1N8RQ

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1n8rQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1n8rQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1n8rQ03
1VQNP 3I56P 3CCVP 3G71P 1Q81Q 1YITP 1VQ4P 1K73Q 2OTJP 1YIJP 1NJIQ 3CCSP 1VQKP 1VQOP 1YI2P 1VQ7P 1QVGO 1M90Q 3CCRP 1S72P 1VQ9P 1QVFO 1JJ2O 1VQPP 1VQ8P 1VQMP 1YJNP 3CD6P 3CCMP 2QA4P 3CCEP 1KD1Q 1KQSO 3G4SP 1KC8Q 1VQ5P 1YJ9P 1VQLP 3CPWO 3CCJP 3CXCO 3CCQP 1Q7YQ 3CMEP 1YHQP 1W2BO 1Q82Q 1Q86Q 1M1KQ 3CC7P 1VQ6P 1K8AQ 3CC2P 2OTLP 1YJWP 3OW2O 3CCLP 3I55P 3G6EP 2QEXP 3CMAP 1K9MQ 3CCUP 3CC4P 1N8RQ
chains in the Genus database with same CATH superfamily
2AEMA 4H2YC 2YXQB 1L0NK 3WUUA 1CI6B 1NYHA 1GK4A 1K04A 1KTMA 2LKIA 1NAFA 3RK2D 4D6TD 1JMMA 1VF5D 3FWNA 2HR3A 1JMBA 4W80A 1S9KE 2KORA 1LGHB 2NZ2A 1KV4A 2RH0A 3CCUP 2FQ0A 1KB9E 4XA4A 2KZJA 5KAFH 1JY2P 2Z46A 1E79H 1SQBD 2E76D 3HUSB 3CWBG 4Y99C 4DT0A 1KFNA 1EQ7A 2PP6A 3RG2A 3SWKA 4F37A 1WT6A 1N86A 1IUQA 3N4XA 3QH9A 2XNDH 1EZVI 4H0LD 1IFMA 2WPQA 4DZOA 2GDXA 2C9NY 3L71E 1T3UA 4O9BA 1HY8A 1FZCB 1GPJA 1BGYE 3CXHH 4Y28J 2N50A 1L2PA 4BPHA 1NTKJ 3V2QA 1H0TB 3RK3E 1ACPA 2JP3A 3EQ2A 2EG5A 3H32B 4RO0A 1P84E 2QRXA 2KW2A 2HYNA 1YTZT 4PD4H 1BCCJ 2CPBA 2L6EA 4GIFA 3Q5RA 1M1JA 1KQGB 1NU1E 3VRLC 2I8DA 1DIPA 2POHA 4U0DA 1LP1A 3H1HJ 1M6EX 2OYHA 3A7OA 4PXHB 1S72P 2E75B 1DEBA 3B5NA 4R4MA 1OIPA 5CBNA 3IR9A 1J1EC 2YO2A 1ZXGA 2YKPA 4H13B 3USSA 1NTZJ 5F2KA 2A45H 1URQD 3A0BH 3CWBD 5CCGC 4YXWH 1NTMG 5F2OA 2IBZG 1NOHA 1HTLC 1NQ4A 1EDKA 1M56D 3L73G 2K9JB 1KD1Q 3HD7A 4IFDK 3TGUG 2OYIB 1GXGA 3B8EB 1IFNA 2NPSA 4JQ0D 3G21A 4RKUJ 3G6EP 1ZNVA 2H88C 5CCHC 5KLVE 4U0CA 3AE8C 3U1CA 2VLPA 1J2JB 1L0LE 3F89A 3CX5E 2WPVB 1VQ5P 1L0NG 4W7YA 5AVRB 3SFEC 1X3OA 4U0FA 4RESB 3RG6C 1MKMA 1SFCC 3EFGA 2N1TD 2ITAA 2BCCG 3WU2H 3D70A 1YIJP 1NU1J 1E0HA 2M8PA 1Y8AA 2H89C 5APUA 1SP4A 1CEIA 1K05A 1L0IA 2J59M 3GHGB 2QE7H 5I4TG 1KFMA 4BRYA 4ZKUA 1S2EA 1OW7A 5H2FE 3SSUA 3T97B 1LWUB 3H1IJ 3JSVC 2B89A 2AFEA 1N7SA 3DS4A 4H44D 1VQ7P 3LIDA 4EOTA 1SVFA 3GF7A 5CCHD 2XZRA 4GT1A 4W7ZA 2E74B 4PD4I 1AJYA 2Y0DA 3CI9A 2KS1A 2JJLA 2VSQA 1UJZA 2CK3H 2ZYGA 4C7NA 1NTMD 2IBZD 1NTKK 2L5GB 2PEIA 1PIXA 3L73D 2MY5A 3RK2B 2FVAA 4HH2A 1QL2A 3TGUD 1PEUA 1YQ3C 1EMVA 1SQQJ 5AW2B 4UB8E 3HRNA 1DEEG 1L0LJ 1EZVG 2WSFJ 3HE4B 1NGMB 1QGKB 5KJ7A 3BCCG 3KDPB 1PP9E 5EJDA 2E76B 1F80D 2W83C 1L0ND 1CZQA 1FU1A 3L72J 3DS1A 1HH0A 2BCCD 2ROQA 3H47A 3H6PA 1Z56A 2AEJA 2H8PD 1N8RQ 1IO4A 2KIKA 1AF8A 1JY3O 4OH8B 2GZGA 1NTZK 3O6QA 1OW8A 3P8CD 1OVVA 1UIXA 4NPFX 2L22A 3JCUE 2WSSH 2WVRA 1BSHA 2OTKE 4LC1A 2GYKA 1PPJE 4WY4A 2K9YA 5B5EE 1T2KC 1PGJA 2MR7A 4GR2A 1AA0A 2IZ0A 1H88A 1WMKA 2FYUJ 3CCSP 4XROA 3W67A 4M3LA 3W68A 1EZVD 5KKZB 1ZP0C 1GZLA 1NU1K 3HD7C 2L9FA 3D6YA 1RE4A 3LW5H 2B88A 3BCCD 2NPSC 1RF1A 7CEIA 1QX8A 1FZGA 3DS5A 1URQB 2XV6A 2KGAA 1Q81Q 2W8ZA 4WYMA 4UB6H 1NH4A 2QNWA 2P58A 1FR2A 4CA3A 2ZJSE 1SQVJ 2A06E 1QL1A 3B5ND 1ZOYC 2GZIA 5M1BA 5APTA 1YYCA 3FGAD 4L75A 2JO0A 3OA7A 4EIJA 2OTJP 2VLOA 2E5YA 2V4HA 3H1JE 2Q5UA 4IPYA 2KOOA 3H1LJ 2XZ0D 4KT0J 5HGMA 2FHSC 4WVZA 5AW7B 1OXZA 2KI7B 5DCKA 2KOSA 3MHVA 1NTKG 2UWJE 2FYNB 1SQQK 5BVZA 5AVZB 2N1TB 5KLVK 2GDYA 2M5RA 4RJTA 2ZXXA 5AW1B 2KZIA 4OVNF 1L0LK 2JDIH 1H89A 1JCDA 2OARA 3PRJA 3VN0A 3DTJA 1N7SC 2LXBA 5TISE 3V4QA 1FJPA 2DW3A 5HV8A 3LRYA 1BCCG 5K5GB 2M0BA 3CCMP 2BEZF 3FX0A 2FQ1A 1RHZB 2HODA 1GW3A 1L0HA 3JC22 1AQ5A 2XKMA 2LTEA 4OGQB 2N5HA 3H1HG 2FKWB 1M6NA 2EHTA 2O1KA 4H44B 2GM4A 5BS2A 4N3YB 2CQ8A 1CSBA 1ZRTE 5AW0B 3H1KJ 2KOPA 4I7ZC 2K1AA 1MZ9A 3IFMA 2KGEA 3IF4A 2KLUA 2FADA 4UHPB 1NTZG 5L8RJ 2FYZA 2GUSA 5KJ7C 5KAIH 1JM0A 4IOIH 3B71A 1FZAA 3MZWB 1ZR4A 2DNWA 1S5LH 2KNCA 3M1MA 3AEFC 1XTCC 5AW3B 4BWNA 1VQPP 3GMAA 1JB0J 3H1JJ 1MFTA 1N7SD 5EFWB 2WZ7A 2BEQD 1N2DC 1LTSC 4GODA 2LMLA 2G8YA 1JY2O 1S4XA 2Q9IA 3U1AA 5KLIC 3I5CA 2M5AA 2K94A 4XRQA 2YMYA 1SQPE 1NTKD 4ZNCA 1M90Q 2AXTE 3WUTA 1JOCA 5KAFE 1FZFA 3GZMA 5EW5E 3L4FA 3VP9A 4HKGA 3L74J 3HE5A 4PD4D 4WY4C 1NU1G 5KJ7D 1BCCD 3A0HH 3PHLA 2XU6A 3G1IA 4U0EA 1G1IA 3M9BA 1DD4A 2W6BA 3CPWO 1A8OA 3H1HD 3MD0A 2QJKB 3CC2P 4U7JA 3EJDA 1LT9A 2HPCA 3H1IG 3TF5A 3CXHE 1SQVK 2Z45A 3VMYA 1RQUA 3VMAA 1LTTC 3VMZA 3L75E 5B66H 2AXCA 1VQKP 4PV1C 3AE3C 2IZ1A 1N73A 2MVUA 1NTZD 3HTKB 2JYGA 4R0MA 2IYOA 1RE4C 2R32A 3H0DA 1JUNA 1RF1C 3P8MC 1L4AB 1Y9BA 1YQ4C 1BAJA 2W6AA 1IK9A 4IL6E 4U3FE 5HVCA 1VDFA 1FBMA 1SQQG 2FVFA 3CD6P 1L0LG 1MV8A 2FACA 4PH1A 1NWQA 2ZYDA 1ZW0A 1CW5A 1EXJA 3VYIA 1KYOE 5HGLA 1M1JB 1NO4A 1N7LA 1FZBA 1U7MA 2AF8A 5AVWB 1IZNB 2QJPB 4JPZB 2OYHB 1IFDA 3L72G 3DS3A 4D6TE 3B5NB 2LR2A 2JR8A 2OQQA 1KILB 1W2BO 1NU1D 5AW4B 2CPSA 2Q7CA 1BE3J 1HUCA 3S9OA 3PJSK 1CI6A 3TK1A 1VPCA 1M8OB 2SPZA 1T6AA 3M0DA 1SQBE 1AV1A 3H1ID 1UIIA 3AE5C 4N78E 3EJBA 2O01J 2JU2A 2FBWC 2AFDA 2FFDB 2P67A 2AEFA 3HUSA 3V2NA 3WU2E 2KG8A 4U3FJ 1R8EA 1SQXG 1GMJA 4DJGA 3Q20A 2QJYC 1HVVA 2KOQA 1KLPA 4XE5B 1KB9H 1RH5B 4R4LA 5BS1A 2FQ2A 3E2DA 1QLED 2FYUG 2M8NA 1SQQD 4WWIA 2IX7C 3SFDC 5KTBA 1L0LD 2ONTA 2PRRA 2GZJA 4KJMA 1FZCA 2IDBA 3MP7B 3L71J 3M91A 1GL2C 4NEOA 4BRYB 2E43A 4GKGA 2XZ1C 1BGYJ 2N6YA 2KYVA 3V4WA 4AUWA 2KUBA 3VMXA 3H32A 3L72D 3GJNA 5AVSB 1FS0E 5GTHE 1LTJB 1RO0A 4MRTC 3CCRP 2Y0CA 1SQVG 1LNQA 4PJ0E 3AE7C 5HGOA 4AQRD 1ZV8A 3GLMA 1MFZA 3NMDA 1VL2A 1FZEA 2XV5A 1DH3A 1FJKA 1GXHA 1RNIA 5KP7B 3WBHA 1JTHB 3H1LG 2IYPA 2JO1A 3PLNA 1HJBA 2QSIA 1PPJG 3CWBE 2XNXA 1VQ9P 1IFPA 3RL0C 1J1DB 1OVRA 4OWFA 3Q5PA 1VQ8P 2WMMA 4I7ZB 2JWAA 5CCGD 2O3JA 2PEJA 1LT9C 2KR5A 1LTGC 2MD9A 2ZT9B 1PEOA 1RE3A 4H2WC 2GA1A 2D2CC 4TT3H 3KZIH 4HJGH 1SQXD 1N73C 4EI2A 2OYIA 3TDKA 2FYUD 2M3EA 5AW5B 1SFCD 3H1KG 2E1MA 2LKMA 3H4EA 1VF5B 2K92A 3O6QB 1UNKA 2W6JH 3OAKA 2C9LY 5KLVJ 3G26A 5KP8B 5E79E 1KB9I 4AYCA 1NAYA 2Q6QA 2WSFH 1NHLA 1SQVD 2JWDA 2D2CD 1KORA 1NVOA 1W5CE 1GU4A 1PEMA 3H1LD 2ZXEB 3F5HA 1PPJD 5APVA 2I1KA 2FXOA 5GTIE 4GDOA 3G28A 3TYYA 1NTME 4H0LB 1EDLA 2IBZE 3M0DC 3L73E 2V7QJ 1NKZB 1E5WA 4UB6E 3TGUE 5H2FH 4U0AA 3L74G 2YKOA 1OWAA 2PEQA 1M74A 4Z1MH 1H8AA 1P84I 4U0BA 3G71P 1NJIQ 1LTIC 3HUSC 4EYYQ 2JQ4A 4I6MC 1L0NE 3PP5A 1X9VA 2PENA 1SS1A 3AEDC 3HE4A 4Y99B 5AVUB 3H1KD 2YIUC 1D7MA 1IFJA 3MTUE 2MJZA 1SQBK 2R5DA 4UB8H 1X0TA 1FZCC 1Y47A 2K5XA 3TNUB 1PP9J 3P8CE 2XT1A 2LF4A 2NO8A 2MR8A 4L76A 3E7KA 2H43A 4HYTB 2MF4A 2YMKA 3M06A 2K88A 2Z4EA 2E42A 3CMAP 1S3JA 1FOSE 1BDDA 2KLVA 3CLQA 1X22A 1DNYA 1T2KD 3CCQP 2M8RA 2O1JA 1M1KQ 3LIEA 2HODB 2WPSA 4A7PA 3Q5SA 3D71A 3E1IA 3CX5I 2CGQA 2E75C 3JCUH 1G2CB 2K0XA 3L74D 1PEQA 4NPDA 2GZFA 1EZVE 1OFCX 2QJYB 1QEXA 1BE3G 1GDTA 2O01N 3P7KA 2W27A 5B5EH 3HD7D 1YTZI 1J1EB 2QM7A 2JU1A 1RE3C 2KK7A 3AEGC 2NPSD 3B4QA 2LPKA 4GOFA 1USDA 4HB1A 2KNCB 2OYIC 2PEKA 5CJ0A 1KC8Q 3IN6A 2KGCA 3RBXA 1YBKA 2WITA 3CXCO 1IC2A 1KILE 2B9BA 3GG2A 1K30A 3S4RA 1RF0A 2FXMA 3BRVB 2N5IA 3P32A 1R5SA 1FE6A 2WT7B 2WTYA 2K0DX 2LIUA 3AE9C 3WMM0 4GOEA 3OW2O 2KG9A 2J58A 3NFQA 5CMZA 1K9MQ 4JYCA 4BXLA 3CCVP 2L91A 2IFNA 1SFCB 2KXPB 3MIWA 4K35A 1R5LA 3U43A 2NRGA 4ASWA 5B66E 5AVYB 3L71G 1VHNA 1LJ2A 1S5LX 2OYOA 2GUVA 2N1TA 1HGVA 2E5TA 1BGYG 2KG6A 3KXDA 1GL2A 2HPCB 4YTPC 1PZQA 3I56P 1EIAA 3KYQA 2X2BA 3PTZA 1BXIA 3KPEA 3AEBC 4JYBA 1BE3D 4XFXA 3RBZA 3KQGA 1IK7A 3LMOA 4EDFA 1BDCA 2JBGA 1X79B 3V6IA 5TISH 1NKNA 3VP8A 1VQ4P 1DV5A 4COPA 4TLFA 2AVAA 3B5IA 2PEMA 1DD3A 2JKVA 3RK3C 2QA4P 1S9KD 4ASVA 1NTMK 1S1CX 1AVOA 1AQTA 2Z5IA 1KB9D 1VQNP 2C0WA 3CL3D 2E76C 3SWYA 3RL0g 1RY3A 2ERHA 2WSEJ 5TJHA 3MGNA 1NTKE 1AUMA 1DX7A 3G4SP 2MVVA 1ZMEC 1KYOD 1Z6MA 3CCJP 2CNRA 1PGOA 2R5BA 1YJWP 2PY8A 5APXA 1OZHA 3AEEC 1MZ8A 4PD4E 1JY2N 2JAZA 3L71D 1BCCE 3ABVC 4WY4D 1QVFO 2B87A 3IAOA 5KLVG 1EC5A 2KODA 1BGYD 2WQYC 1SQPJ 3C9IA 5BU5A 3H1HE 3MUDA 2JEEA 2DGYA 3RK3D 3L70E 2PEOA 5CZDB 1A43A 3V2RA 2AXTH 1GU5A 5DJUB 1P84D 1LP1B 3II6A 3A0BE 4N78D 5CBOA 4PV1D 1NTZE 3V5BA 1KQLA 4C7RA 4IFMA 4BPFA 3L36A 2FVEA 1QRJA 2L4BA 3RGUA 2YIUB 4XFYA 2KOGA 5KKZC 2XDJA 4DG9A 3HTKA 3KHUA 1JJ2O 1OW6A 3L75J 1VQMP 1AYIA 1RO2A 1L4AA 1PL5A 3HD7B 1PV3A 1URQC 1KZUB 4PH0A 2QEXP 2YKQA 2NPSB 3V2PA 2PAJA 3AE1C 1RF0C 3G0VA 2ZAEB 3AE2C 3M0AA 2N9YB 2O01H 1RQVA 2Z44A 3Q2YA 4XFJA 1XTGB 2KB7P 3Q3DA 3CC7P 2KSJA 2GZEA 4QKOA 3ITKA 4IL6H 4DCKA 1EXIA 1Q2NA 2JGPA 1A02F 4YXDC 2Y9ZA 3L70J 5KLVD 1A02J 4IL6X 3QWOC 1VQOP 2K93A 3VTPC 3CX5D 3KZIE 1PP9G 1KYOH 1U7JA 1KILA 3EJEA 1D1DA 2FYNC 1ZR2A 3D6ZA 2N1TC 3H1IE 3A2AA 3U59A 1ZN5A 3C8VA 5APWA 1H0TA 4D6TJ 3VOPA 3BATA 2N9BA 1AFOA 1JO5A 2FXPA 5AW8B 1W2EA 3CE7A 1N7SB 2FY8A 1T3JA 5C39A 2M3BA 5AW6B 3PH0A 3DS2A 1KMIZ 4OGQC 1SQBJ 2KS1B 4H44C 1P84H 1WRGA 1FC2C 4C7NB 1SQQE 2FFDA 2VLNA 1HBWA 2MKVA 2YNYA 4WB4A 2K3RA 3BVHA 5APYA 5HGNA 1OVUA 1VQLP 4L73A 2ZVOB 2P1JA 2LOLA 3CMEP 2QG4A 3FXEA 3G1GA 2C0XA 3R4YA 2WPRA 1SQPK 5AW9B 1K73Q 1GL2D 5JPAA 2Q3IA 2CWOA 3L72E 3HYBA 2W90A 2J5UA 4DOJA 4JF7A 2K9JA 5AVXB 1EDIA 1PGPA 3HZQA 3CXHI 1OMIA 1Q82Q 2P9XA 4BPGA 3NXSA 4OGQD 1IMQA 2P7JA 1PP9D 5KLIB 3FXDA 2JYLA 3A3YB 1FDIA 1LTJA 4LLHA 1KQFB 2K37A 3L35A 2QM8A 4JBZA 1TU3F 2JB0A 2YO3A 3CCEP 1YJ9P 1Q7YQ 2IFMA 1YHQP 3RL0D 3MUDC 3TSIA 5GTHH 2A06G 1JTHA 1X8YA 1FDMA 1GD2E 2PNGA 3CX5H 4WY4B 3MGEA 4PJ0H 5CJ4A 1SQXE 3H1JG 5F2NA 3C1LA 3GHGA 1KYOI 3GW6A 2QJKC 4N6JA 4COCA 3CWBJ 3RK3B 2FYUE 1M7LA 1T8ZA 3NTNA 3T97A 1LWUA 1IFIA 2A45I 1IMPA 4IFFA 1T8KA 5APSA 5CHXA 2RMZA 2BASA 4PV1B 1ZLLA 2KP8A 1L4AC 1AVYA 2V7QH 3UIAA 5KP6B 2Y0EA 2K2QA 1RF1B 1USEA 1SQVE 4H2XC 3M9HA 2PGDA 1M1JC 1G1JA 2M8LA 1VQ6P 1FAVA 4QNBA 2BCCE 4I1LA 3H1LE 3R2PA 2QJPC 1PFIA 2OYHC 1GK6A 3B5NC 1JEKA 5E79H 2H7HA 1KILC 2A06D 1SQXJ 2EHSA 4QMAA 5BU8B 4CPGA 3EWKA 4LGDE 1L4AD 2EIAA 1M57D 3H1JD 2Z5HA 1HF9A 1FDOA 1SLQA 1HGZA 1QVGO 1LT1A 3LW5J 1NTMJ 1JY3N 4ZMDA 1SQPG 3L73J 2VRSA 5GTIH 4M0IA 4HKZH 1K8AQ 5DJTB 3TGUJ 5APQA 2BHVA 1BSNA 1GW4A 3CC4P 2FFDC 3H1KE 4NPEA 3G3ZA 1YI2P 5KAIE 5AVTB 2ZYAA 2HG5D 4KHXA 4C46A 1JY3P 3S1KA 1YJNP 1S5LE 2IPPA 4WBAA 4H13C 3Q1MA 1KILD 1MUUA 1L0NJ 2FAEA 2OTLP 1HJ0A 2RKLA 2R3CA 1OR5A 3BCCE 3FWLA 2BCCJ 1ZRTD 1LTAC 2WWWA 1HWTC 2KSEA 3GF3A 3L75G 2K0YA 1HQBA 1PGQA 1IJDB 3TNUA 4K3AA 3AE4C 1KN7A 2VLQA 1URQA 4PWVB 2BUOA 2PFXA 1GL2B 1EDJA 2CG5B 3B4SA 2M5AB 2QVAA 1LTJC 3G29A 4GR6A 2N98A 4U3FG 1FOSF 3M9QA 1Q90D 3AE6C 3L74E 2E75D 2WSCJ 1KQSO 3A0HE 1OX3A 1Q86Q 3L37A 3OJAB 3DPHA 2WSCH 4H13D 3L70G 3HE5B 4XFZA 1YITP 2RN0A 2N6ZA 1GTWA 4YPCA 3BRTB 1G2CA 2HLOA 1SQPD 1J1DC 1ZMBA 3GHGC 3A5TA 2A45G 3H25A 2R44A 3RL0B 2ZT9C 2YXRB 4D6TG 3ZDMA 1LWUC 3NTEA 3CCLP 1LTBC 1LT9B 2EFJA 2LIWA 4MN4C 2D2CB 3BCCJ 5CCGA 2Q3EA 2P2UA 1U57A 2E74C 2I1JA 1N73B 2GDWA 2BQ1E 1EOQA 1SQBG 2XXMA 2Y9YA 3P05A 5AVQB 3CXHD 2IBZI 4ZKPA 1SQXK 3WUVA 3L75D 3N7NA 2ZVNB 3G9RA 3RK2C 1VF5C 5CCHA 3AEAC 4B86A 2LXCB 2HFED 2WT7A 2FYUK 3NY7B 3AECC 2Q1KA 3O8ZA 2WPTA 3GZLA 2B87B 2R3SA 2G3AA 3E1RA 5AVVB 2LL8A 3I55P 4IZ6A 2ZT9D 1SFCA 3GKLC 4U3FD 2QIWA 2OGUA 2P10A 1E6JP 3K5BA 3DS0A 2ZFCA 1BE3E 2KGDA 2WSEH 3L70D 3EFFK 2E74D 1VKUA 1JCCA 4L74A 2KWLA 3BASA 3SWFA 4I2LC 1JNMA 4H0LC 2L0QA
chains in the Genus database with same CATH topology
4U0DA 3I56P 3WBHA 4XFZA 1EIAA 3G28A 2OARA 1YITP 3DTJA 3MGEA 1M6EX 3DS4A 1VQ7P 1ZMBA 1QVGO 3G1IA 5F2NA 1S72P 1VQ9P 3LRYA 4U0EA 1PEQA 1VQ8P 4XFXA 4U0AA 3CCMP 4GR2A 3CPWO 3DS2A 4COCA 1A8OA 4M0IA 2PEJA 2PEQA 1K8AQ 3CC2P 1QRJA 3NTEA 1M74A 3CCLP 2BHVA 1PEOA 2EFJA 2Z45A 3CCUP 3CC4P 5F2KA 4U0BA 1M6NA 3G71P 1VQ4P 4XFYA 2PEIA 1NJIQ 5BS2A 3CCSP 4COPA 1VQKP 4XROA 2Z46A 1YI2P 5F2OA 1PEUA 1JJ2O 3B5IA 2PEMA 1VQMP 2PEKA 1YJNP 3Q20A 2QA4P 5HGNA 2PENA 1KD1Q 1KC8Q 1VQLP 2JYGA 2BQ1E 1RO2A 3CXCO 1EOQA 3H0DA 3CMEP 3G1GA 2XXMA 2OTLP 3P05A 4PH0A 5BS1A 3DS5A 1BAJA 3E2DA 3G21A 3G6EP 2QEXP 2M8NA 1IUQA 2XV6A 1VQNP 1K30A 1Q81Q 3G0VA 4WYMA 1K73Q 5JPAA 2CWOA 3HYBA 4U0CA 2E1MA 2ONTA 3H4EA 2Z44A 3M1MA 1VQPP 1AUMA 3CD6P 3DS1A 4PH1A 3G4SP 2XT1A 3G26A 3HZQA 3CCJP 1VQ5P 2LF4A 1Q82Q 3CC7P 3H47A 2M8LA 1VQ6P 4U0FA 2P9XA 3RG6C 5HGLA 4QNBA 1YJWP 2PY8A 3OW2O 3I55P 2BUOA 1K9MQ 2JO0A 3CMAP 1N8RQ 3CCVP 2OTJP 2EG5A 1YIJP 2JYLA 4IPYA 2M8PA 5HGMA 4XRQA 1VQOP 3G29A 4GR6A 1RO0A 1M90Q 3CCRP 1E6JP 1QVFO 5DCKA 3DS3A 3DS0A 1D1DA 2KODA 1KQSO 3CCEP 1YJ9P 1Q7YQ 5HGOA 3CCQP 2L6EA 1YHQP 1W2BO 1Q86Q 1M1KQ 5I4TG 1PEMA 2DGYA 3DPHA 2PEOA 1A43A 2EIAA 3VRLC 1RNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN P;  3I56 P;  3CCV P;  3G71 P;  1Q81 Q;  1YIT P;  1VQ4 P;  1K73 Q;  2OTJ P;  1YIJ P;  1NJI Q;  3CCS P;  1VQK P;  1VQO P;  1YI2 P;  1VQ7 P;  1QVG O;  1M90 Q;  3CCR P;  1S72 P;  1VQ9 P;  1QVF O;  1JJ2 O;  1VQP P;  1VQ8 P;  1VQM P;  1YJN P;  3CD6 P;  3CCM P;  2QA4 P;  3CCE P;  1KD1 Q;  1KQS O;  3G4S P;  1KC8 Q;  1VQ5 P;  1YJ9 P;  1VQL P;  3CPW O;  3CCJ P;  3CXC O;  3CCQ P;  1Q7Y Q;  3CME P;  1YHQ P;  1W2B O;  1Q82 Q;  1Q86 Q;  1M1K Q;  3CC7 P;  1VQ6 P;  1K8A Q;  3CC2 P;  2OTL P;  1YJW P;  3OW2 O;  3CCL P;  3I55 P;  3G6E P;  2QEX P;  3CMA P;  1K9M Q;  3CCU P;  3CC4 P;  1N8R Q; 
#chains in the Genus database with same CATH topology
 2AEM A;  4H2Y C;  2YXQ B;  1L0N K;  3WUU A;  1CI6 B;  1NYH A;  1GK4 A;  1K04 A;  1KTM A;  2LKI A;  1NAF A;  3RK2 D;  4D6T D;  1JMM A;  1VF5 D;  3FWN A;  2HR3 A;  1JMB A;  4W80 A;  1S9K E;  2KOR A;  1LGH B;  2NZ2 A;  1KV4 A;  2RH0 A;  3CCU P;  2FQ0 A;  1KB9 E;  4XA4 A;  2KZJ A;  5KAF H;  1JY2 P;  2Z46 A;  1E79 H;  1SQB D;  2E76 D;  3HUS B;  3CWB G;  4Y99 C;  4DT0 A;  1KFN A;  1EQ7 A;  2PP6 A;  3RG2 A;  3SWK A;  4F37 A;  1WT6 A;  1N86 A;  1IUQ A;  3N4X A;  3QH9 A;  2XND H;  1EZV I;  4H0L D;  1IFM A;  2WPQ A;  4DZO A;  2GDX A;  2C9N Y;  3L71 E;  1T3U A;  4O9B A;  1HY8 A;  1FZC B;  1GPJ A;  1BGY E;  3CXH H;  4Y28 J;  2N50 A;  1L2P A;  4BPH A;  1NTK J;  3V2Q A;  1H0T B;  3RK3 E;  1ACP A;  2JP3 A;  3EQ2 A;  2EG5 A;  3H32 B;  4RO0 A;  1P84 E;  2QRX A;  2KW2 A;  2HYN A;  1YTZ T;  4PD4 H;  1BCC J;  2CPB A;  2L6E A;  4GIF A;  3Q5R A;  1M1J A;  1KQG B;  1NU1 E;  3VRL C;  2I8D A;  1DIP A;  2POH A;  4U0D A;  1LP1 A;  3H1H J;  1M6E X;  2OYH A;  3A7O A;  4PXH B;  1S72 P;  2E75 B;  1DEB A;  3B5N A;  4R4M A;  1OIP A;  5CBN A;  3IR9 A;  1J1E C;  2YO2 A;  1ZXG A;  2YKP A;  4H13 B;  3USS A;  1NTZ J;  5F2K A;  2A45 H;  1URQ D;  3A0B H;  3CWB D;  5CCG C;  4YXW H;  1NTM G;  5F2O A;  2IBZ G;  1NOH A;  1HTL C;  1NQ4 A;  1EDK A;  1M56 D;  3L73 G;  2K9J B;  1KD1 Q;  3HD7 A;  4IFD K;  3TGU G;  2OYI B;  1GXG A;  3B8E B;  1IFN A;  2NPS A;  4JQ0 D;  3G21 A;  4RKU J;  3G6E P;  1ZNV A;  2H88 C;  5CCH C;  5KLV E;  4U0C A;  3AE8 C;  3U1C A;  2VLP A;  1J2J B;  1L0L E;  3F89 A;  3CX5 E;  2WPV B;  1VQ5 P;  1L0N G;  4W7Y A;  5AVR B;  3SFE C;  1X3O A;  4U0F A;  4RES B;  3RG6 C;  1MKM A;  1SFC C;  3EFG A;  2N1T D;  2ITA A;  2BCC G;  3WU2 H;  3D70 A;  1YIJ P;  1NU1 J;  1E0H A;  2M8P A;  1Y8A A;  2H89 C;  5APU A;  1SP4 A;  1CEI A;  1K05 A;  1L0I A;  2J59 M;  3GHG B;  2QE7 H;  5I4T G;  1KFM A;  4BRY A;  4ZKU A;  1S2E A;  1OW7 A;  5H2F E;  3SSU A;  3T97 B;  1LWU B;  3H1I J;  3JSV C;  2B89 A;  2AFE A;  1N7S A;  3DS4 A;  4H44 D;  1VQ7 P;  3LID A;  4EOT A;  1SVF A;  3GF7 A;  5CCH D;  2XZR A;  4GT1 A;  4W7Z A;  2E74 B;  4PD4 I;  1AJY A;  2Y0D A;  3CI9 A;  2KS1 A;  2JJL A;  2VSQ A;  1UJZ A;  2CK3 H;  2ZYG A;  4C7N A;  1NTM D;  2IBZ D;  1NTK K;  2L5G B;  2PEI A;  1PIX A;  3L73 D;  2MY5 A;  3RK2 B;  2FVA A;  4HH2 A;  1QL2 A;  3TGU D;  1PEU A;  1YQ3 C;  1EMV A;  1SQQ J;  5AW2 B;  4UB8 E;  3HRN A;  1DEE G;  1L0L J;  1EZV G;  2WSF J;  3HE4 B;  1NGM B;  1QGK B;  5KJ7 A;  3BCC G;  3KDP B;  1PP9 E;  5EJD A;  2E76 B;  1F80 D;  2W83 C;  1L0N D;  1CZQ A;  1FU1 A;  3L72 J;  3DS1 A;  1HH0 A;  2BCC D;  2ROQ A;  3H47 A;  3H6P A;  1Z56 A;  2AEJ A;  2H8P D;  1N8R Q;  1IO4 A;  2KIK A;  1AF8 A;  1JY3 O;  4OH8 B;  2GZG A;  1NTZ K;  3O6Q A;  1OW8 A;  3P8C D;  1OVV A;  1UIX A;  4NPF X;  2L22 A;  3JCU E;  2WSS H;  2WVR A;  1BSH A;  2OTK E;  4LC1 A;  2GYK A;  1PPJ E;  4WY4 A;  2K9Y A;  5B5E E;  1T2K C;  1PGJ A;  2MR7 A;  4GR2 A;  1AA0 A;  2IZ0 A;  1H88 A;  1WMK A;  2FYU J;  3CCS P;  4XRO A;  3W67 A;  4M3L A;  3W68 A;  1EZV D;  5KKZ B;  1ZP0 C;  1GZL A;  1NU1 K;  3HD7 C;  2L9F A;  3D6Y A;  1RE4 A;  3LW5 H;  2B88 A;  3BCC D;  2NPS C;  1RF1 A;  7CEI A;  1QX8 A;  1FZG A;  3DS5 A;  1URQ B;  2XV6 A;  2KGA A;  1Q81 Q;  2W8Z A;  4WYM A;  4UB6 H;  1NH4 A;  2QNW A;  2P58 A;  1FR2 A;  4CA3 A;  2ZJS E;  1SQV J;  2A06 E;  1QL1 A;  3B5N D;  1ZOY C;  2GZI A;  5M1B A;  5APT A;  1YYC A;  3FGA D;  4L75 A;  2JO0 A;  3OA7 A;  4EIJ A;  2OTJ P;  2VLO A;  2E5Y A;  2V4H A;  3H1J E;  2Q5U A;  4IPY A;  2KOO A;  3H1L J;  2XZ0 D;  4KT0 J;  5HGM A;  2FHS C;  4WVZ A;  5AW7 B;  1OXZ A;  2KI7 B;  5DCK A;  2KOS A;  3MHV A;  1NTK G;  2UWJ E;  2FYN B;  1SQQ K;  5BVZ A;  5AVZ B;  2N1T B;  5KLV K;  2GDY A;  2M5R A;  4RJT A;  2ZXX A;  5AW1 B;  2KZI A;  4OVN F;  1L0L K;  2JDI H;  1H89 A;  1JCD A;  2OAR A;  3PRJ A;  3VN0 A;  3DTJ A;  1N7S C;  2LXB A;  5TIS E;  3V4Q A;  1FJP A;  2DW3 A;  5HV8 A;  3LRY A;  1BCC G;  5K5G B;  2M0B A;  3CCM P;  2BEZ F;  3FX0 A;  2FQ1 A;  1RHZ B;  2HOD A;  1GW3 A;  1L0H A;  3JC2 2;  1AQ5 A;  2XKM A;  2LTE A;  4OGQ B;  2N5H A;  3H1H G;  2FKW B;  1M6N A;  2EHT A;  2O1K A;  4H44 B;  2GM4 A;  5BS2 A;  4N3Y B;  2CQ8 A;  1CSB A;  1ZRT E;  5AW0 B;  3H1K J;  2KOP A;  4I7Z C;  2K1A A;  1MZ9 A;  3IFM A;  2KGE A;  3IF4 A;  2KLU A;  2FAD A;  4UHP B;  1NTZ G;  5L8R J;  2FYZ A;  2GUS A;  5KJ7 C;  5KAI H;  1JM0 A;  4IOI H;  3B71 A;  1FZA A;  3MZW B;  1ZR4 A;  2DNW A;  1S5L H;  2KNC A;  3M1M A;  3AEF C;  1XTC C;  5AW3 B;  4BWN A;  1VQP P;  3GMA A;  1JB0 J;  3H1J J;  1MFT A;  1N7S D;  5EFW B;  2WZ7 A;  2BEQ D;  1N2D C;  1LTS C;  4GOD A;  2LML A;  2G8Y A;  1JY2 O;  1S4X A;  2Q9I A;  3U1A A;  5KLI C;  3I5C A;  2M5A A;  2K94 A;  4XRQ A;  2YMY A;  1SQP E;  1NTK D;  4ZNC A;  1M90 Q;  2AXT E;  3WUT A;  1JOC A;  5KAF E;  1FZF A;  3GZM A;  5EW5 E;  3L4F A;  3VP9 A;  4HKG A;  3L74 J;  3HE5 A;  4PD4 D;  4WY4 C;  1NU1 G;  5KJ7 D;  1BCC D;  3A0H H;  3PHL A;  2XU6 A;  3G1I A;  4U0E A;  1G1I A;  3M9B A;  1DD4 A;  2W6B A;  3CPW O;  1A8O A;  3H1H D;  3MD0 A;  2QJK B;  3CC2 P;  4U7J A;  3EJD A;  1LT9 A;  2HPC A;  3H1I G;  3TF5 A;  3CXH E;  1SQV K;  2Z45 A;  3VMY A;  1RQU A;  3VMA A;  1LTT C;  3VMZ A;  3L75 E;  5B66 H;  2AXC A;  1VQK P;  4PV1 C;  3AE3 C;  2IZ1 A;  1N73 A;  2MVU A;  1NTZ D;  3HTK B;  2JYG A;  4R0M A;  2IYO A;  1RE4 C;  2R32 A;  3H0D A;  1JUN A;  1RF1 C;  3P8M C;  1L4A B;  1Y9B A;  1YQ4 C;  1BAJ A;  2W6A A;  1IK9 A;  4IL6 E;  4U3F E;  5HVC A;  1VDF A;  1FBM A;  1SQQ G;  2FVF A;  3CD6 P;  1L0L G;  1MV8 A;  2FAC A;  4PH1 A;  1NWQ A;  2ZYD A;  1ZW0 A;  1CW5 A;  1EXJ A;  3VYI A;  1KYO E;  5HGL A;  1M1J B;  1NO4 A;  1N7L A;  1FZB A;  1U7M A;  2AF8 A;  5AVW B;  1IZN B;  2QJP B;  4JPZ B;  2OYH B;  1IFD A;  3L72 G;  3DS3 A;  4D6T E;  3B5N B;  2LR2 A;  2JR8 A;  2OQQ A;  1KIL B;  1W2B O;  1NU1 D;  5AW4 B;  2CPS A;  2Q7C A;  1BE3 J;  1HUC A;  3S9O A;  3PJS K;  1CI6 A;  3TK1 A;  1VPC A;  1M8O B;  2SPZ A;  1T6A A;  3M0D A;  1SQB E;  1AV1 A;  3H1I D;  1UII A;  3AE5 C;  4N78 E;  3EJB A;  2O01 J;  2JU2 A;  2FBW C;  2AFD A;  2FFD B;  2P67 A;  2AEF A;  3HUS A;  3V2N A;  3WU2 E;  2KG8 A;  4U3F J;  1R8E A;  1SQX G;  1GMJ A;  4DJG A;  3Q20 A;  2QJY C;  1HVV A;  2KOQ A;  1KLP A;  4XE5 B;  1KB9 H;  1RH5 B;  4R4L A;  5BS1 A;  2FQ2 A;  3E2D A;  1QLE D;  2FYU G;  2M8N A;  1SQQ D;  4WWI A;  2IX7 C;  3SFD C;  5KTB A;  1L0L D;  2ONT A;  2PRR A;  2GZJ A;  4KJM A;  1FZC A;  2IDB A;  3MP7 B;  3L71 J;  3M91 A;  1GL2 C;  4NEO A;  4BRY B;  2E43 A;  4GKG A;  2XZ1 C;  1BGY J;  2N6Y A;  2KYV A;  3V4W A;  4AUW A;  2KUB A;  3VMX A;  3H32 A;  3L72 D;  3GJN A;  5AVS B;  1FS0 E;  5GTH E;  1LTJ B;  1RO0 A;  4MRT C;  3CCR P;  2Y0C A;  1SQV G;  1LNQ A;  4PJ0 E;  3AE7 C;  5HGO A;  4AQR D;  1ZV8 A;  3GLM A;  1MFZ A;  3NMD A;  1VL2 A;  1FZE A;  2XV5 A;  1DH3 A;  1FJK A;  1GXH A;  1RNI A;  5KP7 B;  3WBH A;  1JTH B;  3H1L G;  2IYP A;  2JO1 A;  3PLN A;  1HJB A;  2QSI A;  1PPJ G;  3CWB E;  2XNX A;  1VQ9 P;  1IFP A;  3RL0 C;  1J1D B;  1OVR A;  4OWF A;  3Q5P A;  1VQ8 P;  2WMM A;  4I7Z B;  2JWA A;  5CCG D;  2O3J A;  2PEJ A;  1LT9 C;  2KR5 A;  1LTG C;  2MD9 A;  2ZT9 B;  1PEO A;  1RE3 A;  4H2W C;  2GA1 A;  2D2C C;  4TT3 H;  3KZI H;  4HJG H;  1SQX D;  1N73 C;  4EI2 A;  2OYI A;  3TDK A;  2FYU D;  2M3E A;  5AW5 B;  1SFC D;  3H1K G;  2E1M A;  2LKM A;  3H4E A;  1VF5 B;  2K92 A;  3O6Q B;  1UNK A;  2W6J H;  3OAK A;  2C9L Y;  5KLV J;  3G26 A;  5KP8 B;  5E79 E;  1KB9 I;  4AYC A;  1NAY A;  2Q6Q A;  2WSF H;  1NHL A;  1SQV D;  2JWD A;  2D2C D;  1KOR A;  1NVO A;  1W5C E;  1GU4 A;  1PEM A;  3H1L D;  2ZXE B;  3F5H A;  1PPJ D;  5APV A;  2I1K A;  2FXO A;  5GTI E;  4GDO A;  3G28 A;  3TYY A;  1NTM E;  4H0L B;  1EDL A;  2IBZ E;  3M0D C;  3L73 E;  2V7Q J;  1NKZ B;  1E5W A;  4UB6 E;  3TGU E;  5H2F H;  4U0A A;  3L74 G;  2YKO A;  1OWA A;  2PEQ A;  1M74 A;  4Z1M H;  1H8A A;  1P84 I;  4U0B A;  3G71 P;  1NJI Q;  1LTI C;  3HUS C;  4EYY Q;  2JQ4 A;  4I6M C;  1L0N E;  3PP5 A;  1X9V A;  2PEN A;  1SS1 A;  3AED C;  3HE4 A;  4Y99 B;  5AVU B;  3H1K D;  2YIU C;  1D7M A;  1IFJ A;  3MTU E;  2MJZ A;  1SQB K;  2R5D A;  4UB8 H;  1X0T A;  1FZC C;  1Y47 A;  2K5X A;  3TNU B;  1PP9 J;  3P8C E;  2XT1 A;  2LF4 A;  2NO8 A;  2MR8 A;  4L76 A;  3E7K A;  2H43 A;  4HYT B;  2MF4 A;  2YMK A;  3M06 A;  2K88 A;  2Z4E A;  2E42 A;  3CMA P;  1S3J A;  1FOS E;  1BDD A;  2KLV A;  3CLQ A;  1X22 A;  1DNY A;  1T2K D;  3CCQ P;  2M8R A;  2O1J A;  1M1K Q;  3LIE A;  2HOD B;  2WPS A;  4A7P A;  3Q5S A;  3D71 A;  3E1I A;  3CX5 I;  2CGQ A;  2E75 C;  3JCU H;  1G2C B;  2K0X A;  3L74 D;  1PEQ A;  4NPD A;  2GZF A;  1EZV E;  1OFC X;  2QJY B;  1QEX A;  1BE3 G;  1GDT A;  2O01 N;  3P7K A;  2W27 A;  5B5E H;  3HD7 D;  1YTZ I;  1J1E B;  2QM7 A;  2JU1 A;  1RE3 C;  2KK7 A;  3AEG C;  2NPS D;  3B4Q A;  2LPK A;  4GOF A;  1USD A;  4HB1 A;  2KNC B;  2OYI C;  2PEK A;  5CJ0 A;  1KC8 Q;  3IN6 A;  2KGC A;  3RBX A;  1YBK A;  2WIT A;  3CXC O;  1IC2 A;  1KIL E;  2B9B A;  3GG2 A;  1K30 A;  3S4R A;  1RF0 A;  2FXM A;  3BRV B;  2N5I A;  3P32 A;  1R5S A;  1FE6 A;  2WT7 B;  2WTY A;  2K0D X;  2LIU A;  3AE9 C;  3WMM 0;  4GOE A;  3OW2 O;  2KG9 A;  2J58 A;  3NFQ A;  5CMZ A;  1K9M Q;  4JYC A;  4BXL A;  3CCV P;  2L91 A;  2IFN A;  1SFC B;  2KXP B;  3MIW A;  4K35 A;  1R5L A;  3U43 A;  2NRG A;  4ASW A;  5B66 E;  5AVY B;  3L71 G;  1VHN A;  1LJ2 A;  1S5L X;  2OYO A;  2GUV A;  2N1T A;  1HGV A;  2E5T A;  1BGY G;  2KG6 A;  3KXD A;  1GL2 A;  2HPC B;  4YTP C;  1PZQ A;  3I56 P;  1EIA A;  3KYQ A;  2X2B A;  3PTZ A;  1BXI A;  3KPE A;  3AEB C;  4JYB A;  1BE3 D;  4XFX A;  3RBZ A;  3KQG A;  1IK7 A;  3LMO A;  4EDF A;  1BDC A;  2JBG A;  1X79 B;  3V6I A;  5TIS H;  1NKN A;  3VP8 A;  1VQ4 P;  1DV5 A;  4COP A;  4TLF A;  2AVA A;  3B5I A;  2PEM A;  1DD3 A;  2JKV A;  3RK3 C;  2QA4 P;  1S9K D;  4ASV A;  1NTM K;  1S1C X;  1AVO A;  1AQT A;  2Z5I A;  1KB9 D;  1VQN P;  2C0W A;  3CL3 D;  2E76 C;  3SWY A;  3RL0 g;  1RY3 A;  2ERH A;  2WSE J;  5TJH A;  3MGN A;  1NTK E;  1AUM A;  1DX7 A;  3G4S P;  2MVV A;  1ZME C;  1KYO D;  1Z6M A;  3CCJ P;  2CNR A;  1PGO A;  2R5B A;  1YJW P;  2PY8 A;  5APX A;  1OZH A;  3AEE C;  1MZ8 A;  4PD4 E;  1JY2 N;  2JAZ A;  3L71 D;  1BCC E;  3ABV C;  4WY4 D;  1QVF O;  2B87 A;  3IAO A;  5KLV G;  1EC5 A;  2KOD A;  1BGY D;  2WQY C;  1SQP J;  3C9I A;  5BU5 A;  3H1H E;  3MUD A;  2JEE A;  2DGY A;  3RK3 D;  3L70 E;  2PEO A;  5CZD B;  1A43 A;  3V2R A;  2AXT H;  1GU5 A;  5DJU B;  1P84 D;  1LP1 B;  3II6 A;  3A0B E;  4N78 D;  5CBO A;  4PV1 D;  1NTZ E;  3V5B A;  1KQL A;  4C7R A;  4IFM A;  4BPF A;  3L36 A;  2FVE A;  1QRJ A;  2L4B A;  3RGU A;  2YIU B;  4XFY A;  2KOG A;  5KKZ C;  2XDJ A;  4DG9 A;  3HTK A;  3KHU A;  1JJ2 O;  1OW6 A;  3L75 J;  1VQM P;  1AYI A;  1RO2 A;  1L4A A;  1PL5 A;  3HD7 B;  1PV3 A;  1URQ C;  1KZU B;  4PH0 A;  2QEX P;  2YKQ A;  2NPS B;  3V2P A;  2PAJ A;  3AE1 C;  1RF0 C;  3G0V A;  2ZAE B;  3AE2 C;  3M0A A;  2N9Y B;  2O01 H;  1RQV A;  2Z44 A;  3Q2Y A;  4XFJ A;  1XTG B;  2KB7 P;  3Q3D A;  3CC7 P;  2KSJ A;  2GZE A;  4QKO A;  3ITK A;  4IL6 H;  4DCK A;  1EXI A;  1Q2N A;  2JGP A;  1A02 F;  4YXD C;  2Y9Z A;  3L70 J;  5KLV D;  1A02 J;  4IL6 X;  3QWO C;  1VQO P;  2K93 A;  3VTP C;  3CX5 D;  3KZI E;  1PP9 G;  1KYO H;  1U7J A;  1KIL A;  3EJE A;  1D1D A;  2FYN C;  1ZR2 A;  3D6Z A;  2N1T C;  3H1I E;  3A2A A;  3U59 A;  1ZN5 A;  3C8V A;  5APW A;  1H0T A;  4D6T J;  3VOP A;  3BAT A;  2N9B A;  1AFO A;  1JO5 A;  2FXP A;  5AW8 B;  1W2E A;  3CE7 A;  1N7S B;  2FY8 A;  1T3J A;  5C39 A;  2M3B A;  5AW6 B;  3PH0 A;  3DS2 A;  1KMI Z;  4OGQ C;  1SQB J;  2KS1 B;  4H44 C;  1P84 H;  1WRG A;  1FC2 C;  4C7N B;  1SQQ E;  2FFD A;  2VLN A;  1HBW A;  2MKV A;  2YNY A;  4WB4 A;  2K3R A;  3BVH A;  5APY A;  5HGN A;  1OVU A;  1VQL P;  4L73 A;  2ZVO B;  2P1J A;  2LOL A;  3CME P;  2QG4 A;  3FXE A;  3G1G A;  2C0X A;  3R4Y A;  2WPR A;  1SQP K;  5AW9 B;  1K73 Q;  1GL2 D;  5JPA A;  2Q3I A;  2CWO A;  3L72 E;  3HYB A;  2W90 A;  2J5U A;  4DOJ A;  4JF7 A;  2K9J A;  5AVX B;  1EDI A;  1PGP A;  3HZQ A;  3CXH I;  1OMI A;  1Q82 Q;  2P9X A;  4BPG A;  3NXS A;  4OGQ D;  1IMQ A;  2P7J A;  1PP9 D;  5KLI B;  3FXD A;  2JYL A;  3A3Y B;  1FDI A;  1LTJ A;  4LLH A;  1KQF B;  2K37 A;  3L35 A;  2QM8 A;  4JBZ A;  1TU3 F;  2JB0 A;  2YO3 A;  3CCE P;  1YJ9 P;  1Q7Y Q;  2IFM A;  1YHQ P;  3RL0 D;  3MUD C;  3TSI A;  5GTH H;  2A06 G;  1JTH A;  1X8Y A;  1FDM A;  1GD2 E;  2PNG A;  3CX5 H;  4WY4 B;  3MGE A;  4PJ0 H;  5CJ4 A;  1SQX E;  3H1J G;  5F2N A;  3C1L A;  3GHG A;  1KYO I;  3GW6 A;  2QJK C;  4N6J A;  4COC A;  3CWB J;  3RK3 B;  2FYU E;  1M7L A;  1T8Z A;  3NTN A;  3T97 A;  1LWU A;  1IFI A;  2A45 I;  1IMP A;  4IFF A;  1T8K A;  5APS A;  5CHX A;  2RMZ A;  2BAS A;  4PV1 B;  1ZLL A;  2KP8 A;  1L4A C;  1AVY A;  2V7Q H;  3UIA A;  5KP6 B;  2Y0E A;  2K2Q A;  1RF1 B;  1USE A;  1SQV E;  4H2X C;  3M9H A;  2PGD A;  1M1J C;  1G1J A;  2M8L A;  1VQ6 P;  1FAV A;  4QNB A;  2BCC E;  4I1L A;  3H1L E;  3R2P A;  2QJP C;  1PFI A;  2OYH C;  1GK6 A;  3B5N C;  1JEK A;  5E79 H;  2H7H A;  1KIL C;  2A06 D;  1SQX J;  2EHS A;  4QMA A;  5BU8 B;  4CPG A;  3EWK A;  4LGD E;  1L4A D;  2EIA A;  1M57 D;  3H1J D;  2Z5H A;  1HF9 A;  1FDO A;  1SLQ A;  1HGZ A;  1QVG O;  1LT1 A;  3LW5 J;  1NTM J;  1JY3 N;  4ZMD A;  1SQP G;  3L73 J;  2VRS A;  5GTI H;  4M0I A;  4HKZ H;  1K8A Q;  5DJT B;  3TGU J;  5APQ A;  2BHV A;  1BSN A;  1GW4 A;  3CC4 P;  2FFD C;  3H1K E;  4NPE A;  3G3Z A;  1YI2 P;  5KAI E;  5AVT B;  2ZYA A;  2HG5 D;  4KHX A;  4C46 A;  1JY3 P;  3S1K A;  1YJN P;  1S5L E;  2IPP A;  4WBA A;  4H13 C;  3Q1M A;  1KIL D;  1MUU A;  1L0N J;  2FAE A;  2OTL P;  1HJ0 A;  2RKL A;  2R3C A;  1OR5 A;  3BCC E;  3FWL A;  2BCC J;  1ZRT D;  1LTA C;  2WWW A;  1HWT C;  2KSE A;  3GF3 A;  3L75 G;  2K0Y A;  1HQB A;  1PGQ A;  1IJD B;  3TNU A;  4K3A A;  3AE4 C;  1KN7 A;  2VLQ A;  1URQ A;  4PWV B;  2BUO A;  2PFX A;  1GL2 B;  1EDJ A;  2CG5 B;  3B4S A;  2M5A B;  2QVA A;  1LTJ C;  3G29 A;  4GR6 A;  2N98 A;  4U3F G;  1FOS F;  3M9Q A;  1Q90 D;  3AE6 C;  3L74 E;  2E75 D;  2WSC J;  1KQS O;  3A0H E;  1OX3 A;  1Q86 Q;  3L37 A;  3OJA B;  3DPH A;  2WSC H;  4H13 D;  3L70 G;  3HE5 B;  4XFZ A;  1YIT P;  2RN0 A;  2N6Z A;  1GTW A;  4YPC A;  3BRT B;  1G2C A;  2HLO A;  1SQP D;  1J1D C;  1ZMB A;  3GHG C;  3A5T A;  2A45 G;  3H25 A;  2R44 A;  3RL0 B;  2ZT9 C;  2YXR B;  4D6T G;  3ZDM A;  1LWU C;  3NTE A;  3CCL P;  1LTB C;  1LT9 B;  2EFJ A;  2LIW A;  4MN4 C;  2D2C B;  3BCC J;  5CCG A;  2Q3E A;  2P2U A;  1U57 A;  2E74 C;  2I1J A;  1N73 B;  2GDW A;  2BQ1 E;  1EOQ A;  1SQB G;  2XXM A;  2Y9Y A;  3P05 A;  5AVQ B;  3CXH D;  2IBZ I;  4ZKP A;  1SQX K;  3WUV A;  3L75 D;  3N7N A;  2ZVN B;  3G9R A;  3RK2 C;  1VF5 C;  5CCH A;  3AEA C;  4B86 A;  2LXC B;  2HFE D;  2WT7 A;  2FYU K;  3NY7 B;  3AEC C;  2Q1K A;  3O8Z A;  2WPT A;  3GZL A;  2B87 B;  2R3S A;  2G3A A;  3E1R A;  5AVV B;  2LL8 A;  3I55 P;  4IZ6 A;  2ZT9 D;  1SFC A;  3GKL C;  4U3F D;  2QIW A;  2OGU A;  2P10 A;  1E6J P;  3K5B A;  3DS0 A;  2ZFC A;  1BE3 E;  2KGD A;  2WSE H;  3L70 D;  3EFF K;  2E74 D;  1VKU A;  1JCC A;  4L74 A;  2KWL A;  3BAS A;  3SWF A;  4I2L C;  1JNM A;  4H0L C;  2L0Q A; 
#chains in the Genus database with same CATH homology
 4U0D A;  3I56 P;  3WBH A;  4XFZ A;  1EIA A;  3G28 A;  2OAR A;  1YIT P;  3DTJ A;  3MGE A;  1M6E X;  3DS4 A;  1VQ7 P;  1ZMB A;  1QVG O;  3G1I A;  5F2N A;  1S72 P;  1VQ9 P;  3LRY A;  4U0E A;  1PEQ A;  1VQ8 P;  4XFX A;  4U0A A;  3CCM P;  4GR2 A;  3CPW O;  3DS2 A;  4COC A;  1A8O A;  4M0I A;  2PEJ A;  2PEQ A;  1K8A Q;  3CC2 P;  1QRJ A;  3NTE A;  1M74 A;  3CCL P;  2BHV A;  1PEO A;  2EFJ A;  2Z45 A;  3CCU P;  3CC4 P;  5F2K A;  4U0B A;  1M6N A;  3G71 P;  1VQ4 P;  4XFY A;  2PEI A;  1NJI Q;  5BS2 A;  3CCS P;  4COP A;  1VQK P;  4XRO A;  2Z46 A;  1YI2 P;  5F2O A;  1PEU A;  1JJ2 O;  3B5I A;  2PEM A;  1VQM P;  2PEK A;  1YJN P;  3Q20 A;  2QA4 P;  5HGN A;  2PEN A;  1KD1 Q;  1KC8 Q;  1VQL P;  2JYG A;  2BQ1 E;  1RO2 A;  3CXC O;  1EOQ A;  3H0D A;  3CME P;  3G1G A;  2XXM A;  2OTL P;  3P05 A;  4PH0 A;  5BS1 A;  3DS5 A;  1BAJ A;  3E2D A;  3G21 A;  3G6E P;  2QEX P;  2M8N A;  1IUQ A;  2XV6 A;  1VQN P;  1K30 A;  1Q81 Q;  3G0V A;  4WYM A;  1K73 Q;  5JPA A;  2CWO A;  3HYB A;  4U0C A;  2E1M A;  2ONT A;  3H4E A;  2Z44 A;  3M1M A;  1VQP P;  1AUM A;  3CD6 P;  3DS1 A;  4PH1 A;  3G4S P;  2XT1 A;  3G26 A;  3HZQ A;  3CCJ P;  1VQ5 P;  2LF4 A;  1Q82 Q;  3CC7 P;  3H47 A;  2M8L A;  1VQ6 P;  4U0F A;  2P9X A;  3RG6 C;  5HGL A;  4QNB A;  1YJW P;  2PY8 A;  3OW2 O;  3I55 P;  2BUO A;  1K9M Q;  2JO0 A;  3CMA P;  1N8R Q;  3CCV P;  2OTJ P;  2EG5 A;  1YIJ P;  2JYL A;  4IPY A;  2M8P A;  5HGM A;  4XRQ A;  1VQO P;  3G29 A;  4GR6 A;  1RO0 A;  1M90 Q;  3CCR P;  1E6J P;  1QVF O;  5DCK A;  3DS3 A;  3DS0 A;  1D1D A;  2KOD A;  1KQS O;  3CCE P;  1YJ9 P;  1Q7Y Q;  5HGO A;  3CCQ P;  2L6E A;  1YHQ P;  1W2B O;  1Q86 Q;  1M1K Q;  5I4T G;  1PEM A;  2DGY A;  3DPH A;  2PEO A;  1A43 A;  2EIA A;  3VRL C;  1RNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...