1N8RQ

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1n8rQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1n8rQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1n8rQ03
1W2BO 1YHQP 1K73Q 1NJIQ 1KQSO 1JJ2O 3CD6P 3CCUP 3CC4P 3CCVP 1VQ5P 3CCSP 1VQPP 1YI2P 1VQOP 1VQMP 1QVGO 1KC8Q 1N8RQ 3I55P 3CC7P 1VQ9P 3G71P 1Q86Q 2OTJP 1K9MQ 1K8AQ 1M90Q 1KD1Q 1YJ9P 3CC2P 2QEXP 3CPWO 3CCMP 3OW2O 3G4SP 1S72P 1VQKP 3CCRP 2QA4P 1YIJP 3CCLP 3CMAP 3I56P 1Q7YQ 3CCQP 3G6EP 1QVFO 3CCEP 3CMEP 1VQ6P 1Q82Q 3CXCO 1YITP 1Q81Q 1VQNP 2OTLP 1VQLP 1VQ4P 1VQ8P 3CCJP 1YJWP 1M1KQ 1YJNP 1VQ7P
chains in the Genus database with same CATH superfamily
1AYIA 3DS0A 3H32A 3CXHH 4UB8E 1IFNA 3IFMA 3LW5H 1ZMBA 2KG9A 1PEMA 4BXLA 1RF0C 1KV4A 5K5GB 4U0EA 1GXGA 3H1HE 1PGQA 1F80D 4WWIA 3WUVA 1L4AD 1AUMA 1EIAA 2VRSA 3FXEA 2B9BA 5CZDB 2K9JA 4PJ0E 3G4SP 2JO0A 3L71G 1LJ2A 5AW3B 1S3JA 5H2FE 4JBZA 3CC4P 2NPSD 1N8RQ 3CE7A 1HJ0A 4UHPB 3H1IG 2YXQB 1CEIA 4Y99C 3FX0A 1AFOA 1KFNA 2DW3A 2YKOA 1QL1A 2FACA 2AEMA 4WB4A 2HODA 2BHVA 4I6MC 2N98A 4H0LD 1KYOD 3RK2C 1KZUB 4WY4D 1M6NA 1LTJC 2VLPA 5TJHA 2ZJSE 1PL5A 1SQQD 3Q5SA 3CI9A 2IBZI 3H1LE 5CJ0A 5KLVE 2G8YA 4GODA 4H2YC 1NTMK 5APSA 1NTZK 4KT0J 3CXHD 3H6PA 2WTYA 3IN6A 2KG6A 3L75G 3RL0D 2Y0DA 2IBZE 2XV5A 2BEQD 3GHGC 1KILD 3CCQP 5KLVJ 3CMEP 2QRXA 2XZRA 4H13D 2KLVA 1VHNA 4IL6H 4EOTA 1M57D 2FYZA 1VQ5P 3EFGA 3I55P 1SQVG 1IFPA 1JNMA 2QEXP 5AVUB 2FVAA 2O01J 3I56P 2WPSA 1L0LD 1LWUA 1L0LK 1NKNA 1EC5A 3QWOC 5E79H 1SQQG 4C46A 4QKOA 2LXBA 4HJGH 2YO3A 4IL6X 4I7ZB 3GF7A 3T97A 4JYCA 2Y9YA 1LT9C 3L71E 4U0DA 3G6EP 4XFXA 1OFCX 4XRQA 3JSVC 3NTEA 1VQ8P 2KSJA 3VMAA 2IYOA 1J1DB 2RMZA 5CBNA 1BDCA 2M8NA 5APTA 4U0FA 1XTGB 1OR5A 1IJDB 5B66E 1SS1A 2K0YA 4K3AA 5TISE 1SQXK 3FWNA 2KSEA 3HUSC 3KZIH 3DTJA 1GD2E 1G1IA 3A0HE 2Q6QA 3S1KA 3CX5I 2I8DA 3H1IJ 1IFIA 1YI2P 1T3JA 2W6JH 3OAKA 3PTZA 2K93A 3N4XA 1Q90D 2GZIA 1D7MA 2P1JA 1NVOA 3C1LA 1E5WA 4GOEA 2AVAA 3M0AA 1N7SA 3L75E 1X3OA 1GL2A 3KDPB 1RY3A 3CX5E 3GF3A 1E79H 1EQ7A 1E0HA 1YJ9P 4PWVB 2P58A 1EZVD 3CMAP 3H0DA 2OTKE 2XV6A 1Q7YQ 1VQ6P 1Q81Q 3HE5A 4UB6E 1N73A 2FFDC 3H1KD 1FR2A 1VQ7P 2WSFH 1K04A 1HWTC 3JC22 3RG2A 2FXOA 1KC8Q 1MZ9A 3L75J 5CJ4A 4RO0A 1S4XA 1SQQE 3Q5PA 2KNCB 3H1JD 2JB0A 3GW6A 2Q3IA 2WITA 2EG5A 4NPDA 3VTPC 2PY8A 3H4EA 1SQVJ 2CNRA 2KZJA 2JEEA 3O6QB 3M1MA 2K9YA 2HR3A 2E74C 3G71P 1URQC 1Q86Q 3E1RA 3BCCG 3CXHE 2PAJA 4PV1D 4IZ6A 3G3ZA 3AE4C 5KLIC 3CCEP 2YO2A 1KILE 1JY3P 2JWDA 2OYIB 1NU1K 1J1EC 3AE2C 2N9BA 1ZP0C 2E43A 2JP3A 3M06A 2WSEH 1LNQA 5CCGC 2QJYC 1H8AA 3H1KG 1BCCD 2L0QA 3P8MC 2ZAEB 1FDIA 4W7YA 3DS1A 3CLQA 2KXPB 3RK3B 3D71A 1L0LE 3LW5J 4BRYA 1RH5B 3VP9A 3B5NA 1LTJA 2ERHA 4K35A 1S9KD 1SVFA 1P84D 2H8PD 3F5HA 2YKQA 3H1JG 2WMMA 2RKLA 4H44C 3EWKA 2MD9A 2ZXEB 5KJ7A 3M91A 1DEEG 2K37A 4CPGA 2ZT9C 5AW2B 4LGDE 2O01N 1ZMEC 1NHLA 1USDA 2JU1A 1RE3A 5KAIH 2GZFA 4XROA 4PD4D 3CCVP 3WMM0 3RBZA 5AVWB 3M0DC 3IR9A 2IZ1A 3L36A 2VLQA 3VRLC 5L8RJ 2CPSA 1W2EA 1AQ5A 3H32B 3E1IA 1N86A 1HUCA 4W80A 1BCCG 3NTNA 1JY3N 2K3RA 3L4FA 1L0IA 1X9VA 4U0CA 1RO2A 2KGCA 1M1JC 2KOSA 2YIUC 3FWLA 1PGJA 4HYTB 2CQ8A 4RESB 2OYHC 2PGDA 4YXWH 2GDWA 1GU5A 2KG8A 2KOPA 4ZNCA 2HLOA 1EXIA 2NPSA 3CD6P 2K9JB 2B88A 1JY3O 4DZOA 2N1TC 2JWAA 1NGMB 1M6EX 1LT9A 3L70J 2ROQA 1FC2C 1OVRA 3L73G 4I1LA 3WU2H 4HKGA 1SQPD 2QJPB 3MGEA 3MUDC 4H44B 4AUWA 2R5DA 1X22A 3H1KE 1FZFA 2LR2A 3BCCJ 5E79E 3M9HA 3EJDA 3EFFK 2HODB 2ZYAA 3G0VA 5KLVK 3HUSA 1FBMA 3OJAB 4MRTC 2KK7A 3H1JE 1CSBA 1E6JP 1VDFA 3V2QA 1YHQP 2FXPA 2Q5UA 1YBKA 3D70A 1YTZI 3SFEC 4F37A 3BRTB 1KN7A 1OZHA 4DT0A 3G29A 2B89A 2QM7A 2Z5HA 2ITAA 2KOOA 3BRVB 3H1JJ 3KZIE 2JO1A 1ZV8A 4BPFA 1SQPG 4IOIH 3DPHA 3EJBA 2QG4A 1BCCE 2K0XA 4ASWA 1JOCA 2FADA 1LT1A 1H89A 3SWFA 2FFDA 3U1CA 2I1JA 1EOQA 3LIEA 1FJPA 2AXCA 4YPCA 4BPHA 1S9KE 1RE4C 2CWOA 1LWUB 1P84E 2Z45A 1VF5C 2LF4A 5EJDA 1BCCJ 2PNGA 3H1ID 1N73C 1Y47A 2JYGA 2AFEA 2LXCB 1S5LH 4PD4E 1URQA 2GDYA 3NXSA 3PLNA 2WPRA 1PEOA 1NTKG 4GT1A 3DS4A 1FOSE 4ZKPA 3B8EB 2HFED 1K30A 1A8OA 1OMIA 1NOHA 4W7ZA 5CCGA 3L73J 1YQ4C 1S5LX 1RF1A 2WSFJ 3ZDMA 2OYOA 3IAOA 2NO8A 1JO5A 3TNUB 1PPJG 3L75D 3AE9C 1WRGA 5F2KA 3CX5D 2WSCH 1J2JB 3RBXA 3SWKA 5AW4B 1SFCD 3NMDA 4TT3H 2PEQA 4OGQB 2J58A 1VKUA 1N7SB 2D2CC 5HGLA 2SPZA 2K94A 1DD4A 5EW5E 1GL2B 1SQVD 4MN4C 4EDFA 1SQVK 1ZOYC 4NPFX 2L4BA 4IFFA 1SQPE 4PXHB 3B5NC 1RQUA 2E76C 1PIXA 1VF5B 2GUVA 1KQLA 4IFDK 1K05A 2M0BA 3M0DA 2MKVA 1SQQK 3HE5B 3HD7B 5KJ7C 4XFZA 2WSEJ 1JUNA 2PEIA 1LTIC 1RE3C 1SQPJ 2M5AA 5APYA 5BS1A 3W68A 3V6IA 1M1JA 4N6JA 1H0TA 1FU1A 5KP7B 1M7LA 5APQA 3P8CD 2OYHA 2G3AA 1JMMA 3OA7A 1LTBC 1FJKA 3RL0g 2OTLP 1DV5A 2JKVA 1L4AC 2GUSA 2POHA 3A0BH 3CCUP 3MTUE 5AW5B 5AVYB 2GZEA 2O1KA 2OTJP 2N1TA 2MY5A 2K2QA 1YTZT 3OW2O 4GKGA 3PRJA 4C7NA 3LIDA 5HV8A 4WVZA 4XE5B 2IPPA 3MUDA 5GTIH 3E2DA 4Y99B 2NPSC 1JCDA 2D2CB 1IZNB 3RK3D 1SFCC 1D1DA 3PH0A 4C7RA 3ITKA 2W27A 1PPJE 5AW1B 3RK2B 1NTKJ 4TLFA 2NRGA 4BRYB 3B5NB 3USSA 1LTJB 4H0LC 2CK3H 4WY4C 3MHVA 3H1IE 4GR2A 4WYMA 1IUQA 2LIWA 1VQOP 1ZNVA 2B87A 2W6BA 1T8KA 1QRJA 3CCMP 3G26A 4DG9A 4WBAA 2AXTH 3GZLA 2N5IA 3TK1A 5GTHH 3KXDA 1G2CA 5AW9B 3A2AA 2KGDA 2JU2A 1AVOA 1GDTA 2KS1A 1SQBJ 4L75A 5HGNA 4U3FJ 2KOGA 1VQPP 3GHGB 3L70D 4LC1A 2X2BA 3RL0C 2PEJA 2L5GB 2VSQA 1GK4A 1KILC 2A06D 1KB9H 3A5TA 4H13C 7CEIA 5AVQB 3BCCD 5CBOA 4XA4A 3AE8C 1K73Q 5KP8B 2E5YA 1RE4A 4KHXA 3S9OA 4R4MA 3Q3DA 1ZXGA 1TU3F 1H88A 2LPKA 1SQVE 3HTKA 1LP1A 4GR6A 2VLNA 2XZ0D 5B5EH 2AEFA 1LT9B 3A3YB 3VP8A 2FKWB 2ZVOB 3KQGA 1GZLA 1ZLLA 3G1IA 4IPYA 2M3EA 4EI2A 3TF5A 4UB8H 3L70G 1BGYG 3PJSK 2FY8A 2RN0A 1NJIQ 2A06G 3H47A 5APVA 1BE3G 4NPEA 3HUSB 1DEBA 1GTWA 1S72P 1VQKP 2R3CA 5KKZC 2V4HA 2AF8A 3P8CE 3QH9A 4ZKUA 1UNKA 3AE7C 1KQFB 2UWJE 1VQNP 1FDOA 3VMZA 2C9NY 3G28A 1WT6A 3RL0B 3V4WA 4PJ0H 2XKMA 1RNIA 1HVVA 4BPGA 1DIPA 1AV1A 3RGUA 2FQ2A 1FAVA 1KD1Q 3VN0A 3UIAA 1RF1C 2W6AA 2LMLA 5H2FH 1JTHA 2K1AA 1OVVA 1ZRTD 3B5IA 1RHZB 2QJKC 2KUBA 3M9QA 3L37A 1NTMJ 5M1BA 4B86A 3FGAD 1Z56A 1OX3A 1VQ9P 1NTZJ 2GYKA 3RK3E 2GZGA 2XNXA 1IFMA 2E75D 2FFDB 1OWAA 2Y0CA 2KGEA 2RH0A 5BVZA 2A45H 1ZW0A 2K5XA 1NAFA 3BATA 1MFZA 3I5CA 1IO4A 1FS0E 3L73D 1JEKA 1HY8A 2ZYGA 1WMKA 2HPCA 1ACPA 2XNDH 4JPZB 4L76A 2MVVA 5AVXB 2HG5D 1EDJA 2WSCJ 2JR8A 2BQ1E 2IX7C 1L4AA 4YXDC 2E74B 1URQB 5KKZB 2FHSC 1T3UA 2QSIA 5KLIB 3L70E 1DX7A 1M90Q 4PV1C 3CC2P 2P67A 1OVUA 1J1EB 2Q7CA 2MF4A 3KPEA 1QEXA 1L0NG 5CCHD 2L6EA 3SFDC 5AW8B 2A06E 2QJYB 1A43A 2KI7B 3BCCE 1RF1B 3K5BA 1T6AA 2FBWC 3U59A 2WPTA 3WUTA 1SFCA 3TSIA 5AW0B 4IL6E 1FZCC 2Q1KA 1S2EA 1SQXJ 2CPBA 1BGYJ 5DJTB 5F2OA 4WY4A 1SQPK 1BE3J 4OGQD 2LKIA 1N7SD 1IFJA 1GL2D 5APWA 1IC2A 2ZT9B 4PH0A 2V7QH 1S1CX 2FYNC 3AE3C 1Y9BA 3F89A 2LL8A 2WQYC 1HH0A 2QVAA 3SSUA 1T2KD 5B66H 1PEUA 3Q2YA 3HD7D 1YQ3C 1KQGB 3H1HG 1VQMP 2N6ZA 2R3SA 2WT7A 4NEOA 3AEEC 3R4YA 4U0BA 2N50A 2QA4P 1KILA 2MR8A 2M5AB 2QIWA 2IDBA 1HQBA 1KB9I 2H43A 1AVYA 2XT1A 1M1JB 1H0TB 3KYQA 1N7LA 3MZWB 5GTHE 1YJNP 2YIUB 1JJ2O 3ABVC 2OYHB 4M0IA 2YXRB 2P10A 1NTKD 1U7JA 3TYYA 4HB1A 4IFMA 3AE6C 3HYBA 1FZEA 1OW6A 2YMKA 4L74A 2CG5B 1ZRTE 2N1TB 1W2BO 1PGOA 5BS2A 4DJGA 1PZQA 2XZ1C 1L0NE 2W8ZA 3II6A 3MGNA 3H25A 2C9LY 1EDLA 1N2DC 1PPJD 2A45G 4R4LA 2LKMA 3GG2A 3CWBD 2O1JA 1KYOH 4ZMDA 3U43A 3N7NA 1SQBD 2YMYA 1M1KQ 4U3FD 3RK2D 2QE7H 3AE5C 3T97B 3Q5RA 1HTLC 1BDDA 2R32A 4H2XC 3L73E 3AEDC 4AYCA 1L0NJ 2K88A 3P05A 3CCRP 2FYUD 4R0MA 2IYPA 2BASA 5AVRB 1VQLP 2O3JA 1NYHA 2B87B 1R5SA 1GW3A 3EJEA 5I4TG 3GJNA 4JYBA 2W83C 3RG6C 2N6YA 3Q1MA 1G2CB 3TDKA 3CPWO 1LTSC 2KS1B 2E1MA 2M8PA 3JCUH 3L74D 2L91A 2JGPA 2I1KA 4LLHA 4PH1A 2W90A 2KWLA 2KODA 1M8OB 3CWBG 3DS2A 3O8ZA 3V2NA 3NFQA 4HKZH 1SQBG 1EDKA 1RQVA 4U3FG 2L9FA 4XFJA 3MIWA 1LTTC 3L72G 2M3BA 2J59M 1JCCA 2A45I 3H1HJ 1MFTA 2XXMA 4M3LA 3BASA 2KGAA 2FYUG 1DNYA 3U1AA 4EYYQ 3PHLA 5EFWB 1PGPA 3V2RA 3DS3A 3GKLC 3V5BA 2JQ4A 2IZ0A 1N73B 4OH8B 1VPCA 3HTKB 3VMYA 1LP1B 4ASVA 4I7ZC 5HGMA 1PEQA 1GMJA 1R5LA 4DCKA 1CI6A 2KW2A 1UJZA 5AVSB 1IK7A 3L74G 2R44A 2FXMA 1J1DC 5KAIE 4KJMA 1YIJP 2KB7P 1EXJA 2YNYA 2Y9ZA 1NQ4A 3P7KA 1GU4A 1JY2P 1GXHA 1UIXA 1NTMD 5BU8B 2OQQA 2LTEA 1NTZD 3G1GA 3HZQA 2K0DX 1FZCA 1NTKE 5HGOA 1SP4A 5KAFH 1ZR4A 3H1LJ 2ZXXA 2Z5IA 1Z6MA 4XFYA 1JB0J 5CHXA 3HE4A 1A02F 3GLMA 5AVTB 1JTHB 2WSSH 2DNWA 5DCKA 1U7MA 3CWBE 2WWWA 2E42A 2E76B 5CMZA 3W67A 1Q82Q 1SQBE 1NH4A 3V4QA 2JYLA 4U3FE 3WU2E 2JAZA 4I2LC 2QM8A 1HJBA 2CGQA 3L72E 1NTMG 1GK6A 1JM0A 1KTMA 3AEBC 1NTZG 1KMIZ 4AQRD 2FYUE 2GZJA 1AJYA 1MV8A 2EHSA 1AQTA 3CWBJ 1YJWP 2HPCB 5HVCA 2KORA 1JY2N 3VOPA 1ZN5A 2GA1A 1BAJA 1VL2A 2E5TA 1A02J 1SQXD 2E74D 1URQD 1BGYD 5CCHA 3L72J 1L4AB 3CCLP 1FZGA 1M74A 2L22A 2MJZA 3E7KA 3L71J 1R8EA 1BE3D 2ZFCA 2FYUJ 2OGUA 3L74E 2H89C 2V7QJ 2NZ2A 2BUOA 3LMOA 1GPJA 1QL2A 1JY2O 1L0LG 2OYIC 3TNUA 1QVGO 2FQ0A 1GW4A 4OWFA 1FDMA 4D6TD 5CCGD 2ZYDA 4GDOA 1YYCA 1KORA 2PEMA 1T8ZA 3DS5A 1MKMA 2NPSB 1KYOI 4JQ0D 1SFCB 4EIJA 1P84H 3L74J 2AEJA 4GIFA 1PP9D 3RK3C 2PFXA 1HBWA 2KZIA 1UIIA 2PENA 1ZR2A 3AEGC 4H0LB 3D6ZA 1K8AQ 1USEA 1EDIA 4H44D 4WY4B 2IFMA 1OW7A 1IFDA 1QX8A 2KOQA 2ZT9D 1CW5A 2WPQA 2WPVB 3HD7A 1VQ4P 4PD4H 1KYOE 1SQXG 2PRRA 1X0TA 2AFDA 2PEKA 1OXZA 2M8LA 4QNBA 3AEAC 3D6YA 3CXHI 2WZ7A 1M56D 1MUUA 2BCCD 1LTAC 3PP5A 1FE6A 3TGUD 4BWNA 1S5LE 1RF0A 4O9BA 2XU6A 1X79B 1BSHA 2WT7B 4D6TG 1NTME 2KYVA 1KILB 1NTZE 2FVFA 4H13B 5DJUB 2P2UA 4COPA 1SQQJ 4N78D 1PP9G 1U57A 1QVFO 2BEZF 1NU1D 2N5HA 2ONTA 1KB9D 3JCUE 4JF7A 1FZAA 5AW6B 1DD3A 2HYNA 1EZVG 5AVZB 1L0ND 3V2PA 1L0NK 3A7OA 1IMQA 2PEOA 2YKPA 2GDXA 2N1TD 2C0XA 4COCA 1X8YA 4L73A 3MP7B 3GZMA 3Q20A 3IF4A 2BCCG 3TGUG 2JDIH 3LRYA 1LTGC 2QJPC 2XDJA 1OIPA 5APXA 1AF8A 1HF9A 3G9RA 5BU5A 2QNWA 5KTBA 2VLOA 2LOLA 2EFJA 3MD0A 4HH2A 4U7JA 1L0LJ 5AVVB 3NY7B 2Z44A 2H88C 2O01H 1NU1G 2KP8A 3C9IA 1SLQA 2EHTA 1SQXE 1L2PA 4DOJA 1AA0A 1BGYE 3GHGA 3G21A 2M5RA 3H1HD 2KIKA 2N9YB 3B4QA 2KLUA 2FAEA 2FQ1A 1BE3E 3KHUA 1NKZB 1NAYA 1CZQA 4N3YB 2IFNA 5JPAA 2FVEA 3A0BE 2H7HA 1EMVA 3AECC 1DH3A 4QMAA 1EZVI 4GOFA 1HGZA 2JJLA 4D6TE 1NWQA 2QJKB 3AEFC 1Q2NA 5KP6B 1YITP 5KAFE 3B4SA 1LGHB 1PP9E 5GTIE 2E75C 4U0AA 4H2WC 1JMBA 1FZBA 3FXDA 1EZVE 2DGYA 1VF5D 1PFIA 1PV3A 4D6TJ 2Y0EA 1LWUC 4RJTA 3M9BA 3CCJP 2MVUA 3R2PA 3S4RA 2KNCA 4OVNF 5TISH 1KQSO 5AW7B 2MR7A 2R5BA 3WUUA 2ZVNB 2J5UA 1RO0A 3CC7P 1HGVA 3WBHA 2WVRA 3H1LD 1PP9J 2BCCE 5KLVD 3CL3D 3TGUE 3A0HH 2EIAA 2KR5A 3EQ2A 3O6QA 2M8RA 3AE1C 1Y8AA 1CI6B 2P7JA 3HRNA 3CXCO 2AXTE 4PV1B 1QGKB 1QLED 2K92A 3H1KJ 2OYIA 3CCSP 3B71A 1OW8A 1MZ8A 1NTKK 1XTCC 2IBZD 1NO4A 1W5CE 5CCHC 2OARA 3BVHA 2Q3EA 2BCCJ 1BSNA 4N78E 3GMAA 3TGUJ 1NU1E 3CX5H 2LIUA 1KFMA 1KB9E 1FZCB 4Z1MH 2C0WA 1P84I 4C7NB 4CA3A 2PP6A 3VYIA 2Z4EA 1BXIA 4UB6H 2Q9IA 4Y28J 1KLPA 3C8VA 2D2CD 1IMPA 3SWYA 1SQBK 1IK9A 3HE4B 5F2NA 2E75B 3H1LG 4A7PA 4OGQC 2P9XA 5KLVG 1NU1J 1N7SC 4PD4I 1L0HA 2FYNB 1GL2C 3B5ND 2E76D 2Z46A 3L72D 2GM4A 1K9MQ 5B5EE 3L71D 2JBGA 1G1JA 2FYUK 5KJ7D 5APUA 1T2KC 4YTPC 1FOSF 4RKUJ 5C39A 3HD7C 3P32A 3VMXA 3L35A 2IBZG
chains in the Genus database with same CATH topology
3DS2A 3DS0A 3LRYA 4GR2A 1NJIQ 1KQSO 1JJ2O 3CD6P 4WYMA 3H47A 4M0IA 1IUQA 1YI2P 1VQOP 1RO0A 3CC7P 2PENA 3WBHA 1ZMBA 2CWOA 1K8AQ 1QRJA 1M90Q 3CC2P 2Z45A 3CCMP 1M6EX 1PEMA 3G26A 5DCKA 1S72P 1VQKP 2EIAA 4XFZA 2L6EA 3HYBA 3DS1A 3CCQP 2LF4A 2PEIA 4U0EA 3CMEP 1Q82Q 3CXCO 2EFJA 1VQNP 1VQ4P 3MGEA 3G28A 2JYLA 2Z44A 2JYGA 1A43A 1W2BO 2PEKA 1AUMA 2XXMA 1EIAA 2M8LA 5BS2A 1RNIA 4QNBA 1VQ5P 5BS1A 5HGNA 3CCSP 1VQPP 3I55P 1KD1Q 1YJ9P 2PEJA 2QEXP 3DS3A 3G4SP 3G0VA 2OARA 3G21A 3CMAP 3H0DA 3I56P 2XV6A 5HGMA 1Q7YQ 2JO0A 1PEOA 1VQ6P 1Q81Q 1PEQA 2OTLP 3DS4A 5F2OA 3B5IA 1E6JP 1YJWP 1M1KQ 1VQ7P 1K30A 1YHQP 1K73Q 1A8OA 4XROA 3CCUP 3CC4P 3CCVP 1KC8Q 1N8RQ 5JPAA 1BAJA 1VQ9P 2OTJP 3P05A 4PH0A 4COPA 3OW2O 3VRLC 3CCRP 1YIJP 3CCLP 1M74A 4U0DA 3G6EP 1QVFO 4XFXA 3G29A 2BHVA 4XRQA 1YITP 1VQLP 3NTEA 2ONTA 5F2NA 1VQ8P 1PEUA 2EG5A 2P9XA 4GR6A 2PY8A 2BUOA 3H4EA 1M6NA 3E2DA 5I4TG 2M8NA 3G1GA 5F2KA 4U0FA 4U0CA 3RG6C 1RO2A 3M1MA 2Z46A 1VQMP 1QVGO 2PEOA 3HZQA 3G71P 1D1DA 4U0AA 1Q86Q 1K9MQ 5HGOA 3CPWO 3DPHA 3G1IA 4U0BA 2PEQA 4IPYA 2E1MA 2M8PA 2QA4P 4COCA 2PEMA 2DGYA 3DS5A 5HGLA 3DTJA 3CCEP 3Q20A 2BQ1E 2XT1A 4PH1A 3CCJP 1EOQA 2KODA 1YJNP 4XFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B O;  1YHQ P;  1K73 Q;  1NJI Q;  1KQS O;  1JJ2 O;  3CD6 P;  3CCU P;  3CC4 P;  3CCV P;  1VQ5 P;  3CCS P;  1VQP P;  1YI2 P;  1VQO P;  1VQM P;  1QVG O;  1KC8 Q;  1N8R Q;  3I55 P;  3CC7 P;  1VQ9 P;  3G71 P;  1Q86 Q;  2OTJ P;  1K9M Q;  1K8A Q;  1M90 Q;  1KD1 Q;  1YJ9 P;  3CC2 P;  2QEX P;  3CPW O;  3CCM P;  3OW2 O;  3G4S P;  1S72 P;  1VQK P;  3CCR P;  2QA4 P;  1YIJ P;  3CCL P;  3CMA P;  3I56 P;  1Q7Y Q;  3CCQ P;  3G6E P;  1QVF O;  3CCE P;  3CME P;  1VQ6 P;  1Q82 Q;  3CXC O;  1YIT P;  1Q81 Q;  1VQN P;  2OTL P;  1VQL P;  1VQ4 P;  1VQ8 P;  3CCJ P;  1YJW P;  1M1K Q;  1YJN P;  1VQ7 P; 
#chains in the Genus database with same CATH topology
 1AYI A;  3DS0 A;  3H32 A;  3CXH H;  4UB8 E;  1IFN A;  3IFM A;  3LW5 H;  1ZMB A;  2KG9 A;  1PEM A;  4BXL A;  1RF0 C;  1KV4 A;  5K5G B;  4U0E A;  1GXG A;  3H1H E;  1PGQ A;  1F80 D;  4WWI A;  3WUV A;  1L4A D;  1AUM A;  1EIA A;  2VRS A;  3FXE A;  2B9B A;  5CZD B;  2K9J A;  4PJ0 E;  3G4S P;  2JO0 A;  3L71 G;  1LJ2 A;  5AW3 B;  1S3J A;  5H2F E;  4JBZ A;  3CC4 P;  2NPS D;  1N8R Q;  3CE7 A;  1HJ0 A;  4UHP B;  3H1I G;  2YXQ B;  1CEI A;  4Y99 C;  3FX0 A;  1AFO A;  1KFN A;  2DW3 A;  2YKO A;  1QL1 A;  2FAC A;  2AEM A;  4WB4 A;  2HOD A;  2BHV A;  4I6M C;  2N98 A;  4H0L D;  1KYO D;  3RK2 C;  1KZU B;  4WY4 D;  1M6N A;  1LTJ C;  2VLP A;  5TJH A;  2ZJS E;  1PL5 A;  1SQQ D;  3Q5S A;  3CI9 A;  2IBZ I;  3H1L E;  5CJ0 A;  5KLV E;  2G8Y A;  4GOD A;  4H2Y C;  1NTM K;  5APS A;  1NTZ K;  4KT0 J;  3CXH D;  3H6P A;  2WTY A;  3IN6 A;  2KG6 A;  3L75 G;  3RL0 D;  2Y0D A;  2IBZ E;  2XV5 A;  2BEQ D;  3GHG C;  1KIL D;  3CCQ P;  5KLV J;  3CME P;  2QRX A;  2XZR A;  4H13 D;  2KLV A;  1VHN A;  4IL6 H;  4EOT A;  1M57 D;  2FYZ A;  1VQ5 P;  3EFG A;  3I55 P;  1SQV G;  1IFP A;  1JNM A;  2QEX P;  5AVU B;  2FVA A;  2O01 J;  3I56 P;  2WPS A;  1L0L D;  1LWU A;  1L0L K;  1NKN A;  1EC5 A;  3QWO C;  5E79 H;  1SQQ G;  4C46 A;  4QKO A;  2LXB A;  4HJG H;  2YO3 A;  4IL6 X;  4I7Z B;  3GF7 A;  3T97 A;  4JYC A;  2Y9Y A;  1LT9 C;  3L71 E;  4U0D A;  3G6E P;  4XFX A;  1OFC X;  4XRQ A;  3JSV C;  3NTE A;  1VQ8 P;  2KSJ A;  3VMA A;  2IYO A;  1J1D B;  2RMZ A;  5CBN A;  1BDC A;  2M8N A;  5APT A;  4U0F A;  1XTG B;  1OR5 A;  1IJD B;  5B66 E;  1SS1 A;  2K0Y A;  4K3A A;  5TIS E;  1SQX K;  3FWN A;  2KSE A;  3HUS C;  3KZI H;  3DTJ A;  1GD2 E;  1G1I A;  3A0H E;  2Q6Q A;  3S1K A;  3CX5 I;  2I8D A;  3H1I J;  1IFI A;  1YI2 P;  1T3J A;  2W6J H;  3OAK A;  3PTZ A;  2K93 A;  3N4X A;  1Q90 D;  2GZI A;  1D7M A;  2P1J A;  1NVO A;  3C1L A;  1E5W A;  4GOE A;  2AVA A;  3M0A A;  1N7S A;  3L75 E;  1X3O A;  1GL2 A;  3KDP B;  1RY3 A;  3CX5 E;  3GF3 A;  1E79 H;  1EQ7 A;  1E0H A;  1YJ9 P;  4PWV B;  2P58 A;  1EZV D;  3CMA P;  3H0D A;  2OTK E;  2XV6 A;  1Q7Y Q;  1VQ6 P;  1Q81 Q;  3HE5 A;  4UB6 E;  1N73 A;  2FFD C;  3H1K D;  1FR2 A;  1VQ7 P;  2WSF H;  1K04 A;  1HWT C;  3JC2 2;  3RG2 A;  2FXO A;  1KC8 Q;  1MZ9 A;  3L75 J;  5CJ4 A;  4RO0 A;  1S4X A;  1SQQ E;  3Q5P A;  2KNC B;  3H1J D;  2JB0 A;  3GW6 A;  2Q3I A;  2WIT A;  2EG5 A;  4NPD A;  3VTP C;  2PY8 A;  3H4E A;  1SQV J;  2CNR A;  2KZJ A;  2JEE A;  3O6Q B;  3M1M A;  2K9Y A;  2HR3 A;  2E74 C;  3G71 P;  1URQ C;  1Q86 Q;  3E1R A;  3BCC G;  3CXH E;  2PAJ A;  4PV1 D;  4IZ6 A;  3G3Z A;  3AE4 C;  5KLI C;  3CCE P;  2YO2 A;  1KIL E;  1JY3 P;  2JWD A;  2OYI B;  1NU1 K;  1J1E C;  3AE2 C;  2N9B A;  1ZP0 C;  2E43 A;  2JP3 A;  3M06 A;  2WSE H;  1LNQ A;  5CCG C;  2QJY C;  1H8A A;  3H1K G;  1BCC D;  2L0Q A;  3P8M C;  2ZAE B;  1FDI A;  4W7Y A;  3DS1 A;  3CLQ A;  2KXP B;  3RK3 B;  3D71 A;  1L0L E;  3LW5 J;  4BRY A;  1RH5 B;  3VP9 A;  3B5N A;  1LTJ A;  2ERH A;  4K35 A;  1S9K D;  1SVF A;  1P84 D;  2H8P D;  3F5H A;  2YKQ A;  3H1J G;  2WMM A;  2RKL A;  4H44 C;  3EWK A;  2MD9 A;  2ZXE B;  5KJ7 A;  3M91 A;  1DEE G;  2K37 A;  4CPG A;  2ZT9 C;  5AW2 B;  4LGD E;  2O01 N;  1ZME C;  1NHL A;  1USD A;  2JU1 A;  1RE3 A;  5KAI H;  2GZF A;  4XRO A;  4PD4 D;  3CCV P;  3WMM 0;  3RBZ A;  5AVW B;  3M0D C;  3IR9 A;  2IZ1 A;  3L36 A;  2VLQ A;  3VRL C;  5L8R J;  2CPS A;  1W2E A;  1AQ5 A;  3H32 B;  3E1I A;  1N86 A;  1HUC A;  4W80 A;  1BCC G;  3NTN A;  1JY3 N;  2K3R A;  3L4F A;  1L0I A;  1X9V A;  4U0C A;  1RO2 A;  2KGC A;  1M1J C;  2KOS A;  2YIU C;  3FWL A;  1PGJ A;  4HYT B;  2CQ8 A;  4RES B;  2OYH C;  2PGD A;  4YXW H;  2GDW A;  1GU5 A;  2KG8 A;  2KOP A;  4ZNC A;  2HLO A;  1EXI A;  2NPS A;  3CD6 P;  2K9J B;  2B88 A;  1JY3 O;  4DZO A;  2N1T C;  2JWA A;  1NGM B;  1M6E X;  1LT9 A;  3L70 J;  2ROQ A;  1FC2 C;  1OVR A;  3L73 G;  4I1L A;  3WU2 H;  4HKG A;  1SQP D;  2QJP B;  3MGE A;  3MUD C;  4H44 B;  4AUW A;  2R5D A;  1X22 A;  3H1K E;  1FZF A;  2LR2 A;  3BCC J;  5E79 E;  3M9H A;  3EJD A;  3EFF K;  2HOD B;  2ZYA A;  3G0V A;  5KLV K;  3HUS A;  1FBM A;  3OJA B;  4MRT C;  2KK7 A;  3H1J E;  1CSB A;  1E6J P;  1VDF A;  3V2Q A;  1YHQ P;  2FXP A;  2Q5U A;  1YBK A;  3D70 A;  1YTZ I;  3SFE C;  4F37 A;  3BRT B;  1KN7 A;  1OZH A;  4DT0 A;  3G29 A;  2B89 A;  2QM7 A;  2Z5H A;  2ITA A;  2KOO A;  3BRV B;  3H1J J;  3KZI E;  2JO1 A;  1ZV8 A;  4BPF A;  1SQP G;  4IOI H;  3DPH A;  3EJB A;  2QG4 A;  1BCC E;  2K0X A;  4ASW A;  1JOC A;  2FAD A;  1LT1 A;  1H89 A;  3SWF A;  2FFD A;  3U1C A;  2I1J A;  1EOQ A;  3LIE A;  1FJP A;  2AXC A;  4YPC A;  4BPH A;  1S9K E;  1RE4 C;  2CWO A;  1LWU B;  1P84 E;  2Z45 A;  1VF5 C;  2LF4 A;  5EJD A;  1BCC J;  2PNG A;  3H1I D;  1N73 C;  1Y47 A;  2JYG A;  2AFE A;  2LXC B;  1S5L H;  4PD4 E;  1URQ A;  2GDY A;  3NXS A;  3PLN A;  2WPR A;  1PEO A;  1NTK G;  4GT1 A;  3DS4 A;  1FOS E;  4ZKP A;  3B8E B;  2HFE D;  1K30 A;  1A8O A;  1OMI A;  1NOH A;  4W7Z A;  5CCG A;  3L73 J;  1YQ4 C;  1S5L X;  1RF1 A;  2WSF J;  3ZDM A;  2OYO A;  3IAO A;  2NO8 A;  1JO5 A;  3TNU B;  1PPJ G;  3L75 D;  3AE9 C;  1WRG A;  5F2K A;  3CX5 D;  2WSC H;  1J2J B;  3RBX A;  3SWK A;  5AW4 B;  1SFC D;  3NMD A;  4TT3 H;  2PEQ A;  4OGQ B;  2J58 A;  1VKU A;  1N7S B;  2D2C C;  5HGL A;  2SPZ A;  2K94 A;  1DD4 A;  5EW5 E;  1GL2 B;  1SQV D;  4MN4 C;  4EDF A;  1SQV K;  1ZOY C;  4NPF X;  2L4B A;  4IFF A;  1SQP E;  4PXH B;  3B5N C;  1RQU A;  2E76 C;  1PIX A;  1VF5 B;  2GUV A;  1KQL A;  4IFD K;  1K05 A;  2M0B A;  3M0D A;  2MKV A;  1SQQ K;  3HE5 B;  3HD7 B;  5KJ7 C;  4XFZ A;  2WSE J;  1JUN A;  2PEI A;  1LTI C;  1RE3 C;  1SQP J;  2M5A A;  5APY A;  5BS1 A;  3W68 A;  3V6I A;  1M1J A;  4N6J A;  1H0T A;  1FU1 A;  5KP7 B;  1M7L A;  5APQ A;  3P8C D;  2OYH A;  2G3A A;  1JMM A;  3OA7 A;  1LTB C;  1FJK A;  3RL0 g;  2OTL P;  1DV5 A;  2JKV A;  1L4A C;  2GUS A;  2POH A;  3A0B H;  3CCU P;  3MTU E;  5AW5 B;  5AVY B;  2GZE A;  2O1K A;  2OTJ P;  2N1T A;  2MY5 A;  2K2Q A;  1YTZ T;  3OW2 O;  4GKG A;  3PRJ A;  4C7N A;  3LID A;  5HV8 A;  4WVZ A;  4XE5 B;  2IPP A;  3MUD A;  5GTI H;  3E2D A;  4Y99 B;  2NPS C;  1JCD A;  2D2C B;  1IZN B;  3RK3 D;  1SFC C;  1D1D A;  3PH0 A;  4C7R A;  3ITK A;  2W27 A;  1PPJ E;  5AW1 B;  3RK2 B;  1NTK J;  4TLF A;  2NRG A;  4BRY B;  3B5N B;  3USS A;  1LTJ B;  4H0L C;  2CK3 H;  4WY4 C;  3MHV A;  3H1I E;  4GR2 A;  4WYM A;  1IUQ A;  2LIW A;  1VQO P;  1ZNV A;  2B87 A;  2W6B A;  1T8K A;  1QRJ A;  3CCM P;  3G26 A;  4DG9 A;  4WBA A;  2AXT H;  3GZL A;  2N5I A;  3TK1 A;  5GTH H;  3KXD A;  1G2C A;  5AW9 B;  3A2A A;  2KGD A;  2JU2 A;  1AVO A;  1GDT A;  2KS1 A;  1SQB J;  4L75 A;  5HGN A;  4U3F J;  2KOG A;  1VQP P;  3GHG B;  3L70 D;  4LC1 A;  2X2B A;  3RL0 C;  2PEJ A;  2L5G B;  2VSQ A;  1GK4 A;  1KIL C;  2A06 D;  1KB9 H;  3A5T A;  4H13 C;  7CEI A;  5AVQ B;  3BCC D;  5CBO A;  4XA4 A;  3AE8 C;  1K73 Q;  5KP8 B;  2E5Y A;  1RE4 A;  4KHX A;  3S9O A;  4R4M A;  3Q3D A;  1ZXG A;  1TU3 F;  1H88 A;  2LPK A;  1SQV E;  3HTK A;  1LP1 A;  4GR6 A;  2VLN A;  2XZ0 D;  5B5E H;  2AEF A;  1LT9 B;  3A3Y B;  3VP8 A;  2FKW B;  2ZVO B;  3KQG A;  1GZL A;  1ZLL A;  3G1I A;  4IPY A;  2M3E A;  4EI2 A;  3TF5 A;  4UB8 H;  3L70 G;  1BGY G;  3PJS K;  2FY8 A;  2RN0 A;  1NJI Q;  2A06 G;  3H47 A;  5APV A;  1BE3 G;  4NPE A;  3HUS B;  1DEB A;  1GTW A;  1S72 P;  1VQK P;  2R3C A;  5KKZ C;  2V4H A;  2AF8 A;  3P8C E;  3QH9 A;  4ZKU A;  1UNK A;  3AE7 C;  1KQF B;  2UWJ E;  1VQN P;  1FDO A;  3VMZ A;  2C9N Y;  3G28 A;  1WT6 A;  3RL0 B;  3V4W A;  4PJ0 H;  2XKM A;  1RNI A;  1HVV A;  4BPG A;  1DIP A;  1AV1 A;  3RGU A;  2FQ2 A;  1FAV A;  1KD1 Q;  3VN0 A;  3UIA A;  1RF1 C;  2W6A A;  2LML A;  5H2F H;  1JTH A;  2K1A A;  1OVV A;  1ZRT D;  3B5I A;  1RHZ B;  2QJK C;  2KUB A;  3M9Q A;  3L37 A;  1NTM J;  5M1B A;  4B86 A;  3FGA D;  1Z56 A;  1OX3 A;  1VQ9 P;  1NTZ J;  2GYK A;  3RK3 E;  2GZG A;  2XNX A;  1IFM A;  2E75 D;  2FFD B;  1OWA A;  2Y0C A;  2KGE A;  2RH0 A;  5BVZ A;  2A45 H;  1ZW0 A;  2K5X A;  1NAF A;  3BAT A;  1MFZ A;  3I5C A;  1IO4 A;  1FS0 E;  3L73 D;  1JEK A;  1HY8 A;  2ZYG A;  1WMK A;  2HPC A;  1ACP A;  2XND H;  4JPZ B;  4L76 A;  2MVV A;  5AVX B;  2HG5 D;  1EDJ A;  2WSC J;  2JR8 A;  2BQ1 E;  2IX7 C;  1L4A A;  4YXD C;  2E74 B;  1URQ B;  5KKZ B;  2FHS C;  1T3U A;  2QSI A;  5KLI B;  3L70 E;  1DX7 A;  1M90 Q;  4PV1 C;  3CC2 P;  2P67 A;  1OVU A;  1J1E B;  2Q7C A;  2MF4 A;  3KPE A;  1QEX A;  1L0N G;  5CCH D;  2L6E A;  3SFD C;  5AW8 B;  2A06 E;  2QJY B;  1A43 A;  2KI7 B;  3BCC E;  1RF1 B;  3K5B A;  1T6A A;  2FBW C;  3U59 A;  2WPT A;  3WUT A;  1SFC A;  3TSI A;  5AW0 B;  4IL6 E;  1FZC C;  2Q1K A;  1S2E A;  1SQX J;  2CPB A;  1BGY J;  5DJT B;  5F2O A;  4WY4 A;  1SQP K;  1BE3 J;  4OGQ D;  2LKI A;  1N7S D;  1IFJ A;  1GL2 D;  5APW A;  1IC2 A;  2ZT9 B;  4PH0 A;  2V7Q H;  1S1C X;  2FYN C;  3AE3 C;  1Y9B A;  3F89 A;  2LL8 A;  2WQY C;  1HH0 A;  2QVA A;  3SSU A;  1T2K D;  5B66 H;  1PEU A;  3Q2Y A;  3HD7 D;  1YQ3 C;  1KQG B;  3H1H G;  1VQM P;  2N6Z A;  2R3S A;  2WT7 A;  4NEO A;  3AEE C;  3R4Y A;  4U0B A;  2N50 A;  2QA4 P;  1KIL A;  2MR8 A;  2M5A B;  2QIW A;  2IDB A;  1HQB A;  1KB9 I;  2H43 A;  1AVY A;  2XT1 A;  1M1J B;  1H0T B;  3KYQ A;  1N7L A;  3MZW B;  5GTH E;  1YJN P;  2YIU B;  1JJ2 O;  3ABV C;  2OYH B;  4M0I A;  2YXR B;  2P10 A;  1NTK D;  1U7J A;  3TYY A;  4HB1 A;  4IFM A;  3AE6 C;  3HYB A;  1FZE A;  1OW6 A;  2YMK A;  4L74 A;  2CG5 B;  1ZRT E;  2N1T B;  1W2B O;  1PGO A;  5BS2 A;  4DJG A;  1PZQ A;  2XZ1 C;  1L0N E;  2W8Z A;  3II6 A;  3MGN A;  3H25 A;  2C9L Y;  1EDL A;  1N2D C;  1PPJ D;  2A45 G;  4R4L A;  2LKM A;  3GG2 A;  3CWB D;  2O1J A;  1KYO H;  4ZMD A;  3U43 A;  3N7N A;  1SQB D;  2YMY A;  1M1K Q;  4U3F D;  3RK2 D;  2QE7 H;  3AE5 C;  3T97 B;  3Q5R A;  1HTL C;  1BDD A;  2R32 A;  4H2X C;  3L73 E;  3AED C;  4AYC A;  1L0N J;  2K88 A;  3P05 A;  3CCR P;  2FYU D;  4R0M A;  2IYP A;  2BAS A;  5AVR B;  1VQL P;  2O3J A;  1NYH A;  2B87 B;  1R5S A;  1GW3 A;  3EJE A;  5I4T G;  3GJN A;  4JYB A;  2W83 C;  3RG6 C;  2N6Y A;  3Q1M A;  1G2C B;  3TDK A;  3CPW O;  1LTS C;  2KS1 B;  2E1M A;  2M8P A;  3JCU H;  3L74 D;  2L91 A;  2JGP A;  2I1K A;  4LLH A;  4PH1 A;  2W90 A;  2KWL A;  2KOD A;  1M8O B;  3CWB G;  3DS2 A;  3O8Z A;  3V2N A;  3NFQ A;  4HKZ H;  1SQB G;  1EDK A;  1RQV A;  4U3F G;  2L9F A;  4XFJ A;  3MIW A;  1LTT C;  3L72 G;  2M3B A;  2J59 M;  1JCC A;  2A45 I;  3H1H J;  1MFT A;  2XXM A;  4M3L A;  3BAS A;  2KGA A;  2FYU G;  1DNY A;  3U1A A;  4EYY Q;  3PHL A;  5EFW B;  1PGP A;  3V2R A;  3DS3 A;  3GKL C;  3V5B A;  2JQ4 A;  2IZ0 A;  1N73 B;  4OH8 B;  1VPC A;  3HTK B;  3VMY A;  1LP1 B;  4ASV A;  4I7Z C;  5HGM A;  1PEQ A;  1GMJ A;  1R5L A;  4DCK A;  1CI6 A;  2KW2 A;  1UJZ A;  5AVS B;  1IK7 A;  3L74 G;  2R44 A;  2FXM A;  1J1D C;  5KAI E;  4KJM A;  1YIJ P;  2KB7 P;  1EXJ A;  2YNY A;  2Y9Z A;  1NQ4 A;  3P7K A;  1GU4 A;  1JY2 P;  1GXH A;  1UIX A;  1NTM D;  5BU8 B;  2OQQ A;  2LTE A;  1NTZ D;  3G1G A;  3HZQ A;  2K0D X;  1FZC A;  1NTK E;  5HGO A;  1SP4 A;  5KAF H;  1ZR4 A;  3H1L J;  2ZXX A;  2Z5I A;  1Z6M A;  4XFY A;  1JB0 J;  5CHX A;  3HE4 A;  1A02 F;  3GLM A;  5AVT B;  1JTH B;  2WSS H;  2DNW A;  5DCK A;  1U7M A;  3CWB E;  2WWW A;  2E42 A;  2E76 B;  5CMZ A;  3W67 A;  1Q82 Q;  1SQB E;  1NH4 A;  3V4Q A;  2JYL A;  4U3F E;  3WU2 E;  2JAZ A;  4I2L C;  2QM8 A;  1HJB A;  2CGQ A;  3L72 E;  1NTM G;  1GK6 A;  1JM0 A;  1KTM A;  3AEB C;  1NTZ G;  1KMI Z;  4AQR D;  2FYU E;  2GZJ A;  1AJY A;  1MV8 A;  2EHS A;  1AQT A;  3CWB J;  1YJW P;  2HPC B;  5HVC A;  2KOR A;  1JY2 N;  3VOP A;  1ZN5 A;  2GA1 A;  1BAJ A;  1VL2 A;  2E5T A;  1A02 J;  1SQX D;  2E74 D;  1URQ D;  1BGY D;  5CCH A;  3L72 J;  1L4A B;  3CCL P;  1FZG A;  1M74 A;  2L22 A;  2MJZ A;  3E7K A;  3L71 J;  1R8E A;  1BE3 D;  2ZFC A;  2FYU J;  2OGU A;  3L74 E;  2H89 C;  2V7Q J;  2NZ2 A;  2BUO A;  3LMO A;  1GPJ A;  1QL2 A;  1JY2 O;  1L0L G;  2OYI C;  3TNU A;  1QVG O;  2FQ0 A;  1GW4 A;  4OWF A;  1FDM A;  4D6T D;  5CCG D;  2ZYD A;  4GDO A;  1YYC A;  1KOR A;  2PEM A;  1T8Z A;  3DS5 A;  1MKM A;  2NPS B;  1KYO I;  4JQ0 D;  1SFC B;  4EIJ A;  1P84 H;  3L74 J;  2AEJ A;  4GIF A;  1PP9 D;  3RK3 C;  2PFX A;  1HBW A;  2KZI A;  1UII A;  2PEN A;  1ZR2 A;  3AEG C;  4H0L B;  3D6Z A;  1K8A Q;  1USE A;  1EDI A;  4H44 D;  4WY4 B;  2IFM A;  1OW7 A;  1IFD A;  1QX8 A;  2KOQ A;  2ZT9 D;  1CW5 A;  2WPQ A;  2WPV B;  3HD7 A;  1VQ4 P;  4PD4 H;  1KYO E;  1SQX G;  2PRR A;  1X0T A;  2AFD A;  2PEK A;  1OXZ A;  2M8L A;  4QNB A;  3AEA C;  3D6Y A;  3CXH I;  2WZ7 A;  1M56 D;  1MUU A;  2BCC D;  1LTA C;  3PP5 A;  1FE6 A;  3TGU D;  4BWN A;  1S5L E;  1RF0 A;  4O9B A;  2XU6 A;  1X79 B;  1BSH A;  2WT7 B;  4D6T G;  1NTM E;  2KYV A;  1KIL B;  1NTZ E;  2FVF A;  4H13 B;  5DJU B;  2P2U A;  4COP A;  1SQQ J;  4N78 D;  1PP9 G;  1U57 A;  1QVF O;  2BEZ F;  1NU1 D;  2N5H A;  2ONT A;  1KB9 D;  3JCU E;  4JF7 A;  1FZA A;  5AW6 B;  1DD3 A;  2HYN A;  1EZV G;  5AVZ B;  1L0N D;  3V2P A;  1L0N K;  3A7O A;  1IMQ A;  2PEO A;  2YKP A;  2GDX A;  2N1T D;  2C0X A;  4COC A;  1X8Y A;  4L73 A;  3MP7 B;  3GZM A;  3Q20 A;  3IF4 A;  2BCC G;  3TGU G;  2JDI H;  3LRY A;  1LTG C;  2QJP C;  2XDJ A;  1OIP A;  5APX A;  1AF8 A;  1HF9 A;  3G9R A;  5BU5 A;  2QNW A;  5KTB A;  2VLO A;  2LOL A;  2EFJ A;  3MD0 A;  4HH2 A;  4U7J A;  1L0L J;  5AVV B;  3NY7 B;  2Z44 A;  2H88 C;  2O01 H;  1NU1 G;  2KP8 A;  3C9I A;  1SLQ A;  2EHT A;  1SQX E;  1L2P A;  4DOJ A;  1AA0 A;  1BGY E;  3GHG A;  3G21 A;  2M5R A;  3H1H D;  2KIK A;  2N9Y B;  3B4Q A;  2KLU A;  2FAE A;  2FQ1 A;  1BE3 E;  3KHU A;  1NKZ B;  1NAY A;  1CZQ A;  4N3Y B;  2IFN A;  5JPA A;  2FVE A;  3A0B E;  2H7H A;  1EMV A;  3AEC C;  1DH3 A;  4QMA A;  1EZV I;  4GOF A;  1HGZ A;  2JJL A;  4D6T E;  1NWQ A;  2QJK B;  3AEF C;  1Q2N A;  5KP6 B;  1YIT P;  5KAF E;  3B4S A;  1LGH B;  1PP9 E;  5GTI E;  2E75 C;  4U0A A;  4H2W C;  1JMB A;  1FZB A;  3FXD A;  1EZV E;  2DGY A;  1VF5 D;  1PFI A;  1PV3 A;  4D6T J;  2Y0E A;  1LWU C;  4RJT A;  3M9B A;  3CCJ P;  2MVU A;  3R2P A;  3S4R A;  2KNC A;  4OVN F;  5TIS H;  1KQS O;  5AW7 B;  2MR7 A;  2R5B A;  3WUU A;  2ZVN B;  2J5U A;  1RO0 A;  3CC7 P;  1HGV A;  3WBH A;  2WVR A;  3H1L D;  1PP9 J;  2BCC E;  5KLV D;  3CL3 D;  3TGU E;  3A0H H;  2EIA A;  2KR5 A;  3EQ2 A;  3O6Q A;  2M8R A;  3AE1 C;  1Y8A A;  1CI6 B;  2P7J A;  3HRN A;  3CXC O;  2AXT E;  4PV1 B;  1QGK B;  1QLE D;  2K92 A;  3H1K J;  2OYI A;  3CCS P;  3B71 A;  1OW8 A;  1MZ8 A;  1NTK K;  1XTC C;  2IBZ D;  1NO4 A;  1W5C E;  5CCH C;  2OAR A;  3BVH A;  2Q3E A;  2BCC J;  1BSN A;  4N78 E;  3GMA A;  3TGU J;  1NU1 E;  3CX5 H;  2LIU A;  1KFM A;  1KB9 E;  1FZC B;  4Z1M H;  2C0W A;  1P84 I;  4C7N B;  4CA3 A;  2PP6 A;  3VYI A;  2Z4E A;  1BXI A;  4UB6 H;  2Q9I A;  4Y28 J;  1KLP A;  3C8V A;  2D2C D;  1IMP A;  3SWY A;  1SQB K;  1IK9 A;  3HE4 B;  5F2N A;  2E75 B;  3H1L G;  4A7P A;  4OGQ C;  2P9X A;  5KLV G;  1NU1 J;  1N7S C;  4PD4 I;  1L0H A;  2FYN B;  1GL2 C;  3B5N D;  2E76 D;  2Z46 A;  3L72 D;  2GM4 A;  1K9M Q;  5B5E E;  3L71 D;  2JBG A;  1G1J A;  2FYU K;  5KJ7 D;  5APU A;  1T2K C;  4YTP C;  1FOS F;  4RKU J;  5C39 A;  3HD7 C;  3P32 A;  3VMX A;  3L35 A;  2IBZ G; 
#chains in the Genus database with same CATH homology
 3DS2 A;  3DS0 A;  3LRY A;  4GR2 A;  1NJI Q;  1KQS O;  1JJ2 O;  3CD6 P;  4WYM A;  3H47 A;  4M0I A;  1IUQ A;  1YI2 P;  1VQO P;  1RO0 A;  3CC7 P;  2PEN A;  3WBH A;  1ZMB A;  2CWO A;  1K8A Q;  1QRJ A;  1M90 Q;  3CC2 P;  2Z45 A;  3CCM P;  1M6E X;  1PEM A;  3G26 A;  5DCK A;  1S72 P;  1VQK P;  2EIA A;  4XFZ A;  2L6E A;  3HYB A;  3DS1 A;  3CCQ P;  2LF4 A;  2PEI A;  4U0E A;  3CME P;  1Q82 Q;  3CXC O;  2EFJ A;  1VQN P;  1VQ4 P;  3MGE A;  3G28 A;  2JYL A;  2Z44 A;  2JYG A;  1A43 A;  1W2B O;  2PEK A;  1AUM A;  2XXM A;  1EIA A;  2M8L A;  5BS2 A;  1RNI A;  4QNB A;  1VQ5 P;  5BS1 A;  5HGN A;  3CCS P;  1VQP P;  3I55 P;  1KD1 Q;  1YJ9 P;  2PEJ A;  2QEX P;  3DS3 A;  3G4S P;  3G0V A;  2OAR A;  3G21 A;  3CMA P;  3H0D A;  3I56 P;  2XV6 A;  5HGM A;  1Q7Y Q;  2JO0 A;  1PEO A;  1VQ6 P;  1Q81 Q;  1PEQ A;  2OTL P;  3DS4 A;  5F2O A;  3B5I A;  1E6J P;  1YJW P;  1M1K Q;  1VQ7 P;  1K30 A;  1YHQ P;  1K73 Q;  1A8O A;  4XRO A;  3CCU P;  3CC4 P;  3CCV P;  1KC8 Q;  1N8R Q;  5JPA A;  1BAJ A;  1VQ9 P;  2OTJ P;  3P05 A;  4PH0 A;  4COP A;  3OW2 O;  3VRL C;  3CCR P;  1YIJ P;  3CCL P;  1M74 A;  4U0D A;  3G6E P;  1QVF O;  4XFX A;  3G29 A;  2BHV A;  4XRQ A;  1YIT P;  1VQL P;  3NTE A;  2ONT A;  5F2N A;  1VQ8 P;  1PEU A;  2EG5 A;  2P9X A;  4GR6 A;  2PY8 A;  2BUO A;  3H4E A;  1M6N A;  3E2D A;  5I4T G;  2M8N A;  3G1G A;  5F2K A;  4U0F A;  4U0C A;  3RG6 C;  1RO2 A;  3M1M A;  2Z46 A;  1VQM P;  1QVG O;  2PEO A;  3HZQ A;  3G71 P;  1D1D A;  4U0A A;  1Q86 Q;  1K9M Q;  5HGO A;  3CPW O;  3DPH A;  3G1I A;  4U0B A;  2PEQ A;  4IPY A;  2E1M A;  2M8P A;  2QA4 P;  4COC A;  2PEM A;  2DGY A;  3DS5 A;  5HGL A;  3DTJ A;  3CCE P;  3Q20 A;  2BQ1 E;  2XT1 A;  4PH1 A;  3CCJ P;  1EOQ A;  2KOD A;  1YJN P;  4XFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...