2JBGA

Crystal structure of the mutant n560a of the nuclease domain of cole7 in complex with im7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
86
structure length
86
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords COLICIN-E7 IMMUNITY PROTEIN
publication title The Conserved Asparagine in the Hnh Motif Serves an Important Structural Role in Metal Finger Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 86
sequence length 86
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2jbgA00
1AYIA 2WPTA 2GZGA 5EW5E 2VLOA 3GJNA 2VLPA 2JBGA 2JB0A 2K5XA 2ERHA 1UJZA 3U43A 1MZ8A 2GZFA 4F37A 4QKOA 2VLQA 2GZJA 2NO8A 1BXIA 1E0HA 1IMPA 1GXGA 1ZNVA 3GKLC 1EMVA 1UNKA 1GXHA 7CEIA 1CEIA 1IMQA 2K0DX 2GYKA 2GZIA 2JAZA 4UHPB 1FR2A 2GZEA 2VLNA
chains in the Genus database with same CATH superfamily
1D1DA 4XRQA 2BHVA 3H4EA 2EHTA 2KG9A 5KP8B 3RG2A 4U0BA 1E0HA 2L9FA 2JO0A 2PENA 5BS1A 3OW2O 1VQ4P 2DNWA 3CD6P 1AUMA 5I4TG 1L0IA 2EHSA 2N98A 2Z45A 3I55P 1A8OA 3CMEP 2KR5A 2XXMA 1VQ9P 1BAJA 4GR6A 2PEOA 2FADA 3GZMA 2L0QA 1AF8A 1Q81Q 2VLPA 1K30A 1A43A 2PEIA 4COCA 2EIAA 4XFXA 1QVFO 7CEIA 2XZ1C 3EJBA 2AFEA 3G6EP 2MR7A 1NJIQ 1FR2A 1KD1Q 2KWLA 2LTEA 3CCEP 3G1IA 4BPFA 4H2XC 2PEJA 4GR2A 3E2DA 2KOPA 2FQ0A 3GKLC 2CWOA 2KOOA 1VQPP 4CA3A 2N6ZA 3CE7A 5DCKA 2VLNA 2MY5A 2L4BA 1ZMBA 1YI2P 3CMAP 4COPA 2JB0A 4BPGA 4H2WC 3CC7P 2QNWA 3M1MA 2FQ2A 2KOQA 3CC2P 3CC4P 2PNGA 4PH0A 2N5IA 2GYKA 2ROQA 1VQ8P 3G1GA 4WYMA 2GDWA 5EW5E 3NY7B 2QA4P 2LIWA 2VLQA 2KGAA 2Z46A 1VQ6P 3Q20A 3G71P 3CCJP 5JPAA 1VQLP 2CGQA 3DPHA 3DS2A 1Z6MA 1YIJP 4QKOA 3G4SP 3CCVP 3CXCO 2P9XA 2FVAA 3RG6C 1KQSO 2GDYA 2K0DX 2AF8A 1VQOP 2EG5A 2KGEA 2WPTA 1F80D 2LOLA 1M90Q 1K8AQ 3G21A 3GJNA 1K73Q 4U0DA 3CCSP 1EOQA 5KP7B 2LL8A 4HKGA 3CCUP 2PEMA 2GZJA 1VKUA 2KODA 1X3OA 3DS4A 2JU1A 1NQ4A 2JAZA 2M5RA 2FVEA 1M1KQ 2XZ0D 1IUQA 3MGEA 2MR8A 1BXIA 3EJEA 5CZDB 1RO2A 1CEIA 2KG6A 1YJNP 4PXHB 4MRTC 1QVGO 3GZLA 2GZEA 1AYIA 2VLOA 1YJ9P 2LKIA 1JJ2O 2KORA 4U0AA 3H0DA 4PH1A 2ERHA 3DS1A 2KG8A 2NO8A 3HZQA 2MD9A 1VQNP 2CG5B 4U0FA 4U0EA 1DV5A 5F2KA 2L22A 2BUOA 2AFDA 1RNIA 1IMQA 4XROA 2MVUA 2PEKA 2FVFA 3VRLC 2OTLP 2N6YA 5HGLA 4IZ6A 1DNYA 3CCQP 5HGOA 2LIUA 2CNRA 1RO0A 3NTEA 1M6EX 1MZ8A 2M8PA 2GDXA 3WBHA 2XT1A 1ZNVA 2DGYA 4U0CA 5HVCA 3EJDA 3B4QA 1GXHA 5F2OA 1YITP 4NEOA 2EFJA 2KW2A 2E1MA 2N50A 3DS5A 3DTJA 3CCLP 1KC8Q 1Q82Q 4XFZA 2N5HA 1VHNA 1Q86Q 2VSQA 2KGDA 2K0YA 3G28A 1UNKA 1OR5A 2K0XA 3LMOA 1HQBA 2XV6A 4XFYA 2JGPA 4UHPB 2JYGA 2LMLA 3DS3A 4H2YC 2FAEA 4M0IA 3G29A 2AVAA 1VQ7P 1W2BO 1GPJA 1Q7YQ 2L6EA 5HV8A 1IMPA 2KGCA 3HYBA 3G26A 5KP6B 3CCMP 2M8NA 1QRJA 1K9MQ 2OARA 1EIAA 4DG9A 2MF4A 3H47A 3DS0A 2FQ1A 1KLPA 3LRYA 1L0HA 1UJZA 2K92A 4F37A 1ACPA 3I56P 3B5IA 2FHSC 4QNBA 1VQKP 2LPKA 2OTJP 3CPWO 2GZIA 2K5XA 1YJWP 2GZGA 1T8KA 5F2NA 4PWVB 2QEXP 2JYLA 4R0MA 2K94A 2KOSA 5EJDA 3G0VA 1S72P 1VQMP 1GXGA 5HGNA 1YHQP 1N8RQ 1EMVA 2JQ4A 2X2BA 3CCRP 2LF4A 2JU2A 5HGMA 1M6NA 1M74A 2K2QA 2FACA 2CQ8A 2JBGA 2K93A 2ONTA 3U43A 2GZFA 2M8LA 3P05A 2PY8A 4IPYA 1HY8A 2Z44A 2PEQA 1E6JP 2MVVA 4BPHA 5BS2A 1VQ5P
chains in the Genus database with same CATH topology
1AYIA 2WPTA 2GZGA 5EW5E 2VLOA 3GJNA 2VLPA 2JBGA 2JB0A 2K5XA 2ERHA 1UJZA 3U43A 1MZ8A 2GZFA 4F37A 4QKOA 2VLQA 2GZJA 2NO8A 1BXIA 1E0HA 1IMPA 1GXGA 1ZNVA 3GKLC 1EMVA 1UNKA 1GXHA 7CEIA 1CEIA 1IMQA 2K0DX 2GYKA 2GZIA 2JAZA 4UHPB 1FR2A 2GZEA 2VLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AYI A;  2WPT A;  2GZG A;  5EW5 E;  2VLO A;  3GJN A;  2VLP A;  2JBG A;  2JB0 A;  2K5X A;  2ERH A;  1UJZ A;  3U43 A;  1MZ8 A;  2GZF A;  4F37 A;  4QKO A;  2VLQ A;  2GZJ A;  2NO8 A;  1BXI A;  1E0H A;  1IMP A;  1GXG A;  1ZNV A;  3GKL C;  1EMV A;  1UNK A;  1GXH A;  7CEI A;  1CEI A;  1IMQ A;  2K0D X;  2GYK A;  2GZI A;  2JAZ A;  4UHP B;  1FR2 A;  2GZE A;  2VLN A; 
#chains in the Genus database with same CATH topology
 1D1D A;  4XRQ A;  2BHV A;  3H4E A;  2EHT A;  2KG9 A;  5KP8 B;  3RG2 A;  4U0B A;  1E0H A;  2L9F A;  2JO0 A;  2PEN A;  5BS1 A;  3OW2 O;  1VQ4 P;  2DNW A;  3CD6 P;  1AUM A;  5I4T G;  1L0I A;  2EHS A;  2N98 A;  2Z45 A;  3I55 P;  1A8O A;  3CME P;  2KR5 A;  2XXM A;  1VQ9 P;  1BAJ A;  4GR6 A;  2PEO A;  2FAD A;  3GZM A;  2L0Q A;  1AF8 A;  1Q81 Q;  2VLP A;  1K30 A;  1A43 A;  2PEI A;  4COC A;  2EIA A;  4XFX A;  1QVF O;  7CEI A;  2XZ1 C;  3EJB A;  2AFE A;  3G6E P;  2MR7 A;  1NJI Q;  1FR2 A;  1KD1 Q;  2KWL A;  2LTE A;  3CCE P;  3G1I A;  4BPF A;  4H2X C;  2PEJ A;  4GR2 A;  3E2D A;  2KOP A;  2FQ0 A;  3GKL C;  2CWO A;  2KOO A;  1VQP P;  4CA3 A;  2N6Z A;  3CE7 A;  5DCK A;  2VLN A;  2MY5 A;  2L4B A;  1ZMB A;  1YI2 P;  3CMA P;  4COP A;  2JB0 A;  4BPG A;  4H2W C;  3CC7 P;  2QNW A;  3M1M A;  2FQ2 A;  2KOQ A;  3CC2 P;  3CC4 P;  2PNG A;  4PH0 A;  2N5I A;  2GYK A;  2ROQ A;  1VQ8 P;  3G1G A;  4WYM A;  2GDW A;  5EW5 E;  3NY7 B;  2QA4 P;  2LIW A;  2VLQ A;  2KGA A;  2Z46 A;  1VQ6 P;  3Q20 A;  3G71 P;  3CCJ P;  5JPA A;  1VQL P;  2CGQ A;  3DPH A;  3DS2 A;  1Z6M A;  1YIJ P;  4QKO A;  3G4S P;  3CCV P;  3CXC O;  2P9X A;  2FVA A;  3RG6 C;  1KQS O;  2GDY A;  2K0D X;  2AF8 A;  1VQO P;  2EG5 A;  2KGE A;  2WPT A;  1F80 D;  2LOL A;  1M90 Q;  1K8A Q;  3G21 A;  3GJN A;  1K73 Q;  4U0D A;  3CCS P;  1EOQ A;  5KP7 B;  2LL8 A;  4HKG A;  3CCU P;  2PEM A;  2GZJ A;  1VKU A;  2KOD A;  1X3O A;  3DS4 A;  2JU1 A;  1NQ4 A;  2JAZ A;  2M5R A;  2FVE A;  1M1K Q;  2XZ0 D;  1IUQ A;  3MGE A;  2MR8 A;  1BXI A;  3EJE A;  5CZD B;  1RO2 A;  1CEI A;  2KG6 A;  1YJN P;  4PXH B;  4MRT C;  1QVG O;  3GZL A;  2GZE A;  1AYI A;  2VLO A;  1YJ9 P;  2LKI A;  1JJ2 O;  2KOR A;  4U0A A;  3H0D A;  4PH1 A;  2ERH A;  3DS1 A;  2KG8 A;  2NO8 A;  3HZQ A;  2MD9 A;  1VQN P;  2CG5 B;  4U0F A;  4U0E A;  1DV5 A;  5F2K A;  2L22 A;  2BUO A;  2AFD A;  1RNI A;  1IMQ A;  4XRO A;  2MVU A;  2PEK A;  2FVF A;  3VRL C;  2OTL P;  2N6Y A;  5HGL A;  4IZ6 A;  1DNY A;  3CCQ P;  5HGO A;  2LIU A;  2CNR A;  1RO0 A;  3NTE A;  1M6E X;  1MZ8 A;  2M8P A;  2GDX A;  3WBH A;  2XT1 A;  1ZNV A;  2DGY A;  4U0C A;  5HVC A;  3EJD A;  3B4Q A;  1GXH A;  5F2O A;  1YIT P;  4NEO A;  2EFJ A;  2KW2 A;  2E1M A;  2N50 A;  3DS5 A;  3DTJ A;  3CCL P;  1KC8 Q;  1Q82 Q;  4XFZ A;  2N5H A;  1VHN A;  1Q86 Q;  2VSQ A;  2KGD A;  2K0Y A;  3G28 A;  1UNK A;  1OR5 A;  2K0X A;  3LMO A;  1HQB A;  2XV6 A;  4XFY A;  2JGP A;  4UHP B;  2JYG A;  2LML A;  3DS3 A;  4H2Y C;  2FAE A;  4M0I A;  3G29 A;  2AVA A;  1VQ7 P;  1W2B O;  1GPJ A;  1Q7Y Q;  2L6E A;  5HV8 A;  1IMP A;  2KGC A;  3HYB A;  3G26 A;  5KP6 B;  3CCM P;  2M8N A;  1QRJ A;  1K9M Q;  2OAR A;  1EIA A;  4DG9 A;  2MF4 A;  3H47 A;  3DS0 A;  2FQ1 A;  1KLP A;  3LRY A;  1L0H A;  1UJZ A;  2K92 A;  4F37 A;  1ACP A;  3I56 P;  3B5I A;  2FHS C;  4QNB A;  1VQK P;  2LPK A;  2OTJ P;  3CPW O;  2GZI A;  2K5X A;  1YJW P;  2GZG A;  1T8K A;  5F2N A;  4PWV B;  2QEX P;  2JYL A;  4R0M A;  2K94 A;  2KOS A;  5EJD A;  3G0V A;  1S72 P;  1VQM P;  1GXG A;  5HGN A;  1YHQ P;  1N8R Q;  1EMV A;  2JQ4 A;  2X2B A;  3CCR P;  2LF4 A;  2JU2 A;  5HGM A;  1M6N A;  1M74 A;  2K2Q A;  2FAC A;  2CQ8 A;  2JBG A;  2K93 A;  2ONT A;  3U43 A;  2GZF A;  2M8L A;  3P05 A;  2PY8 A;  4IPY A;  1HY8 A;  2Z44 A;  2PEQ A;  1E6J P;  2MVV A;  4BPH A;  5BS2 A;  1VQ5 P; 
#chains in the Genus database with same CATH homology
 1AYI A;  2WPT A;  2GZG A;  5EW5 E;  2VLO A;  3GJN A;  2VLP A;  2JBG A;  2JB0 A;  2K5X A;  2ERH A;  1UJZ A;  3U43 A;  1MZ8 A;  2GZF A;  4F37 A;  4QKO A;  2VLQ A;  2GZJ A;  2NO8 A;  1BXI A;  1E0H A;  1IMP A;  1GXG A;  1ZNV A;  3GKL C;  1EMV A;  1UNK A;  1GXH A;  7CEI A;  1CEI A;  1IMQ A;  2K0D X;  2GYK A;  2GZI A;  2JAZ A;  4UHP B;  1FR2 A;  2GZE A;  2VLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...