A;  3DPH A;  3HYB A;  5HGM A;  3CCM P;  1VQN P;  1QRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...