1N8RQ

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1n8rQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1n8rQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1n8rQ03
1W2BO 3CMEP 3I55P 1NJIQ 1KC8Q 3I56P 1M1KQ 1VQ9P 3CCEP 1YJNP 1K8AQ 3CCJP 1VQKP 1YJWP 1VQOP 1S72P 1JJ2O 1YHQP 1KQSO 1YIJP 1QVGO 3CCLP 1VQPP 3CCSP 1VQ7P 3CCRP 3CMAP 3CC7P 3CCUP 2OTJP 1Q81Q 1K9MQ 1VQLP 1YITP 1Q7YQ 3G6EP 3CC4P 1K73Q 1VQ6P 1KD1Q 1M90Q 1QVFO 3CXCO 1Q86Q 1YJ9P 3OW2O 3CC2P 3CCVP 1VQMP 3CD6P 1VQ8P 2QA4P 2OTLP 1YI2P 2QEXP 1VQ5P 3CCQP 3CCMP 1VQ4P 1N8RQ 3CPWO 1Q82Q 3G4SP 3G71P 1VQNP
chains in the Genus database with same CATH superfamily
2FVEA 1E5WA 3HRNA 2QNWA 4IL6E 2E5YA 2W6AA 1GPJA 2A45H 1GL2A 3L70J 2JB0A 2XNXA 2WTYA 4IOIH 2PEKA 1L0LJ 4U0AA 3HD7D 3H32A 1EXJA 1KYOI 5KLVD 1KILD 1SVFA 4LGDE 4AYCA 1YI2P 3P8MC 2B88A 1N73B 4EOTA 4U7JA 2MVVA 1L4AD 1CSBA 2BUOA 1RO2A 5EW5E 2E74B 3B5NA 4RESB 4L73A 1FBMA 3H6PA 4D6TG 2AXTH 1JB0J 1IFNA 3F5HA 1HJ0A 1M6NA 5AVUB 2XV5A 1KB9E 1CEIA 2LIUA 3QH9A 3A2AA 4ZNCA 1LWUB 1GXGA 4LLHA 3F89A 1WMKA 2N5HA 3CCEP 3G3ZA 2BEQD 2WSSH 1KQSO 1IMQA 1FJPA 5KLVG 3CC7P 4F37A 1SQXD 3H1KE 2E76D 2H89C 2GDYA 2QM7A 2AEMA 5EFWB 4U0DA 2OYHA 2AEFA 4PV1C 2B9BA 5I4TG 2Z4EA 1KYOD 1L0NG 1OWAA 2FYUG 1ZXGA 2KS1A 2BEZF 1X79B 4HJGH 1FOSE 3L36A 3CWBD 5KKZB 1SQXE 2KOOA 3MUDA 4WY4A 4XFXA 4Z1MH 3CD6P 1CZQA 1PPJE 1VQMP 2RMZA 2KG6A 3L35A 5AVVB 3FWLA 2KODA 2GZGA 1MZ8A 1BGYG 1N7LA 2ZT9C 3LRYA 1AYIA 1MFZA 4JYBA 1FZCA 1PEUA 2NRGA 1HGZA 3CMAP 1VL2A 1DEEG 2L4BA 3VMAA 2KG9A 4D6TE 2EHSA 3CE7A 1SQPG 5APXA 1N86A 3FXEA 4IL6X 3CCVP 1HTLC 2FFDC 3Q1MA 1SQXK 4DZOA 1PP9D 5HVCA 2PAJA 3G4SP 2FYNB 1EZVG 3L70G 1L0IA 3GW6A 1GTWA 1RE3C 3B5IA 2AXTE 2XKMA 1Q7YQ 3VRLC 1EDIA 3A0HE 4OVNF 3CX5H 1NTKK 1UIXA 2QA4P 5HGMA 5HV8A 1RQVA 2Y9YA 3L71G 2C0XA 1S5LX 2OYOA 1OVVA 3WUVA 2HPCA 2WSFH 2OGUA 1T8KA 2SPZA 1Y9BA 3B8EB 2DNWA 1L4AC 1NHLA 4MN4C 4BPHA 4H0LC 2I8DA 2PEIA 1AJYA 3NXSA 1BGYE 3L4FA 1BSHA 2P1JA 2IZ0A 2FAEA 3AE2C 1VQ8P 4QKOA 5B66E 2Y0CA 3L72J 5AW7B 2N6YA 3BCCJ 3E2DA 2IPPA 2ZXXA 1GL2D 1OZHA 2H43A 3DPHA 2JO1A 2GDWA 1LTIC 4OWFA 2WT7B 1IZNB 3VMYA 1WRGA 1JTHB 1NU1D 4U0EA 2GZJA 1RQUA 4COPA 3DS5A 1F80D 1M8OB 1LT9C 3GZLA 1J1EB 1NJIQ 1FJKA 5CZDB 1L0NK 2WSCJ 3C9IA 2LKMA 3RK3D 1FE6A 2KUBA 5AW2B 2WSCH 2YO2A 2QJYB 4WY4D 2L91A 1NKNA 2KORA 3EQ2A 3V2PA 3BVHA 4GOFA 1VQ5P 3A3YB 1OW7A 1PV3A 1SQPK 2I1KA 5KLVK 1LWUC 2WVRA 2GUSA 2DGYA 4MRTC 1NU1J 2JWDA 2N1TC 1KMIZ 2E43A 3G9RA 3L70E 4L75A 1FU1A 3H1IG 4C7NB 2HLOA 2ONTA 3MHVA 2KOPA 1ZRTE 2O01N 4PD4I 3E7KA 3RL0B 3RK3E 1A8OA 5CCHC 1NU1K 2PEMA 2K93A 1GW4A 3DS1A 2N9BA 1BE3E 3M9BA 2N50A 3V4QA 2W6BA 2FYUK 3H1JE 2VLNA 5BS2A 2OYHC 1HJBA 3B5ND 2R3SA 3H1KG 3SFEC 1N73A 1JO5A 5F2OA 3G29A 1E6JP 2R44A 1MV8A 1KV4A 2NPSB 1DD4A 3VMXA 2FYUE 3TGUE 1IK9A 2IDBA 1XTGB 2XZ0D 1L0LG 2KW2A 1J2JB 3M91A 3WU2H 1ZW0A 1UJZA 4ZKPA 1G1IA 2M3EA 3H1KJ 3CCJP 3USSA 3U1CA 2HG5D 2A06G 3S9OA 2ZYAA 4EYYQ 2XZ1C 2CGQA 3CCUP 4JPZB 1SQVE 3U43A 1ZR4A 5KKZC 1LP1B 1J1DC 1YIJP 1S5LH 1SQBG 1QX8A 1RY3A 1OMIA 1VDFA 2Z46A 4IL6H 3IR9A 1EQ7A 1VQLP 3H1HJ 1IFMA 1M56D 1BE3G 1FZEA 2AXCA 1OIPA 1KILE 3A0HH 1LT9B 4XFJA 1SLQA 2ZXEB 3Q20A 2HFED 3L74J 1P84E 5CHXA 3H4EA 4M3LA 2QJPB 2MJZA 3C1LA 4GKGA 2ZYGA 1YYCA 3KZIH 3L73E 2JWAA 1H0TA 1SQQJ 3WU2E 3TNUA 4U3FG 1PZQA 3I55P 3CX5E 7CEIA 4H44C 1QVGO 2KZIA 3NTEA 3TYYA 5GTHH 2Q6QA 2UWJE 1EMVA 3H1ID 1URQC 3LW5H 4IPYA 3AEGC 4NPFX 4TLFA 1IJDB 3HYBA 2K9JB 3LW5J 3DS4A 3FXDA 3KHUA 2NPSC 3CWBG 3AEDC 1GMJA 1PGJA 2FQ1A 5CCGD 4LC1A 1HBWA 1EOQA 2OARA 2YO3A 2XZRA 2IFNA 2BCCG 3L75G 4UB8H 5APTA 1NTMD 3H1LD 1P84I 2PRRA 2FXOA 3RK2B 4DG9A 3CXHI 4DOJA 3Q5PA 3FX0A 3S4RA 2M5RA 3JCUH 4YTPC 1W2EA 2ZAEB 4DT0A 1LJ2A 3RK3B 1SQQE 4GT1A 4I1LA 4XFZA 3PHLA 2BQ1E 1T3UA 5AW1B 2PGDA 3D6YA 1PEQA 3T97B 4EDFA 2O01J 2VLQA 3P7KA 1A02F 1L0ND 3KQGA 5AVWB 2N98A 1S9KD 1QVFO 2JYGA 3MD0A 2Y0EA 3AE6C 2K88A 1M6EX 5CBOA 5TISE 1J1EC 1LNQA 3A0BE 1S9KE 1W2BO 5KJ7D 1NTKD 1SQQK 2KZJA 2IBZG 2O1KA 4W80A 1FDMA 1EZVE 1LT1A 1BDDA 2P2UA 1NWQA 4XRQA 3M0AA 5AVSB 4H44D 2JU2A 3CWBE 5KP6B 1M90Q 1SQBK 1DD3A 3BRTB 1BCCG 2MR7A 1VKUA 4U3FJ 4XA4A 4UB6E 3JSVC 3GF7A 1T6AA 2DW3A 2K0XA 1FZBA 2KG8A 2ZVOB 2LOLA 4JYCA 3SWFA 2QJPC 2IYPA 1HY8A 1PGQA 3GHGC 3PRJA 3CXHD 3TGUJ 1VQ4P 4H0LB 1M74A 2PENA 2O1JA 1PEMA 2V7QJ 3R4YA 3IFMA 4D6TJ 3V5BA 1VQKP 1SQQG 4OGQD 2QRXA 2MVUA 5B5EH 1KN7A 3L74G 4HYTB 1NTZK 4JF7A 3KXDA 2KLVA 1K73Q 1LTBC 3MTUE 2QSIA 2IBZI 1IFIA 5TJHA 3TNUB 4WY4C 1UIIA 4M0IA 3L37A 3BATA 3CXHH 2XXMA 5GTIE 5AW3B 1RF1B 3WMM0 2GA1A 2E74C 1SQBE 3O6QB 2WPSA 2BHVA 5KJ7C 3TK1A 4BPFA 1U57A 1SQPE 2GDXA 1JCCA 3G0VA 4WB4A 5HGLA 2YIUB 2XT1A 3L75D 2FXMA 1JJ2O 1SQVK 1CI6B 1KB9H 1RH5B 4NEOA 1QL2A 1KB9D 1KFMA 3V2RA 4NPDA 4AQRD 2MY5A 4U3FD 1SP4A 2QJKC 1E79H 2EHTA 2POHA 3KYQA 3KDPB 5DCKA 1XTCC 3RK2C 3AEFC 1HUCA 1NTZE 2D2CD 2QVAA 4BPGA 4OGQB 1K04A 1EXIA 1KTMA 2IBZE 1P84H 4Y99B 4H0LD 2Z5IA 4W7ZA 1BDCA 2W6JH 4I6MC 3IAOA 1RF0C 2N1TB 3AEEC 1NTMG 3GJNA 1KZUB 1N2DC 3H1LG 3PLNA 3RGUA 4H2YC 1OR5A 2K9JA 1GL2C 1JMBA 5EJDA 2Y0DA 3PP5A 4N6JA 4IFDK 3ITKA 1YQ3C 4H44B 2QE7H 2YIUC 3W67A 1SQBJ 5GTIH 1KQFB 2H8PD 2BCCE 4WBAA 1RE3A 2WSEJ 1RHZB 1M7LA 5BU5A 2M8NA 4NPEA 1TU3F 2YKOA 2LL8A 1QLED 5KTBA 2FYZA 3PTZA 2FYUJ 3AEBC 1NH4A 4K3AA 2EFJA 2YKPA 1L0LE 1HGVA 3HD7C 1CW5A 4OH8B 2K94A 2WITA 3D70A 1BE3D 1NKZB 1M1JC 2CK3H 2IZ1A 2B87B 3FWNA 2QJKB 2E1MA 1H0TB 1OW8A 1NGMB 4PH1A 3RK2D 2BCCJ 5CJ0A 4K35A 5K5GB 3H1HG 1Q2NA 3P05A 1VF5D 1DV5A 3BCCE 2M0BA 1GL2B 5DJUB 1AA0A 1JY3P 1SFCC 1NU1G 4Y99C 3CI9A 1T8ZA 3L73J 4IZ6A 1SQBD 3A0BH 1IK7A 3T97A 3SSUA 1S5LE 1WT6A 1NTZG 1DEBA 4PH0A 1Z56A 2IYOA 4H2WC 3I5CA 2N1TD 2L6EA 1RF1A 1S1CX 1T3JA 2WPVB 3DS3A 1KC8Q 4WVZA 5AW8B 4XFYA 5CBNA 2VRSA 3DTJA 2WPTA 2RN0A 1KFNA 2N9YB 1FOSF 2IX7C 3Q3DA 1DH3A 1E0HA 3OJAB 1D1DA 5F2NA 1YJWP 3Q5RA 2D2CB 3SWKA 5KP7B 1N7SB 1FZCC 2Q3IA 4DCKA 2XNDH 1VQ7P 3CXHE 1JNMA 1NO4A 5KJ7A 2LKIA 3EJEA 3MIWA 2JBGA 1RE4C 3AE4C 4N78D 2GM4A 2JDIH 1AQTA 1SQVG 1X8YA 2C9NY 2FQ0A 4YPCA 5CCGA 5APYA 3GKLC 3L75E 2L0QA 2VLOA 2BASA 4GR2A 2E75D 2LXCB 5APQA 3E1IA 1LTJA 2KOQA 4PWVB 2PFXA 3JCUE 2Z44A 1VQOP 5AW4B 3G26A 2JO0A 1D7MA 1FDIA 3TGUG 1A43A 2V7QH 3HTKA 3CL3D 2FBWC 3VOPA 2Q5UA 1SS1A 2Q1KA 3FGAD 2WQYC 1GW3A 1G2CB 5L8RJ 3L73G 3CMEP 3NTNA 3EWKA 2J58A 2E76B 5AVQB 2K0YA 4EI2A 3BCCG 2HYNA 1EIAA 3H32B 3LMOA 3D71A 2E5TA 1NTZJ 1KLPA 2JJLA 4GIFA 3DS0A 1GU5A 1DX7A 2LF4A 5APVA 2QG4A 5AW5B 2OYIA 1L0NE 4R4MA 3H1HE 5AW0B 1BCCE 3GMAA 5JPAA 3HZQA 2AFEA 2X2BA 1SQXG 3VP8A 4GODA 2LTEA 3M9QA 2A45I 3M0DA 2E74D 3O6QA 4U0CA 2ERHA 1ZV8A 2FXPA 3HE5A 1M1KQ 1PFIA 2CNRA 2Q7CA 2CQ8A 3L71E 1VQPP 2NZ2A 1EDJA 4GOEA 2KLUA 3L74E 4JQ0D 2VLPA 1ZP0C 2WMMA 1JTHA 2GZEA 3L74D 3CWBJ 2K37A 1AVYA 4WY4B 2R3CA 3RL0g 3M0DC 2XU6A 2KGDA 2KOSA 1MZ9A 3TDKA 2YXRB 4Y28J 1T2KD 2KR5A 1Q81Q 1ZR2A 2L5GB 2FFDB 4A7PA 2MD9A 1FZGA 2PEJA 1PP9E 5B5EE 3ZDMA 4UB6H 2E76C 2R32A 2WWWA 1JEKA 5AVXB 1YJNP 4ASVA 1QRJA 2MR8A 1R8EA 4O9BA 2KNCB 3RG6C 1BE3J 2G3AA 1BCCD 1Y8AA 1RNIA 2M3BA 1RE4A 4YXWH 1QL1A 3AEAC 2ZT9D 1L0HA 1USDA 3H25A 1NTKJ 3HD7A 1GK6A 2M8PA 1FR2A 2PEOA 1KYOE 2P67A 2K0DX 2IBZD 2KOGA 1MKMA 3MGEA 2P58A 2J59M 5C39A 3GF3A 3V6IA 2OYIB 3MGNA 1OFCX 1SQXJ 5M1BA 4I7ZC 3O8ZA 2HODB 2AFDA 2M5AA 1JMMA 3CCSP 1OX3A 3ABVC 3JC22 3TF5A 1LTAC 1LP1A 3N4XA 5AW9B 3SFDC 5KLVJ 2R5BA 4PJ0H 2P7JA 1GXHA 2ITAA 2OYHB 1BAJA 1EC5A 3G71P 2NO8A 5AVZB 1FZFA 3AECC 2LMLA 1SQQD 2GZFA 5APWA 4GDOA 4GR6A 3OAKA 5TISH 2PEQA 4ZMDA 2XDJA 4HB1A 2EIAA 3L72E 1H8AA 2HR3A 2MF4A 1L0LD 1PEOA 3U59A 4PD4H 3CX5I 3NMDA 2FQ2A 2JU1A 1BGYJ 3A7OA 2W27A 1N7SA 1ZNVA 4H2XC 2KGCA 2RKLA 1LTTC 2K9YA 2QEXP 1HQBA 1G2CA 4EIJA 3PJSK 4QMAA 1LTSC 1GU4A 3H1JD 1PPJD 1SFCB 5B66H 3P32A 3H47A 2QJYC 2JEEA 2ZYDA 3N7NA 2RH0A 4C7RA 4ZKUA 4C46A 4BWNA 4HKGA 1KD1Q 4XROA 3U1AA 2OYIC 3RK3C 1L0NJ 2AF8A 2KGAA 2WZ7A 4PD4E 2NPSD 4BRYA 5HGNA 2FY8A 4TT3H 1L0LK 1BCCJ 3B5NB 1L4AA 1VHNA 3CC4P 1JY3O 4PV1D 3CC2P 3L73D 3H0DA 1OW6A 3HUSB 3UIAA 4CPGA 5KAIH 2KB7P 3P8CE 4WYMA 2O01H 1S72P 4PV1B 3RL0D 4IFMA 1MFTA 1JY2P 3HE4B 5GTHE 1X0TA 4COCA 2N6ZA 5BVZA 5CCHD 1KB9I 1SQVD 1X22A 1KILC 1L4AB 2Z5HA 5CMZA 1PP9J 4PD4D 3H1JJ 1KILB 2LXBA 2KP8A 2AEJA 1SFCA 4HKZH 3H1KD 2GZIA 2GYKA 3HD7B 1LTGC 1URQB 3HTKB 3B5NC 3TSIA 5AVTB 5KLIB 3AE9C 1VQ6P 3OW2O 2OTLP 1ACPA 1LTJB 3EFGA 3K5BA 2KIKA 1U7MA 2MKVA 2HODA 2E42A 1K30A 1YTZT 3C8VA 2JP3A 2AVAA 1S2EA 1JY2O 4UB8E 2GUVA 1M1JA 1ZMBA 2G8YA 3W68A 4HH2A 1A02J 1Y47A 3VN0A 4H13B 1NTMJ 3H1LJ 3AE5C 1W5CE 1NTKG 5KAIE 3I56P 5BS1A 5HGOA 2O3JA 2XV6A 1EDLA 3IF4A 1QEXA 1NVOA 1IFPA 2KK7A 3BASA 1PL5A 2ZJSE 1Q86Q 3EJDA 1QGKB 3WBHA 2J5UA 3LIEA 2KNCA 2YXQB 3RL0C 2M8LA 2FKWB 3IN6A 1GDTA 1RF1C 3RG2A 4R4LA 1K8AQ 1AF8A 2FHSC 2W90A 3PH0A 2R5DA 1X9VA 4UHPB 3VP9A 3NY7B 1VPCA 1N73C 2WT7A 2FYNC 1EDKA 3L70D 1PGOA 1BSNA 2CPBA 2ZFCA 5E79E 1R5LA 1FZCB 3V2NA 2OQQA 2JAZA 2PP6A 3EFFK 1CI6A 2LPKA 4DJGA 1NU1E 2KSEA 1AV1A 2OTKE 2YKQA 2BCCD 4L74A 2P10A 3M9HA 2K2QA 1USEA 3B4QA 1DNYA 4B86A 1RF0A 3CLQA 2EG5A 1L2PA 2N1TA 3L72G 3GHGB 1EZVI 4KJMA 1FC2C 1G1JA 1JM0A 2FVFA 3TGUD 3V4WA 5KAFH 1NTMK 5H2FE 1R5SA 1RO0A 1UNKA 5E79H 3BRVB 1VQNP 4H13D 1NAYA 1KQLA 2M8RA 1YTZI 3G1GA 3HE4A 4KT0J 3GLMA 2FFDA 4CA3A 1YJ9P 1YBKA 3VYIA 2HPCB 1SQPJ 3NFQA 2A06D 3CCMP 2JR8A 2V4HA 2M5AB 1IUQA 2K1AA 4I2LC 5AVRB 1H89A 2FADA 2A45G 3CCLP 2WSEH 2K92A 5CJ4A 2P9XA 1S3JA 3VTPC 1S4XA 2PY8A 1URQD 2K3RA 2YMKA 1BXIA 1P84D 2LIWA 3CPWO 3CX5D 1J1DB 4KHXA 4WWIA 2I1JA 2B89A 3GHGA 3H1IE 2JYLA 3WUUA 1ZN5A 2CG5B 3V2QA 1OVRA 1JOCA 3S1KA 1NTKE 2QIWA 1AUMA 1ZMEC 1EZVD 2A06E 2W8ZA 2KS1B 2WSFJ 4JBZA 1IFJA 4RJTA 2Y9ZA 1GK4A 1IO4A 1Q90D 1LT9A 1MUUA 4W7YA 4QNBA 1FZAA 1T2KC 4N78E 3B71A 1K05A 3LIDA 1OXZA 1GD2E 1YQ4C 3L71D 3KZIE 4U0BA 1U7JA 5AVYB 1NTZD 3CCQP 1NOHA 3AE3C 3MZWB 5KLVE 2YNYA 3D6ZA 2WPQA 4RKUJ 3AE1C 5AW6B 4U0FA 1KQGB 2KGEA 3L75J 5CCHA 3AE8C 3A5TA 3GG2A 1FDOA 3H1IJ 1K9MQ 2ZVNB 3CXCO 5KLIC 2YMYA 1OVUA 2N5IA 1SFCD 2L9FA 1NTME 3H1LE 3VMZA 4YXDC 1NAFA 1VF5C 2E75B 2CPSA 2KYVA 3G21A 1HVVA 1AVOA 3BCCD 3DS2A 2H88C 4AUWA 1HF9A 4N3YB 1LWUA 3L72D 3G28A 1JCDA 3OA7A 2KWLA 4U3FE 3WUTA 1X3OA 1LGHB 3II6A 4IFFA 2C9LY 2LR2A 3MUDC 3HUSA 1HH0A 1IMPA 1GZLA 1M1JB 2JQ4A 2FVAA 1ZOYC 3CCRP 4D6TD 4BRYB 1Z6MA 3M06A 1IC2A 1FAVA 3E1RA 3H1HD 1N7SD 1SQPD 4I7ZB 2JGPA 3SWYA 1IFDA 3QWOC 4XE5B 2L22A 3M1MA 3AE7C 3B4SA 4OGQC 3HUSC 5APUA 3Q2YA 1PP9G 3L71J 4BXLA 3H1JG 1URQA 2Q9IA 1LTJC 2B87A 4PXHB 2FACA 3G6EP 3RBXA 3R2PA 2JKVA 1NYHA 3G1IA 2WPRA 4L76A 1H88A 2Q3EA 3MP7B 1VQ9P 2FYUD 4RO0A 1HWTC 2ROQA 1SQVJ 2NPSA 1PGPA 4ASWA 2D2CC 5APSA 1YITP 3P8CD 2PNGA 5H2FH 1KORA 1PIXA 2ZT9B 1Q82Q 1NQ4A 1BGYD 4R0MA 1PPJG 1YHQP 1JY2N 2IFMA 2E75C 5F2KA 1ZLLA 5KP8B 2KSJA 1ZRTD 5DJTB 2H7HA 2OTJP 1M57D 1VF5B 1JUNA 2Z45A 3EJBA 3GZMA 1AQ5A 3HE5B 2VSQA 2KI7B 2W83C 1AFOA 1N8RQ 3KPEA 2K5XA 5KAFE 1DIPA 4C7NA 4PJ0E 1KYOH 3Q5SA 1N7SC 2KXPB 2QM8A 2C0WA 5CCGC 1JY3N 4H13C 1KILA 3RBZA 2CWOA 5BU8B 1FS0E
chains in the Genus database with same CATH topology
1W2BO 1K30A 3G0VA 3I55P 2EFJA 3M1MA 5HGLA 5F2NA 5JPAA 3HZQA 2XT1A 1YJWP 3H47A 2EG5A 3LRYA 3DPHA 5F2OA 1JJ2O 2M8PA 3G29A 1E6JP 1QVGO 4QNBA 3NTEA 1PEUA 4XRQA 2PEKA 1VQ7P 4U0AA 3CMAP 2PEOA 1ZMBA 3G6EP 3MGEA 1KD1Q 1M90Q 4IPYA 3CCVP 4XROA 4U0CA 1YI2P 4U0BA 4U0EA 1RO0A 3CCQP 4COPA 3DS5A 3G1IA 3HYBA 5DCKA 2E1MA 3G4SP 1VQNP 3DS4A 2BUOA 1RO2A 1M1KQ 1NJIQ 3I56P 1VQ9P 5BS1A 5HGOA 3CCJP 3G1GA 2XV6A 4U0FA 4PH1A 5HGNA 1VQPP 3CCSP 3B5IA 3CCUP 1K9MQ 3P05A 1YITP 1Q7YQ 3CC4P 3VRLC 1M6NA 3CXCO 1Q86Q 1YJ9P 3CC2P 3WBHA 2QA4P 4GR2A 1EOQA 1VQ5P 5HGMA 3H0DA 3CCMP 1VQ4P 2OARA 2M8LA 1BAJA 1M74A 2PENA 1Q82Q 3G71P 1YIJP 1PEMA 1IUQA 4WYMA 3CCEP 1K8AQ 1VQKP 2Z44A 1VQOP 3G26A 2JO0A 1S72P 3G21A 1A43A 1YHQP 1KQSO 3DS2A 5F2KA 3CCLP 2Z46A 2DGYA 3G28A 3CC7P 2OTJP 2P9XA 1Q81Q 2Z45A 4COCA 1VQLP 2PY8A 1K73Q 4GR6A 1D1DA 2PEQA 4PH0A 2PEJA 2EIAA 4U0DA 3Q20A 1N8RQ 2ONTA 2L6EA 3CPWO 4M0IA 3CMEP 4XFZA 3DS3A 1KC8Q 1PEOA 1A8OA 5I4TG 1YJNP 4XFYA 2PEMA 2XXMA 2BQ1E 1QRJA 3DS1A 1PEQA 2PEIA 1EIAA 3DTJA 3H4EA 2JYLA 3RG6C 3CCRP 3DS0A 1VQ6P 1QVFO 1RNIA 2JYGA 4XFXA 1AUMA 5BS2A 3OW2O 2M8NA 3CD6P 1VQMP 2LF4A 1VQ8P 2OTLP 1M6EX 2BHVA 2QEXP 2CWOA 3E2DA 2KODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B O;  3CME P;  3I55 P;  1NJI Q;  1KC8 Q;  3I56 P;  1M1K Q;  1VQ9 P;  3CCE P;  1YJN P;  1K8A Q;  3CCJ P;  1VQK P;  1YJW P;  1VQO P;  1S72 P;  1JJ2 O;  1YHQ P;  1KQS O;  1YIJ P;  1QVG O;  3CCL P;  1VQP P;  3CCS P;  1VQ7 P;  3CCR P;  3CMA P;  3CC7 P;  3CCU P;  2OTJ P;  1Q81 Q;  1K9M Q;  1VQL P;  1YIT P;  1Q7Y Q;  3G6E P;  3CC4 P;  1K73 Q;  1VQ6 P;  1KD1 Q;  1M90 Q;  1QVF O;  3CXC O;  1Q86 Q;  1YJ9 P;  3OW2 O;  3CC2 P;  3CCV P;  1VQM P;  3CD6 P;  1VQ8 P;  2QA4 P;  2OTL P;  1YI2 P;  2QEX P;  1VQ5 P;  3CCQ P;  3CCM P;  1VQ4 P;  1N8R Q;  3CPW O;  1Q82 Q;  3G4S P;  3G71 P;  1VQN P; 
#chains in the Genus database with same CATH topology
 2FVE A;  1E5W A;  3HRN A;  2QNW A;  4IL6 E;  2E5Y A;  2W6A A;  1GPJ A;  2A45 H;  1GL2 A;  3L70 J;  2JB0 A;  2XNX A;  2WTY A;  4IOI H;  2PEK A;  1L0L J;  4U0A A;  3HD7 D;  3H32 A;  1EXJ A;  1KYO I;  5KLV D;  1KIL D;  1SVF A;  4LGD E;  4AYC A;  1YI2 P;  3P8M C;  2B88 A;  1N73 B;  4EOT A;  4U7J A;  2MVV A;  1L4A D;  1CSB A;  2BUO A;  1RO2 A;  5EW5 E;  2E74 B;  3B5N A;  4RES B;  4L73 A;  1FBM A;  3H6P A;  4D6T G;  2AXT H;  1JB0 J;  1IFN A;  3F5H A;  1HJ0 A;  1M6N A;  5AVU B;  2XV5 A;  1KB9 E;  1CEI A;  2LIU A;  3QH9 A;  3A2A A;  4ZNC A;  1LWU B;  1GXG A;  4LLH A;  3F89 A;  1WMK A;  2N5H A;  3CCE P;  3G3Z A;  2BEQ D;  2WSS H;  1KQS O;  1IMQ A;  1FJP A;  5KLV G;  3CC7 P;  4F37 A;  1SQX D;  3H1K E;  2E76 D;  2H89 C;  2GDY A;  2QM7 A;  2AEM A;  5EFW B;  4U0D A;  2OYH A;  2AEF A;  4PV1 C;  2B9B A;  5I4T G;  2Z4E A;  1KYO D;  1L0N G;  1OWA A;  2FYU G;  1ZXG A;  2KS1 A;  2BEZ F;  1X79 B;  4HJG H;  1FOS E;  3L36 A;  3CWB D;  5KKZ B;  1SQX E;  2KOO A;  3MUD A;  4WY4 A;  4XFX A;  4Z1M H;  3CD6 P;  1CZQ A;  1PPJ E;  1VQM P;  2RMZ A;  2KG6 A;  3L35 A;  5AVV B;  3FWL A;  2KOD A;  2GZG A;  1MZ8 A;  1BGY G;  1N7L A;  2ZT9 C;  3LRY A;  1AYI A;  1MFZ A;  4JYB A;  1FZC A;  1PEU A;  2NRG A;  1HGZ A;  3CMA P;  1VL2 A;  1DEE G;  2L4B A;  3VMA A;  2KG9 A;  4D6T E;  2EHS A;  3CE7 A;  1SQP G;  5APX A;  1N86 A;  3FXE A;  4IL6 X;  3CCV P;  1HTL C;  2FFD C;  3Q1M A;  1SQX K;  4DZO A;  1PP9 D;  5HVC A;  2PAJ A;  3G4S P;  2FYN B;  1EZV G;  3L70 G;  1L0I A;  3GW6 A;  1GTW A;  1RE3 C;  3B5I A;  2AXT E;  2XKM A;  1Q7Y Q;  3VRL C;  1EDI A;  3A0H E;  4OVN F;  3CX5 H;  1NTK K;  1UIX A;  2QA4 P;  5HGM A;  5HV8 A;  1RQV A;  2Y9Y A;  3L71 G;  2C0X A;  1S5L X;  2OYO A;  1OVV A;  3WUV A;  2HPC A;  2WSF H;  2OGU A;  1T8K A;  2SPZ A;  1Y9B A;  3B8E B;  2DNW A;  1L4A C;  1NHL A;  4MN4 C;  4BPH A;  4H0L C;  2I8D A;  2PEI A;  1AJY A;  3NXS A;  1BGY E;  3L4F A;  1BSH A;  2P1J A;  2IZ0 A;  2FAE A;  3AE2 C;  1VQ8 P;  4QKO A;  5B66 E;  2Y0C A;  3L72 J;  5AW7 B;  2N6Y A;  3BCC J;  3E2D A;  2IPP A;  2ZXX A;  1GL2 D;  1OZH A;  2H43 A;  3DPH A;  2JO1 A;  2GDW A;  1LTI C;  4OWF A;  2WT7 B;  1IZN B;  3VMY A;  1WRG A;  1JTH B;  1NU1 D;  4U0E A;  2GZJ A;  1RQU A;  4COP A;  3DS5 A;  1F80 D;  1M8O B;  1LT9 C;  3GZL A;  1J1E B;  1NJI Q;  1FJK A;  5CZD B;  1L0N K;  2WSC J;  3C9I A;  2LKM A;  3RK3 D;  1FE6 A;  2KUB A;  5AW2 B;  2WSC H;  2YO2 A;  2QJY B;  4WY4 D;  2L91 A;  1NKN A;  2KOR A;  3EQ2 A;  3V2P A;  3BVH A;  4GOF A;  1VQ5 P;  3A3Y B;  1OW7 A;  1PV3 A;  1SQP K;  2I1K A;  5KLV K;  1LWU C;  2WVR A;  2GUS A;  2DGY A;  4MRT C;  1NU1 J;  2JWD A;  2N1T C;  1KMI Z;  2E43 A;  3G9R A;  3L70 E;  4L75 A;  1FU1 A;  3H1I G;  4C7N B;  2HLO A;  2ONT A;  3MHV A;  2KOP A;  1ZRT E;  2O01 N;  4PD4 I;  3E7K A;  3RL0 B;  3RK3 E;  1A8O A;  5CCH C;  1NU1 K;  2PEM A;  2K93 A;  1GW4 A;  3DS1 A;  2N9B A;  1BE3 E;  3M9B A;  2N50 A;  3V4Q A;  2W6B A;  2FYU K;  3H1J E;  2VLN A;  5BS2 A;  2OYH C;  1HJB A;  3B5N D;  2R3S A;  3H1K G;  3SFE C;  1N73 A;  1JO5 A;  5F2O A;  3G29 A;  1E6J P;  2R44 A;  1MV8 A;  1KV4 A;  2NPS B;  1DD4 A;  3VMX A;  2FYU E;  3TGU E;  1IK9 A;  2IDB A;  1XTG B;  2XZ0 D;  1L0L G;  2KW2 A;  1J2J B;  3M91 A;  3WU2 H;  1ZW0 A;  1UJZ A;  4ZKP A;  1G1I A;  2M3E A;  3H1K J;  3CCJ P;  3USS A;  3U1C A;  2HG5 D;  2A06 G;  3S9O A;  2ZYA A;  4EYY Q;  2XZ1 C;  2CGQ A;  3CCU P;  4JPZ B;  1SQV E;  3U43 A;  1ZR4 A;  5KKZ C;  1LP1 B;  1J1D C;  1YIJ P;  1S5L H;  1SQB G;  1QX8 A;  1RY3 A;  1OMI A;  1VDF A;  2Z46 A;  4IL6 H;  3IR9 A;  1EQ7 A;  1VQL P;  3H1H J;  1IFM A;  1M56 D;  1BE3 G;  1FZE A;  2AXC A;  1OIP A;  1KIL E;  3A0H H;  1LT9 B;  4XFJ A;  1SLQ A;  2ZXE B;  3Q20 A;  2HFE D;  3L74 J;  1P84 E;  5CHX A;  3H4E A;  4M3L A;  2QJP B;  2MJZ A;  3C1L A;  4GKG A;  2ZYG A;  1YYC A;  3KZI H;  3L73 E;  2JWA A;  1H0T A;  1SQQ J;  3WU2 E;  3TNU A;  4U3F G;  1PZQ A;  3I55 P;  3CX5 E;  7CEI A;  4H44 C;  1QVG O;  2KZI A;  3NTE A;  3TYY A;  5GTH H;  2Q6Q A;  2UWJ E;  1EMV A;  3H1I D;  1URQ C;  3LW5 H;  4IPY A;  3AEG C;  4NPF X;  4TLF A;  1IJD B;  3HYB A;  2K9J B;  3LW5 J;  3DS4 A;  3FXD A;  3KHU A;  2NPS C;  3CWB G;  3AED C;  1GMJ A;  1PGJ A;  2FQ1 A;  5CCG D;  4LC1 A;  1HBW A;  1EOQ A;  2OAR A;  2YO3 A;  2XZR A;  2IFN A;  2BCC G;  3L75 G;  4UB8 H;  5APT A;  1NTM D;  3H1L D;  1P84 I;  2PRR A;  2FXO A;  3RK2 B;  4DG9 A;  3CXH I;  4DOJ A;  3Q5P A;  3FX0 A;  3S4R A;  2M5R A;  3JCU H;  4YTP C;  1W2E A;  2ZAE B;  4DT0 A;  1LJ2 A;  3RK3 B;  1SQQ E;  4GT1 A;  4I1L A;  4XFZ A;  3PHL A;  2BQ1 E;  1T3U A;  5AW1 B;  2PGD A;  3D6Y A;  1PEQ A;  3T97 B;  4EDF A;  2O01 J;  2VLQ A;  3P7K A;  1A02 F;  1L0N D;  3KQG A;  5AVW B;  2N98 A;  1S9K D;  1QVF O;  2JYG A;  3MD0 A;  2Y0E A;  3AE6 C;  2K88 A;  1M6E X;  5CBO A;  5TIS E;  1J1E C;  1LNQ A;  3A0B E;  1S9K E;  1W2B O;  5KJ7 D;  1NTK D;  1SQQ K;  2KZJ A;  2IBZ G;  2O1K A;  4W80 A;  1FDM A;  1EZV E;  1LT1 A;  1BDD A;  2P2U A;  1NWQ A;  4XRQ A;  3M0A A;  5AVS B;  4H44 D;  2JU2 A;  3CWB E;  5KP6 B;  1M90 Q;  1SQB K;  1DD3 A;  3BRT B;  1BCC G;  2MR7 A;  1VKU A;  4U3F J;  4XA4 A;  4UB6 E;  3JSV C;  3GF7 A;  1T6A A;  2DW3 A;  2K0X A;  1FZB A;  2KG8 A;  2ZVO B;  2LOL A;  4JYC A;  3SWF A;  2QJP C;  2IYP A;  1HY8 A;  1PGQ A;  3GHG C;  3PRJ A;  3CXH D;  3TGU J;  1VQ4 P;  4H0L B;  1M74 A;  2PEN A;  2O1J A;  1PEM A;  2V7Q J;  3R4Y A;  3IFM A;  4D6T J;  3V5B A;  1VQK P;  1SQQ G;  4OGQ D;  2QRX A;  2MVU A;  5B5E H;  1KN7 A;  3L74 G;  4HYT B;  1NTZ K;  4JF7 A;  3KXD A;  2KLV A;  1K73 Q;  1LTB C;  3MTU E;  2QSI A;  2IBZ I;  1IFI A;  5TJH A;  3TNU B;  4WY4 C;  1UII A;  4M0I A;  3L37 A;  3BAT A;  3CXH H;  2XXM A;  5GTI E;  5AW3 B;  1RF1 B;  3WMM 0;  2GA1 A;  2E74 C;  1SQB E;  3O6Q B;  2WPS A;  2BHV A;  5KJ7 C;  3TK1 A;  4BPF A;  1U57 A;  1SQP E;  2GDX A;  1JCC A;  3G0V A;  4WB4 A;  5HGL A;  2YIU B;  2XT1 A;  3L75 D;  2FXM A;  1JJ2 O;  1SQV K;  1CI6 B;  1KB9 H;  1RH5 B;  4NEO A;  1QL2 A;  1KB9 D;  1KFM A;  3V2R A;  4NPD A;  4AQR D;  2MY5 A;  4U3F D;  1SP4 A;  2QJK C;  1E79 H;  2EHT A;  2POH A;  3KYQ A;  3KDP B;  5DCK A;  1XTC C;  3RK2 C;  3AEF C;  1HUC A;  1NTZ E;  2D2C D;  2QVA A;  4BPG A;  4OGQ B;  1K04 A;  1EXI A;  1KTM A;  2IBZ E;  1P84 H;  4Y99 B;  4H0L D;  2Z5I A;  4W7Z A;  1BDC A;  2W6J H;  4I6M C;  3IAO A;  1RF0 C;  2N1T B;  3AEE C;  1NTM G;  3GJN A;  1KZU B;  1N2D C;  3H1L G;  3PLN A;  3RGU A;  4H2Y C;  1OR5 A;  2K9J A;  1GL2 C;  1JMB A;  5EJD A;  2Y0D A;  3PP5 A;  4N6J A;  4IFD K;  3ITK A;  1YQ3 C;  4H44 B;  2QE7 H;  2YIU C;  3W67 A;  1SQB J;  5GTI H;  1KQF B;  2H8P D;  2BCC E;  4WBA A;  1RE3 A;  2WSE J;  1RHZ B;  1M7L A;  5BU5 A;  2M8N A;  4NPE A;  1TU3 F;  2YKO A;  2LL8 A;  1QLE D;  5KTB A;  2FYZ A;  3PTZ A;  2FYU J;  3AEB C;  1NH4 A;  4K3A A;  2EFJ A;  2YKP A;  1L0L E;  1HGV A;  3HD7 C;  1CW5 A;  4OH8 B;  2K94 A;  2WIT A;  3D70 A;  1BE3 D;  1NKZ B;  1M1J C;  2CK3 H;  2IZ1 A;  2B87 B;  3FWN A;  2QJK B;  2E1M A;  1H0T B;  1OW8 A;  1NGM B;  4PH1 A;  3RK2 D;  2BCC J;  5CJ0 A;  4K35 A;  5K5G B;  3H1H G;  1Q2N A;  3P05 A;  1VF5 D;  1DV5 A;  3BCC E;  2M0B A;  1GL2 B;  5DJU B;  1AA0 A;  1JY3 P;  1SFC C;  1NU1 G;  4Y99 C;  3CI9 A;  1T8Z A;  3L73 J;  4IZ6 A;  1SQB D;  3A0B H;  1IK7 A;  3T97 A;  3SSU A;  1S5L E;  1WT6 A;  1NTZ G;  1DEB A;  4PH0 A;  1Z56 A;  2IYO A;  4H2W C;  3I5C A;  2N1T D;  2L6E A;  1RF1 A;  1S1C X;  1T3J A;  2WPV B;  3DS3 A;  1KC8 Q;  4WVZ A;  5AW8 B;  4XFY A;  5CBN A;  2VRS A;  3DTJ A;  2WPT A;  2RN0 A;  1KFN A;  2N9Y B;  1FOS F;  2IX7 C;  3Q3D A;  1DH3 A;  1E0H A;  3OJA B;  1D1D A;  5F2N A;  1YJW P;  3Q5R A;  2D2C B;  3SWK A;  5KP7 B;  1N7S B;  1FZC C;  2Q3I A;  4DCK A;  2XND H;  1VQ7 P;  3CXH E;  1JNM A;  1NO4 A;  5KJ7 A;  2LKI A;  3EJE A;  3MIW A;  2JBG A;  1RE4 C;  3AE4 C;  4N78 D;  2GM4 A;  2JDI H;  1AQT A;  1SQV G;  1X8Y A;  2C9N Y;  2FQ0 A;  4YPC A;  5CCG A;  5APY A;  3GKL C;  3L75 E;  2L0Q A;  2VLO A;  2BAS A;  4GR2 A;  2E75 D;  2LXC B;  5APQ A;  3E1I A;  1LTJ A;  2KOQ A;  4PWV B;  2PFX A;  3JCU E;  2Z44 A;  1VQO P;  5AW4 B;  3G26 A;  2JO0 A;  1D7M A;  1FDI A;  3TGU G;  1A43 A;  2V7Q H;  3HTK A;  3CL3 D;  2FBW C;  3VOP A;  2Q5U A;  1SS1 A;  2Q1K A;  3FGA D;  2WQY C;  1GW3 A;  1G2C B;  5L8R J;  3L73 G;  3CME P;  3NTN A;  3EWK A;  2J58 A;  2E76 B;  5AVQ B;  2K0Y A;  4EI2 A;  3BCC G;  2HYN A;  1EIA A;  3H32 B;  3LMO A;  3D71 A;  2E5T A;  1NTZ J;  1KLP A;  2JJL A;  4GIF A;  3DS0 A;  1GU5 A;  1DX7 A;  2LF4 A;  5APV A;  2QG4 A;  5AW5 B;  2OYI A;  1L0N E;  4R4M A;  3H1H E;  5AW0 B;  1BCC E;  3GMA A;  5JPA A;  3HZQ A;  2AFE A;  2X2B A;  1SQX G;  3VP8 A;  4GOD A;  2LTE A;  3M9Q A;  2A45 I;  3M0D A;  2E74 D;  3O6Q A;  4U0C A;  2ERH A;  1ZV8 A;  2FXP A;  3HE5 A;  1M1K Q;  1PFI A;  2CNR A;  2Q7C A;  2CQ8 A;  3L71 E;  1VQP P;  2NZ2 A;  1EDJ A;  4GOE A;  2KLU A;  3L74 E;  4JQ0 D;  2VLP A;  1ZP0 C;  2WMM A;  1JTH A;  2GZE A;  3L74 D;  3CWB J;  2K37 A;  1AVY A;  4WY4 B;  2R3C A;  3RL0 g;  3M0D C;  2XU6 A;  2KGD A;  2KOS A;  1MZ9 A;  3TDK A;  2YXR B;  4Y28 J;  1T2K D;  2KR5 A;  1Q81 Q;  1ZR2 A;  2L5G B;  2FFD B;  4A7P A;  2MD9 A;  1FZG A;  2PEJ A;  1PP9 E;  5B5E E;  3ZDM A;  4UB6 H;  2E76 C;  2R32 A;  2WWW A;  1JEK A;  5AVX B;  1YJN P;  4ASV A;  1QRJ A;  2MR8 A;  1R8E A;  4O9B A;  2KNC B;  3RG6 C;  1BE3 J;  2G3A A;  1BCC D;  1Y8A A;  1RNI A;  2M3B A;  1RE4 A;  4YXW H;  1QL1 A;  3AEA C;  2ZT9 D;  1L0H A;  1USD A;  3H25 A;  1NTK J;  3HD7 A;  1GK6 A;  2M8P A;  1FR2 A;  2PEO A;  1KYO E;  2P67 A;  2K0D X;  2IBZ D;  2KOG A;  1MKM A;  3MGE A;  2P58 A;  2J59 M;  5C39 A;  3GF3 A;  3V6I A;  2OYI B;  3MGN A;  1OFC X;  1SQX J;  5M1B A;  4I7Z C;  3O8Z A;  2HOD B;  2AFD A;  2M5A A;  1JMM A;  3CCS P;  1OX3 A;  3ABV C;  3JC2 2;  3TF5 A;  1LTA C;  1LP1 A;  3N4X A;  5AW9 B;  3SFD C;  5KLV J;  2R5B A;  4PJ0 H;  2P7J A;  1GXH A;  2ITA A;  2OYH B;  1BAJ A;  1EC5 A;  3G71 P;  2NO8 A;  5AVZ B;  1FZF A;  3AEC C;  2LML A;  1SQQ D;  2GZF A;  5APW A;  4GDO A;  4GR6 A;  3OAK A;  5TIS H;  2PEQ A;  4ZMD A;  2XDJ A;  4HB1 A;  2EIA A;  3L72 E;  1H8A A;  2HR3 A;  2MF4 A;  1L0L D;  1PEO A;  3U59 A;  4PD4 H;  3CX5 I;  3NMD A;  2FQ2 A;  2JU1 A;  1BGY J;  3A7O A;  2W27 A;  1N7S A;  1ZNV A;  4H2X C;  2KGC A;  2RKL A;  1LTT C;  2K9Y A;  2QEX P;  1HQB A;  1G2C A;  4EIJ A;  3PJS K;  4QMA A;  1LTS C;  1GU4 A;  3H1J D;  1PPJ D;  1SFC B;  5B66 H;  3P32 A;  3H47 A;  2QJY C;  2JEE A;  2ZYD A;  3N7N A;  2RH0 A;  4C7R A;  4ZKU A;  4C46 A;  4BWN A;  4HKG A;  1KD1 Q;  4XRO A;  3U1A A;  2OYI C;  3RK3 C;  1L0N J;  2AF8 A;  2KGA A;  2WZ7 A;  4PD4 E;  2NPS D;  4BRY A;  5HGN A;  2FY8 A;  4TT3 H;  1L0L K;  1BCC J;  3B5N B;  1L4A A;  1VHN A;  3CC4 P;  1JY3 O;  4PV1 D;  3CC2 P;  3L73 D;  3H0D A;  1OW6 A;  3HUS B;  3UIA A;  4CPG A;  5KAI H;  2KB7 P;  3P8C E;  4WYM A;  2O01 H;  1S72 P;  4PV1 B;  3RL0 D;  4IFM A;  1MFT A;  1JY2 P;  3HE4 B;  5GTH E;  1X0T A;  4COC A;  2N6Z A;  5BVZ A;  5CCH D;  1KB9 I;  1SQV D;  1X22 A;  1KIL C;  1L4A B;  2Z5H A;  5CMZ A;  1PP9 J;  4PD4 D;  3H1J J;  1KIL B;  2LXB A;  2KP8 A;  2AEJ A;  1SFC A;  4HKZ H;  3H1K D;  2GZI A;  2GYK A;  3HD7 B;  1LTG C;  1URQ B;  3HTK B;  3B5N C;  3TSI A;  5AVT B;  5KLI B;  3AE9 C;  1VQ6 P;  3OW2 O;  2OTL P;  1ACP A;  1LTJ B;  3EFG A;  3K5B A;  2KIK A;  1U7M A;  2MKV A;  2HOD A;  2E42 A;  1K30 A;  1YTZ T;  3C8V A;  2JP3 A;  2AVA A;  1S2E A;  1JY2 O;  4UB8 E;  2GUV A;  1M1J A;  1ZMB A;  2G8Y A;  3W68 A;  4HH2 A;  1A02 J;  1Y47 A;  3VN0 A;  4H13 B;  1NTM J;  3H1L J;  3AE5 C;  1W5C E;  1NTK G;  5KAI E;  3I56 P;  5BS1 A;  5HGO A;  2O3J A;  2XV6 A;  1EDL A;  3IF4 A;  1QEX A;  1NVO A;  1IFP A;  2KK7 A;  3BAS A;  1PL5 A;  2ZJS E;  1Q86 Q;  3EJD A;  1QGK B;  3WBH A;  2J5U A;  3LIE A;  2KNC A;  2YXQ B;  3RL0 C;  2M8L A;  2FKW B;  3IN6 A;  1GDT A;  1RF1 C;  3RG2 A;  4R4L A;  1K8A Q;  1AF8 A;  2FHS C;  2W90 A;  3PH0 A;  2R5D A;  1X9V A;  4UHP B;  3VP9 A;  3NY7 B;  1VPC A;  1N73 C;  2WT7 A;  2FYN C;  1EDK A;  3L70 D;  1PGO A;  1BSN A;  2CPB A;  2ZFC A;  5E79 E;  1R5L A;  1FZC B;  3V2N A;  2OQQ A;  2JAZ A;  2PP6 A;  3EFF K;  1CI6 A;  2LPK A;  4DJG A;  1NU1 E;  2KSE A;  1AV1 A;  2OTK E;  2YKQ A;  2BCC D;  4L74 A;  2P10 A;  3M9H A;  2K2Q A;  1USE A;  3B4Q A;  1DNY A;  4B86 A;  1RF0 A;  3CLQ A;  2EG5 A;  1L2P A;  2N1T A;  3L72 G;  3GHG B;  1EZV I;  4KJM A;  1FC2 C;  1G1J A;  1JM0 A;  2FVF A;  3TGU D;  3V4W A;  5KAF H;  1NTM K;  5H2F E;  1R5S A;  1RO0 A;  1UNK A;  5E79 H;  3BRV B;  1VQN P;  4H13 D;  1NAY A;  1KQL A;  2M8R A;  1YTZ I;  3G1G A;  3HE4 A;  4KT0 J;  3GLM A;  2FFD A;  4CA3 A;  1YJ9 P;  1YBK A;  3VYI A;  2HPC B;  1SQP J;  3NFQ A;  2A06 D;  3CCM P;  2JR8 A;  2V4H A;  2M5A B;  1IUQ A;  2K1A A;  4I2L C;  5AVR B;  1H89 A;  2FAD A;  2A45 G;  3CCL P;  2WSE H;  2K92 A;  5CJ4 A;  2P9X A;  1S3J A;  3VTP C;  1S4X A;  2PY8 A;  1URQ D;  2K3R A;  2YMK A;  1BXI A;  1P84 D;  2LIW A;  3CPW O;  3CX5 D;  1J1D B;  4KHX A;  4WWI A;  2I1J A;  2B89 A;  3GHG A;  3H1I E;  2JYL A;  3WUU A;  1ZN5 A;  2CG5 B;  3V2Q A;  1OVR A;  1JOC A;  3S1K A;  1NTK E;  2QIW A;  1AUM A;  1ZME C;  1EZV D;  2A06 E;  2W8Z A;  2KS1 B;  2WSF J;  4JBZ A;  1IFJ A;  4RJT A;  2Y9Z A;  1GK4 A;  1IO4 A;  1Q90 D;  1LT9 A;  1MUU A;  4W7Y A;  4QNB A;  1FZA A;  1T2K C;  4N78 E;  3B71 A;  1K05 A;  3LID A;  1OXZ A;  1GD2 E;  1YQ4 C;  3L71 D;  3KZI E;  4U0B A;  1U7J A;  5AVY B;  1NTZ D;  3CCQ P;  1NOH A;  3AE3 C;  3MZW B;  5KLV E;  2YNY A;  3D6Z A;  2WPQ A;  4RKU J;  3AE1 C;  5AW6 B;  4U0F A;  1KQG B;  2KGE A;  3L75 J;  5CCH A;  3AE8 C;  3A5T A;  3GG2 A;  1FDO A;  3H1I J;  1K9M Q;  2ZVN B;  3CXC O;  5KLI C;  2YMY A;  1OVU A;  2N5I A;  1SFC D;  2L9F A;  1NTM E;  3H1L E;  3VMZ A;  4YXD C;  1NAF A;  1VF5 C;  2E75 B;  2CPS A;  2KYV A;  3G21 A;  1HVV A;  1AVO A;  3BCC D;  3DS2 A;  2H88 C;  4AUW A;  1HF9 A;  4N3Y B;  1LWU A;  3L72 D;  3G28 A;  1JCD A;  3OA7 A;  2KWL A;  4U3F E;  3WUT A;  1X3O A;  1LGH B;  3II6 A;  4IFF A;  2C9L Y;  2LR2 A;  3MUD C;  3HUS A;  1HH0 A;  1IMP A;  1GZL A;  1M1J B;  2JQ4 A;  2FVA A;  1ZOY C;  3CCR P;  4D6T D;  4BRY B;  1Z6M A;  3M06 A;  1IC2 A;  1FAV A;  3E1R A;  3H1H D;  1N7S D;  1SQP D;  4I7Z B;  2JGP A;  3SWY A;  1IFD A;  3QWO C;  4XE5 B;  2L22 A;  3M1M A;  3AE7 C;  3B4S A;  4OGQ C;  3HUS C;  5APU A;  3Q2Y A;  1PP9 G;  3L71 J;  4BXL A;  3H1J G;  1URQ A;  2Q9I A;  1LTJ C;  2B87 A;  4PXH B;  2FAC A;  3G6E P;  3RBX A;  3R2P A;  2JKV A;  1NYH A;  3G1I A;  2WPR A;  4L76 A;  1H88 A;  2Q3E A;  3MP7 B;  1VQ9 P;  2FYU D;  4RO0 A;  1HWT C;  2ROQ A;  1SQV J;  2NPS A;  1PGP A;  4ASW A;  2D2C C;  5APS A;  1YIT P;  3P8C D;  2PNG A;  5H2F H;  1KOR A;  1PIX A;  2ZT9 B;  1Q82 Q;  1NQ4 A;  1BGY D;  4R0M A;  1PPJ G;  1YHQ P;  1JY2 N;  2IFM A;  2E75 C;  5F2K A;  1ZLL A;  5KP8 B;  2KSJ A;  1ZRT D;  5DJT B;  2H7H A;  2OTJ P;  1M57 D;  1VF5 B;  1JUN A;  2Z45 A;  3EJB A;  3GZM A;  1AQ5 A;  3HE5 B;  2VSQ A;  2KI7 B;  2W83 C;  1AFO A;  1N8R Q;  3KPE A;  2K5X A;  5KAF E;  1DIP A;  4C7N A;  4PJ0 E;  1KYO H;  3Q5S A;  1N7S C;  2KXP B;  2QM8 A;  2C0W A;  5CCG C;  1JY3 N;  4H13 C;  1KIL A;  3RBZ A;  2CWO A;  5BU8 B;  1FS0 E; 
#chains in the Genus database with same CATH homology
 1W2B O;  1K30 A;  3G0V A;  3I55 P;  2EFJ A;  3M1M A;  5HGL A;  5F2N A;  5JPA A;  3HZQ A;  2XT1 A;  1YJW P;  3H47 A;  2EG5 A;  3LRY A;  3DPH A;  5F2O A;  1JJ2 O;  2M8P A;  3G29 A;  1E6J P;  1QVG O;  4QNB A;  3NTE A;  1PEU A;  4XRQ A;  2PEK A;  1VQ7 P;  4U0A A;  3CMA P;  2PEO A;  1ZMB A;  3G6E P;  3MGE A;  1KD1 Q;  1M90 Q;  4IPY A;  3CCV P;  4XRO A;  4U0C A;  1YI2 P;  4U0B A;  4U0E A;  1RO0 A;  3CCQ P;  4COP A;  3DS5 A;  3G1I A;  3HYB A;  5DCK A;  2E1M A;  3G4S P;  1VQN P;  3DS4 A;  2BUO A;  1RO2 A;  1M1K Q;  1NJI Q;  3I56 P;  1VQ9 P;  5BS1 A;  5HGO A;  3CCJ P;  3G1G A;  2XV6 A;  4U0F A;  4PH1 A;  5HGN A;  1VQP P;  3CCS P;  3B5I A;  3CCU P;  1K9M Q;  3P05 A;  1YIT P;  1Q7Y Q;  3CC4 P;  3VRL C;  1M6N A;  3CXC O;  1Q86 Q;  1YJ9 P;  3CC2 P;  3WBH A;  2QA4 P;  4GR2 A;  1EOQ A;  1VQ5 P;  5HGM A;  3H0D A;  3CCM P;  1VQ4 P;  2OAR A;  2M8L A;  1BAJ A;  1M74 A;  2PEN A;  1Q82 Q;  3G71 P;  1YIJ P;  1PEM A;  1IUQ A;  4WYM A;  3CCE P;  1K8A Q;  1VQK P;  2Z44 A;  1VQO P;  3G26 A;  2JO0 A;  1S72 P;  3G21 A;  1A43 A;  1YHQ P;  1KQS O;  3DS2 A;  5F2K A;  3CCL P;  2Z46 A;  2DGY A;  3G28 A;  3CC7 P;  2OTJ P;  2P9X A;  1Q81 Q;  2Z45 A;  4COC A;  1VQL P;  2PY8 A;  1K73 Q;  4GR6 A;  1D1D A;  2PEQ A;  4PH0 A;  2PEJ A;  2EIA A;  4U0D A;  3Q20 A;  1N8R Q;  2ONT A;  2L6E A;  3CPW O;  4M0I A;  3CME P;  4XFZ A;  3DS3 A;  1KC8 Q;  1PEO A;  1A8O A;  5I4T G;  1YJN P;  4XFY A;  2PEM A;  2XXM A;  2BQ1 E;  1QRJ A;  3DS1 A;  1PEQ A;  2PEI A;  1EIA A;  3DTJ A;  3H4E A;  2JYL A;  3RG6 C;  3CCR P;  3DS0 A;  1VQ6 P;  1QVF O;  1RNI A;  2JYG A;  4XFX A;  1AUM A;  5BS2 A;  3OW2 O;  2M8N A;  3CD6 P;  1VQM P;  2LF4 A;  1VQ8 P;  2OTL P;  1M6E X;  2BHV A;  2QEX P;  2CWO A;  3E2D A;  2KOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...