2JBGA

Crystal structure of the mutant n560a of the nuclease domain of cole7 in complex with im7
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
86
structure length
86
Chain Sequence
MELKNSISDYTEAEFVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLICIN-E7 IMMUNITY PROTEIN
publication title The Conserved Asparagine in the Hnh Motif Serves an Important Structural Role in Metal Finger Endonucleases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/inhibitor
total genus 28
structure length 86
sequence length 86
chains with identical sequence C
ec nomenclature ec 3.1.-.-:
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01320 Colicin_Pyocin Colicin immunity protein / pyocin immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.20 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Colicin E immunity protein 2jbgA00
1EMVA 1IMPA 1MZ8A 2K0DX 2VLPA 3GJNA 2JB0A 2GYKA 2GZJA 1GXGA 1BXIA 1CEIA 3GKLC 1AYIA 2VLNA 3U43A 1E0HA 4UHPB 2GZEA 2GZGA 2VLOA 2ERHA 1ZNVA 2JBGA 4F37A 7CEIA 5EW5E 1UNKA 2JAZA 1FR2A 1UJZA 1IMQA 2GZIA 2NO8A 2VLQA 2K5XA 4QKOA 2GZFA 1GXHA 2WPTA
chains in the Genus database with same CATH superfamily
2LF4A 2Z46A 1VQKP 3GJNA 2JB0A 1W2BO 2PEIA 4CA3A 2KGAA 1BAJA 4XROA 2AFDA 1YJNP 1YJWP 2FVAA 2JGPA 1FR2A 2GZIA 1IMQA 3GZMA 2KORA 2PEOA 2PEMA 2OTJP 2VLPA 2GDYA 2EG5A 3U43A 3CCVP 1RO0A 3CD6P 2CNRA 2FACA 2M5RA 3DS1A 2XZ1C 1K8AQ 2XXMA 1RO2A 3VRLC 2MVUA 1EOQA 1E6JP 2AFEA 2KOPA 1QRJA 1M74A 3RG2A 2VLNA 2M8LA 2GZEA 1VQ5P 5F2NA 7CEIA 1L0IA 5BS2A 4GR2A 2EHTA 3M1MA 3CMAP 3LRYA 4U0FA 3GKLC 4HKGA 2K94A 3G21A 3G26A 2CGQA 3CCUP 2JO0A 2DNWA 1VQNP 2K92A 3LMOA 1UJZA 1QVGO 5JPAA 2MD9A 3Q20A 4R0MA 4BPFA 2PENA 2JU1A 1M6EX 3WBHA 5KP6B 3CCMP 3G28A 2M8NA 2N6YA 3MGEA 2VLOA 2EHSA 2LOLA 3B5IA 4PH0A 2P9XA 2LIWA 2LMLA 5EJDA 2BHVA 1AYIA 4U0EA 2FADA 3OW2O 1MZ8A 5CZDB 2LIUA 5HGNA 2QNWA 4PH1A 3CC2P 1M1KQ 3HZQA 2JBGA 4PXHB 3DS5A 5F2OA 2LTEA 2LL8A 3DS0A 2KG9A 2PEKA 4GR6A 3NY7B 2DGYA 1K30A 3CCQP 2CQ8A 2AF8A 1Q81Q 1CEIA 1VQOP 1KD1Q 2KGDA 3NTEA 1YJ9P 3P05A 2MR8A 2OTLP 2FVEA 1Q7YQ 1VQPP 3HYBA 4H2YC 1KQSO 2K2QA 2N6ZA 1NJIQ 1VQMP 3CCLP 3DS3A 1K73Q 1ACPA 2Z44A 1N8RQ 1NQ4A 2MVVA 4QNBA 2L22A 1GXHA 1S72P 3EJDA 1AF8A 1IMPA 5HGOA 2FQ2A 2N5HA 2N98A 2AVAA 1X3OA 1EIAA 2KGEA 1YI2P 2GDWA 4BPHA 1A8OA 2KOOA 1T8KA 1UNKA 1M90Q 5KP7B 4NEOA 1Q82Q 2GZFA 1Z6MA 2WPTA 2OARA 1RNIA 2KWLA 1Q86Q 5KP8B 3I55P 3CCJP 4WYMA 2QA4P 3DS4A 4XRQA 4H2WC 3CC4P 2KOQA 1K9MQ 3G29A 4MRTC 3CCRP 4U0DA 3E2DA 2N5IA 3G1GA 2JQ4A 2JU2A 2XT1A 3RG6C 2NO8A 2BUOA 2FQ0A 4COCA 1A43A 1IUQA 1EMVA 2GYKA 2PY8A 1GXGA 1BXIA 2EIAA 5HGMA 2FQ1A 2PEJA 3B4QA 4U0CA 2Z45A 2M8PA 2L4BA 2X2BA 3DPHA 3H47A 2KOSA 2VSQA 1VHNA 4U0AA 3CCEP 1YITP 5F2KA 4M0IA 3CCSP 2KG6A 4F37A 2FAEA 4XFXA 1YIJP 2K0XA 5I4TG 1GPJA 3DS2A 1F80D 2LPKA 2E1MA 1VKUA 4COPA 4UHPB 2KGCA 2KW2A 2GZGA 2FHSC 3DTJA 2ERHA 1VQ9P 4DG9A 2JYLA 2KR5A 2L6EA 2JAZA 1KLPA 1KC8Q 1HQBA 1JJ2O 1VQ6P 2KODA 4BPGA 1QVFO 2K93A 2QEXP 1E0HA 1VQ8P 3H0DA 3EJEA 1VQ4P 5EW5E 2CWOA 5HV8A 2XV6A 3GZLA 2FVFA 3CPWO 2K0DX 3G6EP 2GDXA 1VQ7P 5BS1A 3I56P 1HY8A 1D1DA 3CE7A 2N50A 4PWVB 1DNYA 2CG5B 4XFYA 5HVCA 2ROQA 4QKOA 2ONTA 2MY5A 1M6NA 1L0HA 4H2XC 4U0BA 2PNGA 4XFZA 3CMEP 1AUMA 3CC7P 1YHQP 2GZJA 3G0VA 2MF4A 4IPYA 3G71P 1OR5A 3G4SP 1VQLP 2L9FA 2PEQA 3EJBA 5DCKA 2XZ0D 2EFJA 2JYGA 1ZNVA 5HGLA 2MR7A 3CXCO 2LKIA 3G1IA 2VLQA 2KG8A 4IZ6A 2K5XA 1ZMBA 2K0YA 3H4EA 1DV5A 2L0QA
chains in the Genus database with same CATH topology
1EMVA 1IMPA 1MZ8A 2K0DX 2VLPA 3GJNA 2JB0A 2GYKA 2GZJA 1GXGA 1BXIA 1CEIA 3GKLC 1AYIA 2VLNA 3U43A 1E0HA 4UHPB 2GZEA 2GZGA 2VLOA 2ERHA 1ZNVA 2JBGA 4F37A 7CEIA 5EW5E 1UNKA 2JAZA 1FR2A 1UJZA 1IMQA 2GZIA 2NO8A 2VLQA 2K5XA 4QKOA 2GZFA 1GXHA 2WPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EMV A;  1IMP A;  1MZ8 A;  2K0D X;  2VLP A;  3GJN A;  2JB0 A;  2GYK A;  2GZJ A;  1GXG A;  1BXI A;  1CEI A;  3GKL C;  1AYI A;  2VLN A;  3U43 A;  1E0H A;  4UHP B;  2GZE A;  2GZG A;  2VLO A;  2ERH A;  1ZNV A;  2JBG A;  4F37 A;  7CEI A;  5EW5 E;  1UNK A;  2JAZ A;  1FR2 A;  1UJZ A;  1IMQ A;  2GZI A;  2NO8 A;  2VLQ A;  2K5X A;  4QKO A;  2GZF A;  1GXH A;  2WPT A; 
#chains in the Genus database with same CATH topology
 2LF4 A;  2Z46 A;  1VQK P;  3GJN A;  2JB0 A;  1W2B O;  2PEI A;  4CA3 A;  2KGA A;  1BAJ A;  4XRO A;  2AFD A;  1YJN P;  1YJW P;  2FVA A;  2JGP A;  1FR2 A;  2GZI A;  1IMQ A;  3GZM A;  2KOR A;  2PEO A;  2PEM A;  2OTJ P;  2VLP A;  2GDY A;  2EG5 A;  3U43 A;  3CCV P;  1RO0 A;  3CD6 P;  2CNR A;  2FAC A;  2M5R A;  3DS1 A;  2XZ1 C;  1K8A Q;  2XXM A;  1RO2 A;  3VRL C;  2MVU A;  1EOQ A;  1E6J P;  2AFE A;  2KOP A;  1QRJ A;  1M74 A;  3RG2 A;  2VLN A;  2M8L A;  2GZE A;  1VQ5 P;  5F2N A;  7CEI A;  1L0I A;  5BS2 A;  4GR2 A;  2EHT A;  3M1M A;  3CMA P;  3LRY A;  4U0F A;  3GKL C;  4HKG A;  2K94 A;  3G21 A;  3G26 A;  2CGQ A;  3CCU P;  2JO0 A;  2DNW A;  1VQN P;  2K92 A;  3LMO A;  1UJZ A;  1QVG O;  5JPA A;  2MD9 A;  3Q20 A;  4R0M A;  4BPF A;  2PEN A;  2JU1 A;  1M6E X;  3WBH A;  5KP6 B;  3CCM P;  3G28 A;  2M8N A;  2N6Y A;  3MGE A;  2VLO A;  2EHS A;  2LOL A;  3B5I A;  4PH0 A;  2P9X A;  2LIW A;  2LML A;  5EJD A;  2BHV A;  1AYI A;  4U0E A;  2FAD A;  3OW2 O;  1MZ8 A;  5CZD B;  2LIU A;  5HGN A;  2QNW A;  4PH1 A;  3CC2 P;  1M1K Q;  3HZQ A;  2JBG A;  4PXH B;  3DS5 A;  5F2O A;  2LTE A;  2LL8 A;  3DS0 A;  2KG9 A;  2PEK A;  4GR6 A;  3NY7 B;  2DGY A;  1K30 A;  3CCQ P;  2CQ8 A;  2AF8 A;  1Q81 Q;  1CEI A;  1VQO P;  1KD1 Q;  2KGD A;  3NTE A;  1YJ9 P;  3P05 A;  2MR8 A;  2OTL P;  2FVE A;  1Q7Y Q;  1VQP P;  3HYB A;  4H2Y C;  1KQS O;  2K2Q A;  2N6Z A;  1NJI Q;  1VQM P;  3CCL P;  3DS3 A;  1K73 Q;  1ACP A;  2Z44 A;  1N8R Q;  1NQ4 A;  2MVV A;  4QNB A;  2L22 A;  1GXH A;  1S72 P;  3EJD A;  1AF8 A;  1IMP A;  5HGO A;  2FQ2 A;  2N5H A;  2N98 A;  2AVA A;  1X3O A;  1EIA A;  2KGE A;  1YI2 P;  2GDW A;  4BPH A;  1A8O A;  2KOO A;  1T8K A;  1UNK A;  1M90 Q;  5KP7 B;  4NEO A;  1Q82 Q;  2GZF A;  1Z6M A;  2WPT A;  2OAR A;  1RNI A;  2KWL A;  1Q86 Q;  5KP8 B;  3I55 P;  3CCJ P;  4WYM A;  2QA4 P;  3DS4 A;  4XRQ A;  4H2W C;  3CC4 P;  2KOQ A;  1K9M Q;  3G29 A;  4MRT C;  3CCR P;  4U0D A;  3E2D A;  2N5I A;  3G1G A;  2JQ4 A;  2JU2 A;  2XT1 A;  3RG6 C;  2NO8 A;  2BUO A;  2FQ0 A;  4COC A;  1A43 A;  1IUQ A;  1EMV A;  2GYK A;  2PY8 A;  1GXG A;  1BXI A;  2EIA A;  5HGM A;  2FQ1 A;  2PEJ A;  3B4Q A;  4U0C A;  2Z45 A;  2M8P A;  2L4B A;  2X2B A;  3DPH A;  3H47 A;  2KOS A;  2VSQ A;  1VHN A;  4U0A A;  3CCE P;  1YIT P;  5F2K A;  4M0I A;  3CCS P;  2KG6 A;  4F37 A;  2FAE A;  4XFX A;  1YIJ P;  2K0X A;  5I4T G;  1GPJ A;  3DS2 A;  1F80 D;  2LPK A;  2E1M A;  1VKU A;  4COP A;  4UHP B;  2KGC A;  2KW2 A;  2GZG A;  2FHS C;  3DTJ A;  2ERH A;  1VQ9 P;  4DG9 A;  2JYL A;  2KR5 A;  2L6E A;  2JAZ A;  1KLP A;  1KC8 Q;  1HQB A;  1JJ2 O;  1VQ6 P;  2KOD A;  4BPG A;  1QVF O;  2K93 A;  2QEX P;  1E0H A;  1VQ8 P;  3H0D A;  3EJE A;  1VQ4 P;  5EW5 E;  2CWO A;  5HV8 A;  2XV6 A;  3GZL A;  2FVF A;  3CPW O;  2K0D X;  3G6E P;  2GDX A;  1VQ7 P;  5BS1 A;  3I56 P;  1HY8 A;  1D1D A;  3CE7 A;  2N50 A;  4PWV B;  1DNY A;  2CG5 B;  4XFY A;  5HVC A;  2ROQ A;  4QKO A;  2ONT A;  2MY5 A;  1M6N A;  1L0H A;  4H2X C;  4U0B A;  2PNG A;  4XFZ A;  3CME P;  1AUM A;  3CC7 P;  1YHQ P;  2GZJ A;  3G0V A;  2MF4 A;  4IPY A;  3G71 P;  1OR5 A;  3G4S P;  1VQL P;  2L9F A;  2PEQ A;  3EJB A;  5DCK A;  2XZ0 D;  2EFJ A;  2JYG A;  1ZNV A;  5HGL A;  2MR7 A;  3CXC O;  2LKI A;  3G1I A;  2VLQ A;  2KG8 A;  4IZ6 A;  2K5X A;  1ZMB A;  2K0Y A;  3H4E A;  1DV5 A;  2L0Q A; 
#chains in the Genus database with same CATH homology
 1EMV A;  1IMP A;  1MZ8 A;  2K0D X;  2VLP A;  3GJN A;  2JB0 A;  2GYK A;  2GZJ A;  1GXG A;  1BXI A;  1CEI A;  3GKL C;  1AYI A;  2VLN A;  3U43 A;  1E0H A;  4UHP B;  2GZE A;  2GZG A;  2VLO A;  2ERH A;  1ZNV A;  2JBG A;  4F37 A;  7CEI A;  5EW5 E;  1UNK A;  2JAZ A;  1FR2 A;  1UJZ A;  1IMQ A;  2GZI A;  2NO8 A;  2VLQ A;  2K5X A;  4QKO A;  2GZF A;  1GXH A;  2WPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...