2JBGA

Crystal structure of the mutant n560a of the nuclease domain of cole7 in complex with im7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
86
structure length
86
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN-E7 IMMUNITY PROTEIN
publication title The Conserved Asparagine in the Hnh Motif Serves an Important Structural Role in Metal Finger Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
total genus 28
structure length 86
sequence length 86
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2jbgA00
1BXIA 1FR2A 2GZEA 1UNKA 3GJNA 4F37A 7CEIA 2JBGA 2VLPA 4QKOA 2GZIA 1MZ8A 1ZNVA 2GYKA 3U43A 2ERHA 2K0DX 1IMPA 4UHPB 1IMQA 2VLOA 2NO8A 2GZGA 2VLNA 2GZFA 2VLQA 2JAZA 3GKLC 2K5XA 1EMVA 1UJZA 2GZJA 2JB0A 1GXGA 5EW5E 1CEIA 1AYIA 1GXHA 2WPTA 1E0HA
chains in the Genus database with same CATH superfamily
1FR2A 2FAEA 5F2NA 3CCEP 2VLPA 2QEXP 2MD9A 1IMQA 1Q86Q 2PEQA 2EHTA 1ACPA 2KOPA 3RG2A 2GDXA 2FQ2A 2ROQA 1K8AQ 2XT1A 2PNGA 4U0BA 4U0EA 3B5IA 2LMLA 4IPYA 2OTLP 1IMPA 3I56P 2M5RA 3E2DA 1VKUA 2XZ1C 2LKIA 1RO2A 2KGCA 2N5IA 3CCUP 2KOQA 1A8OA 2PY8A 1DNYA 2K93A 1QVFO 2KW2A 3Q20A 4BPGA 3CCVP 1UNKA 1L0IA 3M1MA 2XZ0D 3G1IA 1VQMP 2ERHA 2N5HA 1M1KQ 4BPHA 1Z6MA 5HGLA 2MVVA 5HGOA 3EJEA 1AUMA 1VQ9P 4XFZA 2DGYA 5JPAA 3G21A 4DG9A 2FVFA 2MY5A 5BS1A 2LIWA 2OTJP 1YJNP 1VQNP 2N6YA 1N8RQ 2JO0A 2P9XA 2K94A 2DNWA 1VQ7P 4U0FA 1YJWP 5KP7B 2JAZA 1M6EX 3CCSP 2K5XA 2K92A 4GR2A 1CEIA 2LF4A 2JYLA 2WPTA 2KORA 2CGQA 2MR8A 4F37A 2QNWA 4WYMA 5HVCA 4U0DA 2QA4P 5EJDA 2K2QA 1IUQA 2KODA 2E1MA 1QRJA 5KP6B 4IZ6A 3HYBA 4H2XC 3CPWO 3CD6P 2GZJA 2GDWA 3G29A 1YITP 2EG5A 2FHSC 4XFYA 2LL8A 1GPJA 1YI2P 3DTJA 3H0DA 1YHQP 3H4EA 5I4TG 3DPHA 1EMVA 3DS3A 2PENA 2CWOA 2EFJA 1S72P 2FACA 2CG5B 1VQ5P 3DS1A 2JYGA 2FQ1A 1E6JP 2MVUA 2OARA 1KD1Q 1W2BO 3DS0A 2Z45A 1K30A 3EJDA 1JJ2O 1VQPP 2ONTA 1VQOP 2Z44A 3H47A 4MRTC 3GZLA 1RO0A 4XFXA 3G4SP 1GXGA 5CZDB 1GXHA 1E0HA 2KOSA 1HY8A 3CMAP 4CA3A 3DS2A 1MZ8A 2GZIA 1ZNVA 3MGEA 2M8LA 3CCJP 4UHPB 1K73Q 2GZGA 2L22A 3HZQA 2AF8A 3G26A 4GR6A 2EIAA 2PEJA 4PWVB 2VSQA 1K9MQ 2LOLA 2GYKA 1T8KA 2NO8A 2BHVA 2M8PA 3GKLC 3CCRP 1UJZA 2PEMA 4NEOA 3GZMA 1BXIA 3LRYA 2XV6A 2JGPA 3B4QA 1NQ4A 2XXMA 3CE7A 2BUOA 2FQ0A 3CMEP 2M8NA 3EJBA 2L6EA 1A43A 2KGAA 2JB0A 1YJ9P 4HKGA 4XRQA 2CNRA 4U0CA 1Q7YQ 4H2WC 1VQKP 1YIJP 3CCMP 4QKOA 2LIUA 2X2BA 3NTEA 2JU2A 5KP8B 3WBHA 1RNIA 2GZFA 4R0MA 1NJIQ 1VQ4P 1QVGO 3NY7B 2Z46A 2GDYA 3CCLP 1EIAA 4U0AA 5EW5E 3G6EP 3LMOA 2FADA 2FVAA 4COCA 1HQBA 3G0VA 5HV8A 2L4BA 2JBGA 3DS5A 2K0DX 2N6ZA 2N98A 4BPFA 3G1GA 2MR7A 1F80D 3I55P 3P05A 2AFDA 5F2OA 1DV5A 4M0IA 2LTEA 4PH1A 2KOOA 2JU1A 2KGDA 2N50A 4XROA 2KG6A 2KG8A 1X3OA 2KG9A 2LPKA 3G71P 1Q82Q 1M90Q 2KGEA 4H2YC 1AYIA 1D1DA 3CC7P 5DCKA 1KQSO 1EOQA 2GZEA 2KWLA 7CEIA 3RG6C 3U43A 1OR5A 5F2KA 2VLNA 1ZMBA 1VHNA 3CXCO 1VQLP 2PEIA 1KLPA 4COPA 2CQ8A 1VQ8P 3CC2P 1BAJA 4PH0A 3GJNA 5HGNA 2L9FA 3CCQP 2FVEA 1VQ6P 2EHSA 5HGMA 2L0QA 4QNBA 2KR5A 2PEOA 4PXHB 2VLQA 1Q81Q 2AFEA 3G28A 2JQ4A 5BS2A 1KC8Q 3OW2O 2AVAA 1M74A 3VRLC 2VLOA 3DS4A 1M6NA 2K0YA 1AF8A 2MF4A 3CC4P 2K0XA 1L0HA 2PEKA
chains in the Genus database with same CATH topology
1BXIA 1FR2A 2GZEA 1UNKA 3GJNA 4F37A 7CEIA 2JBGA 2VLPA 4QKOA 2GZIA 1MZ8A 1ZNVA 2GYKA 3U43A 2ERHA 2K0DX 1IMPA 4UHPB 1IMQA 2VLOA 2NO8A 2GZGA 2VLNA 2GZFA 2VLQA 2JAZA 3GKLC 2K5XA 1EMVA 1UJZA 2GZJA 2JB0A 1GXGA 5EW5E 1CEIA 1AYIA 1GXHA 2WPTA 1E0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BXI A;  1FR2 A;  2GZE A;  1UNK A;  3GJN A;  4F37 A;  7CEI A;  2JBG A;  2VLP A;  4QKO A;  2GZI A;  1MZ8 A;  1ZNV A;  2GYK A;  3U43 A;  2ERH A;  2K0D X;  1IMP A;  4UHP B;  1IMQ A;  2VLO A;  2NO8 A;  2GZG A;  2VLN A;  2GZF A;  2VLQ A;  2JAZ A;  3GKL C;  2K5X A;  1EMV A;  1UJZ A;  2GZJ A;  2JB0 A;  1GXG A;  5EW5 E;  1CEI A;  1AYI A;  1GXH A;  2WPT A;  1E0H A; 
#chains in the Genus database with same CATH topology
 1FR2 A;  2FAE A;  5F2N A;  3CCE P;  2VLP A;  2QEX P;  2MD9 A;  1IMQ A;  1Q86 Q;  2PEQ A;  2EHT A;  1ACP A;  2KOP A;  3RG2 A;  2GDX A;  2FQ2 A;  2ROQ A;  1K8A Q;  2XT1 A;  2PNG A;  4U0B A;  4U0E A;  3B5I A;  2LML A;  4IPY A;  2OTL P;  1IMP A;  3I56 P;  2M5R A;  3E2D A;  1VKU A;  2XZ1 C;  2LKI A;  1RO2 A;  2KGC A;  2N5I A;  3CCU P;  2KOQ A;  1A8O A;  2PY8 A;  1DNY A;  2K93 A;  1QVF O;  2KW2 A;  3Q20 A;  4BPG A;  3CCV P;  1UNK A;  1L0I A;  3M1M A;  2XZ0 D;  3G1I A;  1VQM P;  2ERH A;  2N5H A;  1M1K Q;  4BPH A;  1Z6M A;  5HGL A;  2MVV A;  5HGO A;  3EJE A;  1AUM A;  1VQ9 P;  4XFZ A;  2DGY A;  5JPA A;  3G21 A;  4DG9 A;  2FVF A;  2MY5 A;  5BS1 A;  2LIW A;  2OTJ P;  1YJN P;  1VQN P;  2N6Y A;  1N8R Q;  2JO0 A;  2P9X A;  2K94 A;  2DNW A;  1VQ7 P;  4U0F A;  1YJW P;  5KP7 B;  2JAZ A;  1M6E X;  3CCS P;  2K5X A;  2K92 A;  4GR2 A;  1CEI A;  2LF4 A;  2JYL A;  2WPT A;  2KOR A;  2CGQ A;  2MR8 A;  4F37 A;  2QNW A;  4WYM A;  5HVC A;  4U0D A;  2QA4 P;  5EJD A;  2K2Q A;  1IUQ A;  2KOD A;  2E1M A;  1QRJ A;  5KP6 B;  4IZ6 A;  3HYB A;  4H2X C;  3CPW O;  3CD6 P;  2GZJ A;  2GDW A;  3G29 A;  1YIT P;  2EG5 A;  2FHS C;  4XFY A;  2LL8 A;  1GPJ A;  1YI2 P;  3DTJ A;  3H0D A;  1YHQ P;  3H4E A;  5I4T G;  3DPH A;  1EMV A;  3DS3 A;  2PEN A;  2CWO A;  2EFJ A;  1S72 P;  2FAC A;  2CG5 B;  1VQ5 P;  3DS1 A;  2JYG A;  2FQ1 A;  1E6J P;  2MVU A;  2OAR A;  1KD1 Q;  1W2B O;  3DS0 A;  2Z45 A;  1K30 A;  3EJD A;  1JJ2 O;  1VQP P;  2ONT A;  1VQO P;  2Z44 A;  3H47 A;  4MRT C;  3GZL A;  1RO0 A;  4XFX A;  3G4S P;  1GXG A;  5CZD B;  1GXH A;  1E0H A;  2KOS A;  1HY8 A;  3CMA P;  4CA3 A;  3DS2 A;  1MZ8 A;  2GZI A;  1ZNV A;  3MGE A;  2M8L A;  3CCJ P;  4UHP B;  1K73 Q;  2GZG A;  2L22 A;  3HZQ A;  2AF8 A;  3G26 A;  4GR6 A;  2EIA A;  2PEJ A;  4PWV B;  2VSQ A;  1K9M Q;  2LOL A;  2GYK A;  1T8K A;  2NO8 A;  2BHV A;  2M8P A;  3GKL C;  3CCR P;  1UJZ A;  2PEM A;  4NEO A;  3GZM A;  1BXI A;  3LRY A;  2XV6 A;  2JGP A;  3B4Q A;  1NQ4 A;  2XXM A;  3CE7 A;  2BUO A;  2FQ0 A;  3CME P;  2M8N A;  3EJB A;  2L6E A;  1A43 A;  2KGA A;  2JB0 A;  1YJ9 P;  4HKG A;  4XRQ A;  2CNR A;  4U0C A;  1Q7Y Q;  4H2W C;  1VQK P;  1YIJ P;  3CCM P;  4QKO A;  2LIU A;  2X2B A;  3NTE A;  2JU2 A;  5KP8 B;  3WBH A;  1RNI A;  2GZF A;  4R0M A;  1NJI Q;  1VQ4 P;  1QVG O;  3NY7 B;  2Z46 A;  2GDY A;  3CCL P;  1EIA A;  4U0A A;  5EW5 E;  3G6E P;  3LMO A;  2FAD A;  2FVA A;  4COC A;  1HQB A;  3G0V A;  5HV8 A;  2L4B A;  2JBG A;  3DS5 A;  2K0D X;  2N6Z A;  2N98 A;  4BPF A;  3G1G A;  2MR7 A;  1F80 D;  3I55 P;  3P05 A;  2AFD A;  5F2O A;  1DV5 A;  4M0I A;  2LTE A;  4PH1 A;  2KOO A;  2JU1 A;  2KGD A;  2N50 A;  4XRO A;  2KG6 A;  2KG8 A;  1X3O A;  2KG9 A;  2LPK A;  3G71 P;  1Q82 Q;  1M90 Q;  2KGE A;  4H2Y C;  1AYI A;  1D1D A;  3CC7 P;  5DCK A;  1KQS O;  1EOQ A;  2GZE A;  2KWL A;  7CEI A;  3RG6 C;  3U43 A;  1OR5 A;  5F2K A;  2VLN A;  1ZMB A;  1VHN A;  3CXC O;  1VQL P;  2PEI A;  1KLP A;  4COP A;  2CQ8 A;  1VQ8 P;  3CC2 P;  1BAJ A;  4PH0 A;  3GJN A;  5HGN A;  2L9F A;  3CCQ P;  2FVE A;  1VQ6 P;  2EHS A;  5HGM A;  2L0Q A;  4QNB A;  2KR5 A;  2PEO A;  4PXH B;  2VLQ A;  1Q81 Q;  2AFE A;  3G28 A;  2JQ4 A;  5BS2 A;  1KC8 Q;  3OW2 O;  2AVA A;  1M74 A;  3VRL C;  2VLO A;  3DS4 A;  1M6N A;  2K0Y A;  1AF8 A;  2MF4 A;  3CC4 P;  2K0X A;  1L0H A;  2PEK A; 
#chains in the Genus database with same CATH homology
 1BXI A;  1FR2 A;  2GZE A;  1UNK A;  3GJN A;  4F37 A;  7CEI A;  2JBG A;  2VLP A;  4QKO A;  2GZI A;  1MZ8 A;  1ZNV A;  2GYK A;  3U43 A;  2ERH A;  2K0D X;  1IMP A;  4UHP B;  1IMQ A;  2VLO A;  2NO8 A;  2GZG A;  2VLN A;  2GZF A;  2VLQ A;  2JAZ A;  3GKL C;  2K5X A;  1EMV A;  1UJZ A;  2GZJ A;  2JB0 A;  1GXG A;  5EW5 E;  1CEI A;  1AYI A;  1GXH A;  2WPT A;  1E0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...