1N8RQ

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
143
Chain Sequence
TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 48
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01280 Ribosomal_L19e Ribosomal protein L19e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.60 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1n8rQ02
1.10.1650.10 Mainly Alpha Orthogonal Bundle 50s Ribosomal Protein L19e, Chain O, domain 1 50s Ribosomal Protein L19e, Chain O, domain 1 1n8rQ01
1.20.5.560 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single Heli x bin 1n8rQ03
1VQ7P 1VQ9P 2OTLP 3G71P 3G6EP 1Q86Q 1VQLP 1VQMP 1M90Q 1JJ2O 3CXCO 1S72P 1VQOP 1VQNP 1M1KQ 3CCSP 1QVGO 1N8RQ 3CC2P 1K73Q 1YIJP 1QVFO 1Q7YQ 3CCUP 3CMAP 3I56P 2QA4P 1VQPP 1VQ5P 1YJNP 3CCJP 1K8AQ 3CC7P 1KD1Q 3CCLP 1YI2P 3G4SP 2OTJP 3CMEP 2QEXP 1W2BO 1YJ9P 1Q82Q 1VQKP 3CPWO 1VQ6P 1VQ4P 1YITP 3CC4P 1K9MQ 1KQSO 3CCQP 1YHQP 3CCRP 3CCVP 3OW2O 1NJIQ 1Q81Q 1KC8Q 1VQ8P 3CCEP 1YJWP 3CD6P 3CCMP 3I55P
chains in the Genus database with same CATH superfamily
1CSBA 5APVA 3G71P 4C7NB 4WYMA 5APWA 3BCCD 3ABVC 1VPCA 3JCUE 1JTHA 4JF7A 1R5LA 1DX7A 2JO1A 2LXCB 2K37A 3SWYA 1GXHA 1LTGC 2OTJP 3U1CA 2OARA 1P84H 1OXZA 1IMPA 3G6EP 1AA0A 1M74A 3E7KA 3FWLA 5KLVD 4GR2A 2A45G 3HE5B 4PXHB 1N8RQ 2WSCJ 1L0IA 2QIWA 3HUSB 1L0NJ 1KQGB 2N1TA 1FAVA 2PY8A 2LR2A 1X0TA 3MP7B 4RKUJ 5KAIE 3K5BA 3TNUA 1J2JB 1L0NE 4GOFA 3HYBA 2GDYA 2LXBA 1N73A 1LT9A 2IBZI 3BRVB 5CBOA 1X8YA 2KGDA 2E74D 3KDPB 5B5EE 1P84I 1NTME 2UWJE 1UNKA 2Z4EA 1OW6A 3CD6P 1M7LA 5HGOA 2FQ1A 1HTLC 4BPFA 1BDCA 3RG2A 3KPEA 1RO0A 2LOLA 1QLED 2GYKA 1DEEG 4RESB 3GJNA 1CZQA 2QEXP 4JYCA 2BCCE 3KQGA 2P2UA 3V2PA 2N6ZA 1SQXJ 1KTMA 1AJYA 2FYUD 2FVEA 5HGMA 2FFDA 2XZ0D 2OYIA 3CX5E 2QVAA 1XTGB 2A06G 2KGEA 5GTIH 5BU8B 3G4SP 1S1CX 4H2YC 3SWKA 1AFOA 2XV6A 3PLNA 5CCHD 1ZMEC 3P7KA 3M0AA 1HY8A 5AW6B 5CCHC 3BVHA 4U0DA 2WT7A 2XNXA 2RMZA 1EC5A 4H2WC 1Q2NA 3GHGA 2YO3A 1RE3A 2KOOA 4BPHA 1SFCB 5AVYB 3VMZA 3O6QB 1ZMBA 2PNGA 2B87B 3RL0D 4DCKA 2C9NY 3RL0C 2QM7A 5BVZA 1IFNA 1FJKA 1SQPJ 4Z1MH 2JO0A 2QJPC 1ZP0C 4IL6E 2KR5A 3BRTB 2CWOA 4H2XC 1OZHA 2KI7B 5AVRB 3H6PA 1L2PA 2M8LA 5AVUB 2P58A 1YQ3C 2A06D 3G21A 2KOQA 4IPYA 2PEIA 1BSNA 5CJ4A 4XFJA 1NTMG 1S5LH 5CHXA 3DS0A 3S4RA 1UIIA 3N4XA 2JJLA 3KYQA 4OWFA 3HTKB 3TGUE 2Q5UA 2VLQA 3BASA 2FVFA 1N86A 3L70J 1M1JB 2PP6A 3PHLA 5DJUB 3ITKA 2PEMA 4MRTC 2BCCG 3EFGA 3Q1MA 5F2OA 1NKNA 2CQ8A 3L70E 2M5AA 3M06A 3NMDA 1W5CE 2KK7A 2P7JA 2VLPA 2RKLA 5KLIC 1L0ND 1YBKA 1RF1C 3IFMA 1NU1E 5CCGA 2PENA 2E5YA 4JYBA 1BE3J 2BEQD 3WUVA 2LKMA 3SFDC 2WITA 4I6MC 1FZAA 1SS1A 3AEGC 3C9IA 1BCCJ 1LTIC 2RH0A 3B5NB 3A0HE 1N2DC 1M8OB 2R3SA 2KXPB 2MY5A 2H8PD 1BCCE 1USEA 2IX7C 3G9RA 1ZNVA 3L73E 1DNYA 2ZXXA 4QMAA 2ZYAA 5E79H 1FDIA 3DS1A 2N98A 1MV8A 3IN6A 2JEEA 2WPQA 3VMXA 2IYPA 1F80D 2QG4A 5I4TG 4HH2A 2IBZE 3CC4P 2KOSA 4U0AA 1NAFA 5KTBA 2WPTA 2JQ4A 1AYIA 4U7JA 1QL2A 1P84E 3EWKA 1L0NK 3TGUG 1GD2E 3L75E 2O3JA 5APXA 1MZ9A 2FYNB 1BAJA 2AF8A 1W2BO 4W7ZA 1URQB 2FVAA 3M9QA 2P1JA 3CCVP 2L22A 1L4AD 4OGQD 1LTJC 3II6A 1RY3A 1PP9J 3F5HA 3L70G 1L4AC 1IFMA 1ACPA 4OGQC 2QA4P 1LT9C 3Q3DA 1RE4A 3E1IA 3FX0A 1G2CB 2VSQA 1LT1A 1JMMA 3H1IJ 2R5BA 1NWQA 1NU1G 2MVVA 1PV3A 2HODA 1YHQP 1FR2A 4TLFA 1SQPD 4U0BA 1Z6MA 1OVVA 3H1IE 1NO4A 1VQOP 1OW7A 4JPZB 2KS1B 2GUSA 1ZRTE 2IZ1A 3H1HJ 4W7YA 4ZKUA 1YI2P 2OGUA 1U57A 1U7JA 3E2DA 2JAZA 1LP1B 3MUDA 2JBGA 3NTNA 1JY2O 2N50A 4D6TJ 3H1HE 1BCCG 2FFDC 2OYIC 2KG6A 3L73G 4XFZA 5AW9B 1PEMA 1GXGA 3L70D 3Q5PA 1J1DC 2Y0EA 3G1IA 3GF3A 3CCRP 1E0HA 1CW5A 3LRYA 1NTZE 2KZIA 5TISH 5BS1A 1GL2A 1VF5C 1NU1D 2ROQA 2V4HA 2IBZG 4PV1D 2GDWA 4DJGA 4XRQA 4PV1C 2YNYA 1RE3C 1T8KA 3AE7C 5APYA 2L9FA 3L75G 3DS3A 2KOPA 1S3JA 1BE3D 1X9VA 3C8VA 4H13D 3AEDC 3OJAB 4GOEA 4H13C 4M0IA 1BCCD 3HD7A 2J5UA 4UB6H 1VL2A 2KLVA 3L73D 4NPEA 4GR6A 1KB9E 2W27A 3QWOC 3PH0A 3H0DA 1M1KQ 2M8RA 3LMOA 1LWUA 1IMQA 5H2FH 3M0DC 1W2EA 4U0FA 2C0XA 2FQ0A 3H1IG 2QJKC 2IBZD 2D2CD 1S5LE 1LGHB 2E5TA 1CEIA 3RL0B 4DG9A 2D2CC 4WWIA 4EOTA 1NU1K 3L75D 1YJNP 2QJPB 3TSIA 4C7RA 2JYGA 3NFQA 1FC2C 3H1HG 1EXIA 1FZFA 3Q5RA 1OWAA 4DZOA 4OVNF 1PGQA 2ZYGA 3HUSA 4H0LD 2W6BA 3TF5A 5CCGD 1MKMA 2K9JA 2WSFJ 2L5GB 4PD4H 2JWDA 4H0LC 3PRJA 5CCGC 2E42A 2GZEA 1N7SD 5KAFH 3HE4B 2LKIA 1NTZG 5JPAA 2K88A 1PP9D 1N7SC 1EZVI 2JYLA 1H89A 1KN7A 1NJIQ 2Q7CA 3ZDMA 2Y9ZA 4LC1A 1SP4A 2ZXEB 2K94A 1KYOH 1OIPA 4HKGA 3H1ID 4I1LA 5APQA 2O01H 2MR8A 3KXDA 5AW5B 1QVFO 1JOCA 1IUQA 1ZRTD 3TDKA 1LTBC 5GTHH 1OVRA 2WWWA 1LNQA 1Q90D 1VQ6P 2FXOA 2ONTA 2Z46A 5HVCA 3AE1C 4UB8H 3CC2P 2FXMA 4N3YB 5CJ0A 2WQYC 3V6IA 2Z5IA 1S2EA 2NPSA 5KLIB 3H1HD 1RF1B 4U0CA 4PD4I 3V2RA 3CCUP 5E79E 3B5IA 2JB0A 2O01N 4D6TD 3EJEA 2KORA 3T97A 3U59A 1KYOI 2KODA 3B4QA 3DS2A 1NTMJ 2M3EA 4O9BA 1RF0A 3GMAA 4EYYQ 2O1JA 2BCCJ 3MD0A 1ZOYC 1SFCA 2Q6QA 2Y9YA 1AQTA 5C39A 3W67A 1FE6A 1JTHB 2Y0DA 1RE4C 4OH8B 3OA7A 3DS4A 1R8EA 1H88A 2I8DA 1KQFB 2ZT9D 1KB9D 3LW5H 4N78D 2FY8A 3M1MA 5AW8B 4XROA 4COPA 1Z56A 1NTKE 2EG5A 2ZT9C 3VRLC 3H25A 3I56P 4JQ0D 1SQQJ 2Z45A 4K3AA 3KHUA 2M8PA 4AUWA 1PEQA 1GPJA 2DW3A 2M8NA 1MFTA 2V7QJ 2NZ2A 2FYZA 2LMLA 1OFCX 3Q5SA 3I5CA 1SQQE 1LTJB 3MUDC 3CXCO 2M3BA 5AVWB 2J59M 3NXSA 1NTZK 1L4AB 4OGQB 4WVZA 3LIEA 3A5TA 2JU2A 1K8AQ 1LT9B 3P32A 1Y8AA 3G26A 2KZJA 1QX8A 1Q81Q 3B4SA 2ZVOB 1AQ5A 1GL2D 2K5XA 4N6JA 3WU2H 1FOSE 4YPCA 1GL2C 3H1KE 2WSEH 5TISE 1G1IA 3L36A 3FXDA 5AW7B 1FZGA 2KGAA 5F2NA 3PTZA 2HG5D 3TGUJ 3P05A 1FDMA 4IFDK 1SLQA 2KP8A 1YIJP 2FFDB 1RO2A 1Y9BA 2O1KA 2OYIB 3RK3E 2GZIA 3RK2D 7CEIA 1J1DB 4C46A 2K0YA 2I1KA 3B5NA 3RK2C 4BRYB 1EOQA 1GK6A 1YYCA 1KILA 4GKGA 3GLMA 4LGDE 3AE9C 3IR9A 4U0EA 3SFEC 1VF5B 4UB6E 1FU1A 3B71A 1T6AA 1JY2P 5EFWB 2AXTH 4IZ6A 2WT7B 2P9XA 1LWUC 1NU1J 2C9LY 1OR5A 3D6ZA 4PV1B 3VMYA 2AXCA 3CCEP 1VDFA 1NTKG 2SPZA 5H2FE 3H4EA 4PH1A 3GW6A 2QRXA 1EZVE 5AVVB 1T2KD 1GMJA 3H32A 3FWNA 4H13B 1T2KC 4DT0A 1PEOA 1SQQG 2KOGA 2YMKA 1NTMD 4IFMA 1VQ9P 3AECC 1A02J 3L73J 1URQA 1FDOA 4R4LA 1N7LA 2H43A 1FZCA 2DNWA 1YQ4C 3JCUH 4NPFX 2E1MA 2KNCA 4PD4E 2FQ2A 4PWVB 2BCCD 2QJKB 4I2LC 3H1KG 3H47A 1SQBE 1ZR2A 2W83C 2D2CB 2XV5A 1M57D 2JGPA 2HPCB 3CX5D 2JU1A 1KD1Q 4RJTA 2W6JH 3GF7A 1KYOE 3L75J 4LLHA 2KG8A 1KILE 4RO0A 2CPBA 2OYOA 1ZV8A 1SQQD 1UJZA 2EFJA 5HV8A 2NPSC 2KW2A 1Q7YQ 2MVUA 1VQ5P 4R4MA 4H0LB 1NGMB 2HLOA 3V5BA 1A02F 2GDXA 2N1TD 1R5SA 1QEXA 3CCQP 1N7SB 2R5DA 2N1TC 1VQ7P 1EQ7A 1NTMK 1OVUA 1M90Q 2XZ1C 5APUA 5KP7B 2OYHA 2R44A 4I7ZC 1N73C 2E76D 3KZIH 1M6EX 1IJDB 2XNDH 4Y28J 1HGZA 1G1JA 3NY7B 2E76C 4XE5B 5EJDA 1EDLA 1BGYE 1EZVG 4GT1A 4Y99C 2L91A 1ZN5A 2J58A 1EDJA 1ZR4A 4WY4A 4NPDA 2BHVA 1NTKK 3RK3D 1H0TA 3SSUA 3TGUD 3RK3C 5CBNA 2XU6A 4IOIH 2KB7P 1PEUA 4EDFA 1JM0A 1DIPA 2LL8A 1GU5A 4MN4C 4GIFA 1SQQK 4WB4A 4PH0A 2LIUA 1NTZJ 2W8ZA 1E79H 1SQBG 1FBMA 5F2KA 2FXPA 3V2NA 1VF5D 5K5GB 5KLVE 1Q86Q 5GTIE 2Q3EA 3AEEC 3SWFA 3EJBA 2X2BA 1EZVD 4F37A 2QM8A 1KQLA 1KFNA 2N5HA 4IL6X 1DEBA 1LTTC 2CPSA 3GHGC 1KMIZ 1MZ8A 2HFED 2MD9A 3L37A 2K0XA 2HODB 2JP3A 1Y47A 3S1KA 3Q2YA 1QVGO 1ZW0A 2WSEJ 2ZT9B 2N5IA 1J1EC 3F89A 1A43A 4BXLA 3VMAA 2CG5B 5EW5E 2ZAEB 1CI6A 1PL5A 1IC2A 3FXEA 3EJDA 1WT6A 4K35A 3O8ZA 1JY3N 2GZGA 2N9YB 1BGYG 1M56D 2YO2A 3D71A 2CNRA 1KYOD 3A0BH 4C7NA 1LJ2A 3VN0A 2OTKE 2FYUE 4ASVA 5KP6B 1XTCC 1VHNA 1KILC 3TYYA 1P84D 1GL2B 4B86A 1HUCA 1S4XA 4KT0J 2PRRA 4IFFA 3W68A 1JEKA 1IFDA 5AVTB 3U43A 1RF1A 1YJWP 4XFXA 3I55P 3HE5A 3G3ZA 1RNIA 2AXTE 4PJ0H 2IFNA 1DD4A 1JB0J 1EIAA 2E75D 4ZMDA 4W80A 4AYCA 3HRNA 2YIUC 5KLVG 2E75C 3CI9A 2B88A 2CK3H 2WPVB 1USDA 1ZLLA 1IK7A 4YTPC 3RK2B 5AW2B 2IDBA 4CA3A 3A3YB 5AW4B 5BS2A 1SQBK 2P10A 1RHZB 2KSJA 3BATA 1PPJE 5TJHA 2G3AA 2K9YA 2OQQA 1LWUB 1FZCC 2KLUA 5AVZB 2LF4A 3CXHH 1SQVJ 1OX3A 2Y0CA 2YKPA 1NHLA 3GZMA 1DD3A 2ITAA 4XA4A 3RL0g 3CMAP 2KG9A 3WUTA 1IZNB 1SQVE 1D7MA 1NYHA 1K05A 5AVXB 2PEJA 1HVVA 2POHA 3MIWA 3A7OA 2WTYA 3R4YA 2BASA 3GKLC 4COCA 1NTZD 1E5WA 3QH9A 2VRSA 3IAOA 2JR8A 2PEOA 3V4WA 3CCJP 2K9JB 2FYUG 5CZDB 1OMIA 1S9KE 3AEFC 1PFIA 1BSHA 3C1LA 3CXHI 1LTJA 4CPGA 3DS5A 1L4AA 4UHPB 2FACA 2LIWA 2K1AA 1K04A 1S72P 1NVOA 4DOJA 1E6JP 1RQVA 3VOPA 3G29A 2NO8A 1QRJA 3O6QA 2B87A 2OYHC 1AV1A 5KKZC 1NTKJ 2BEZF 1JUNA 2E74C 2NRGA 2R3CA 3KZIE 3U1AA 2XKMA 1VQLP 1HQBA 3RBZA 2IZ0A 2K0DX 4WY4D 1FZBA 1KZUB 4L74A 2NPSB 4WY4C 5KP8B 4M3LA 2JWAA 3L71J 1T3UA 2QSIA 3RGUA 3L35A 3FGAD 5B66H 2N1TB 1PPJG 3L71E 1GZLA 4H44D 1KV4A 5KLVK 2C0WA 3TNUB 3VYIA 3T97B 3HTKA 4H44C 4I7ZB 1SQXE 1N73B 4BRYA 2FAEA 2LTEA 1M1JA 3L72J 3V2QA 3B8EB 3CL3D 3H1KJ 1IK9A 2E76B 2WMMA 1BDDA 1SQVG 4Y99B 1FJPA 5CMZA 2BQ1E 4AQRD 3L72E 2EIAA 1WMKA 2LPKA 4EI2A 3AE4C 4GDOA 3H1LJ 1HWTC 4L75A 4HYTB 1KQSO 1RH5B 2QJYC 3RK3B 5KJ7A 2A45H 1IFPA 3H1LE 4QKOA 1KB9H 4KHXA 1PPJD 2WVRA 1L0NG 5DCKA 3RBXA 2VLNA 4ZKPA 1AUMA 1L0LJ 3HD7D 1HGVA 1SQPE 1EDKA 1GW4A 3L4FA 5AVSB 1JNMA 1FOSF 3HD7C 1S5LX 1X79B 1QL1A 2FYUK 2QE7H 3L74J 1L0LE 3M0DA 4A7PA 4L76A 2XDJA 1SQVD 2YKQA 4GODA 2MR7A 1K30A 1Q82Q 1IO4A 3LIDA 4YXDC 3GHGB 2HPCA 3L74E 2Q9IA 2A45I 3A0BE 1JO5A 3MGNA 5AW3B 1KB9I 1NOHA 3TK1A 3WMM0 3D6YA 1J1EB 1MUUA 2ERHA 1S9KD 2K93A 1VQKP 2VLOA 1AVOA 3PJSK 3L71G 3MTUE 3UIAA 3CCMP 2HYNA 2MKVA 2WSSH 1RQUA 1OW8A 1SQXG 3S9OA 4NEOA 3CCSP 3HUSC 1PZQA 2WSFH 3P8MC 2IFMA 1NKZB 1DV5A 1SQBJ 3M9HA 1N7SA 3AE5C 4PJ0E 5AW0B 2ZYDA 3RG6C 3CLQA 2KYVA 1JMBA 1JY3P 1TU3F 1VKUA 3OAKA 2ZFCA 1VQ8P 2PEQA 3V4QA 3L72G 3GZLA 1BE3E 5KAFE 2JDIH 2FADA 3WBHA 2O01J 1G2CA 3AE8C 4HB1A 1KILB 3WUUA 2M5RA 2P67A 4U3FJ 1NTKD 1NQ4A 2H89C 1T3JA 1FS0E 2WPSA 1A8OA 2EHSA 1SQVK 1T8ZA 3CPWO 3CWBJ 2H88C 3H1LG 2PEKA 2KS1A 4U3FE 1KFMA 2M5AB 4EIJA 2NPSD 5GTHE 2BUOA 3VTPC 3L71D 1JCDA 1LTSC 1K73Q 3CXHE 3CWBE 4WBAA 4UB8E 5KAIH 2WSCH 1SQPG 2B9BA 3D70A 1SQXD 3H1JJ 1GTWA 4BWNA 1LP1A 3DPHA 2YIUB 2E75B 2W6AA 2RN0A 4HJGH 1YITP 3H32B 2Z44A 1IFJA 1HF9A 1M6NA 1L0LG 1EDIA 2AVAA 5DJTB 3H1JE 4JBZA 3CE7A 2WZ7A 5M1BA 5B5EH 2PFXA 1PIXA 1BGYJ 1HJ0A 1GU4A 3L72D 2K3RA 2MJZA 4L73A 1GDTA 3H1KD 3L74G 3P8CE 3E1RA 3JSVC 3N7NA 1GK4A 4ZNCA 2Q1KA 1EXJA 2FBWC 1K9MQ 2OTLP 1RF0C 2KSEA 1FZCB 3A2AA 1AVYA 2KNCB 2AEJA 2R32A 3G1GA 2GUVA 2Q3IA 3Q20A 1L0HA 2GZFA 3GG2A 1SFCD 3H1LD 1ZXGA 1VQPP 3CC7P 3BCCJ 1SFCC 3EQ2A 2K92A 3USSA 1PGJA 1IFIA 1PP9E 2CGQA 2KIKA 3OW2O 3CX5H 2PGDA 3PP5A 3M9BA 3LW5J 5AW1B 3BCCE 2M0BA 2FKWB 1X22A 2AEMA 2YKOA 1FZEA 1L0LD 1SVFA 5KLVJ 4HKZH 4ASWA 1BE3G 1YJ9P 1SQXK 3R2PA 1YTZI 2HR3A 3MHVA 3L74D 5CCHA 2V7QH 1VQMP 2L6EA 5AVQB 4XFYA 2K2QA 5APTA 5HGNA 3JC22 3IF4A 5B66E 3CCLP 4U3FG 2XT1A 1UIXA 2OYHB 4D6TE 2QNWA 4BPGA 3NTEA 5KKZB 3CX5I 3M91A 1HBWA 5APSA 2ZJSE 1WRGA 3CWBG 2E74B 1M1JC 1QGKB 2W90A 4IL6H 1HH0A 1JY2N 2MF4A 3G0VA 2XXMA 1JY3O 2H7HA 1YTZT 4WY4B 3CMEP 2EHTA 2YXRB 3H1JG 3WU2E 1PGOA 3HZQA 1H0TB 5KJ7D 4PD4D 2YXQB 1SQPK 1SQBD 5KJ7C 3HE4A 1MFZA 5L8RJ 3AE6C 2L0QA 2FYUJ 4H44B 4TT3H 5BU5A 1L0LK 1DH3A 1JCCA 3B5ND 2IYOA 1KILD 4N78E 4U3FD 1PGPA 3AEBC 3B5NC 2L4BA 2KUBA 1JJ2O 2E43A 1VQNP 2AEFA 1PP9G 1KLPA 3MGEA 4YXWH 3CXHD 1BXIA 3CWBD 3AE3C 3EFFK 2JKVA 2XZRA 4QNBA 2IPPA 2WPRA 2KGCA 1D1DA 3BCCG 3AE2C 1KORA 1VQ4P 2QJYB 3DTJA 1X3OA 2FHSC 2PAJA 3G28A 3H1JD 2I1JA 3VP9A 2B89A 2N6YA 1U7MA 4KJMA 2AFDA 3P8CD 3AEAC 2GA1A 3A0HH 2G8YA 2DGYA 1KC8Q 1GW3A 1AF8A 1BGYD 3VP8A 2Z5HA 1LTAC 2N9BA 1CI6B 3HD7B 1NAYA 1HJBA 5HGLA 4D6TG 1H8AA 2YMYA 2GZJA 3MZWB 1URQD 2FYNC 4R0MA 1URQC 2ZVNB 2AFEA 1EMVA 1NH4A 2GM4A 2KWLA 2A06E
chains in the Genus database with same CATH topology
5F2NA 3LRYA 1PEUA 3G71P 4WYMA 3G1GA 5HGMA 4COCA 5BS1A 2BQ1E 3Q20A 2PEMA 3P05A 3CCSP 1YIJP 4PH0A 2EIAA 1RO2A 2PEOA 5F2OA 1VQPP 3CCJP 3CC7P 1KD1Q 1BAJA 4XRQA 3RG6C 3G4SP 2OTJP 1W2BO 3DS4A 5JPAA 5F2KA 2OARA 1KQSO 1VQ8P 2JYLA 3CCVP 3OW2O 1NJIQ 2XV6A 1YJWP 3DS5A 2PEQA 4XFXA 3I55P 1EOQA 3DS3A 1RNIA 3G6EP 1Q86Q 1M74A 1JJ2O 4U0EA 1S72P 3M1MA 1VQNP 3WBHA 4GR2A 2EFJA 2PENA 4U0DA 4XROA 4COPA 1E6JP 1N8RQ 2EG5A 3MGEA 3VRLC 3G29A 1EIAA 1QVFO 1Q7YQ 3I56P 2QA4P 1QRJA 1IUQA 1VQ5P 4QNBA 2Z45A 2P9XA 5DCKA 4M0IA 1A8OA 1D1DA 1YJ9P 3CPWO 1ZMBA 2M8PA 1VQ6P 2PY8A 2ONTA 1AUMA 2Z46A 1VQ4P 3CCQP 1YHQP 3CCEP 1PEQA 3CC2P 2M8NA 2PEKA 3DTJA 4GR6A 4U0BA 1VQ7P 3H4EA 4PH1A 1VQLP 1VQMP 1M90Q 3HYBA 3CXCO 3G28A 2L6EA 2BUOA 5BS2A 3H0DA 1VQOP 1M1KQ 4U0CA 1QVGO 4XFYA 1K73Q 2JO0A 3CCUP 5HGNA 1A43A 1K8AQ 1M6EX 3CCLP 3B5IA 1YI2P 2XT1A 2CWOA 1K30A 3DPHA 1Q82Q 1PEOA 3G26A 3NTEA 4U0FA 2LF4A 1YITP 2DGYA 2Z44A 3CD6P 2M8LA 1Q81Q 3E2DA 1KC8Q 1M6NA 5HGOA 1VQ9P 3G21A 2KODA 3DS1A 3DS2A 4IPYA 3G0VA 2PEIA 5HGLA 2XXMA 1RO0A 2BHVA 3CMAP 3DS0A 1YJNP 4XFZA 1PEMA 2JYGA 2PEJA 5I4TG 3CMEP 2QEXP 3G1IA 1VQKP 2E1MA 3CC4P 1K9MQ 2OTLP 3CCRP 3HZQA 4U0AA 3CCMP 3H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 P;  1VQ9 P;  2OTL P;  3G71 P;  3G6E P;  1Q86 Q;  1VQL P;  1VQM P;  1M90 Q;  1JJ2 O;  3CXC O;  1S72 P;  1VQO P;  1VQN P;  1M1K Q;  3CCS P;  1QVG O;  1N8R Q;  3CC2 P;  1K73 Q;  1YIJ P;  1QVF O;  1Q7Y Q;  3CCU P;  3CMA P;  3I56 P;  2QA4 P;  1VQP P;  1VQ5 P;  1YJN P;  3CCJ P;  1K8A Q;  3CC7 P;  1KD1 Q;  3CCL P;  1YI2 P;  3G4S P;  2OTJ P;  3CME P;  2QEX P;  1W2B O;  1YJ9 P;  1Q82 Q;  1VQK P;  3CPW O;  1VQ6 P;  1VQ4 P;  1YIT P;  3CC4 P;  1K9M Q;  1KQS O;  3CCQ P;  1YHQ P;  3CCR P;  3CCV P;  3OW2 O;  1NJI Q;  1Q81 Q;  1KC8 Q;  1VQ8 P;  3CCE P;  1YJW P;  3CD6 P;  3CCM P;  3I55 P; 
#chains in the Genus database with same CATH topology
 1CSB A;  5APV A;  3G71 P;  4C7N B;  4WYM A;  5APW A;  3BCC D;  3ABV C;  1VPC A;  3JCU E;  1JTH A;  4JF7 A;  1R5L A;  1DX7 A;  2JO1 A;  2LXC B;  2K37 A;  3SWY A;  1GXH A;  1LTG C;  2OTJ P;  3U1C A;  2OAR A;  1P84 H;  1OXZ A;  1IMP A;  3G6E P;  1AA0 A;  1M74 A;  3E7K A;  3FWL A;  5KLV D;  4GR2 A;  2A45 G;  3HE5 B;  4PXH B;  1N8R Q;  2WSC J;  1L0I A;  2QIW A;  3HUS B;  1L0N J;  1KQG B;  2N1T A;  1FAV A;  2PY8 A;  2LR2 A;  1X0T A;  3MP7 B;  4RKU J;  5KAI E;  3K5B A;  3TNU A;  1J2J B;  1L0N E;  4GOF A;  3HYB A;  2GDY A;  2LXB A;  1N73 A;  1LT9 A;  2IBZ I;  3BRV B;  5CBO A;  1X8Y A;  2KGD A;  2E74 D;  3KDP B;  5B5E E;  1P84 I;  1NTM E;  2UWJ E;  1UNK A;  2Z4E A;  1OW6 A;  3CD6 P;  1M7L A;  5HGO A;  2FQ1 A;  1HTL C;  4BPF A;  1BDC A;  3RG2 A;  3KPE A;  1RO0 A;  2LOL A;  1QLE D;  2GYK A;  1DEE G;  4RES B;  3GJN A;  1CZQ A;  2QEX P;  4JYC A;  2BCC E;  3KQG A;  2P2U A;  3V2P A;  2N6Z A;  1SQX J;  1KTM A;  1AJY A;  2FYU D;  2FVE A;  5HGM A;  2FFD A;  2XZ0 D;  2OYI A;  3CX5 E;  2QVA A;  1XTG B;  2A06 G;  2KGE A;  5GTI H;  5BU8 B;  3G4S P;  1S1C X;  4H2Y C;  3SWK A;  1AFO A;  2XV6 A;  3PLN A;  5CCH D;  1ZME C;  3P7K A;  3M0A A;  1HY8 A;  5AW6 B;  5CCH C;  3BVH A;  4U0D A;  2WT7 A;  2XNX A;  2RMZ A;  1EC5 A;  4H2W C;  1Q2N A;  3GHG A;  2YO3 A;  1RE3 A;  2KOO A;  4BPH A;  1SFC B;  5AVY B;  3VMZ A;  3O6Q B;  1ZMB A;  2PNG A;  2B87 B;  3RL0 D;  4DCK A;  2C9N Y;  3RL0 C;  2QM7 A;  5BVZ A;  1IFN A;  1FJK A;  1SQP J;  4Z1M H;  2JO0 A;  2QJP C;  1ZP0 C;  4IL6 E;  2KR5 A;  3BRT B;  2CWO A;  4H2X C;  1OZH A;  2KI7 B;  5AVR B;  3H6P A;  1L2P A;  2M8L A;  5AVU B;  2P58 A;  1YQ3 C;  2A06 D;  3G21 A;  2KOQ A;  4IPY A;  2PEI A;  1BSN A;  5CJ4 A;  4XFJ A;  1NTM G;  1S5L H;  5CHX A;  3DS0 A;  3S4R A;  1UII A;  3N4X A;  2JJL A;  3KYQ A;  4OWF A;  3HTK B;  3TGU E;  2Q5U A;  2VLQ A;  3BAS A;  2FVF A;  1N86 A;  3L70 J;  1M1J B;  2PP6 A;  3PHL A;  5DJU B;  3ITK A;  2PEM A;  4MRT C;  2BCC G;  3EFG A;  3Q1M A;  5F2O A;  1NKN A;  2CQ8 A;  3L70 E;  2M5A A;  3M06 A;  3NMD A;  1W5C E;  2KK7 A;  2P7J A;  2VLP A;  2RKL A;  5KLI C;  1L0N D;  1YBK A;  1RF1 C;  3IFM A;  1NU1 E;  5CCG A;  2PEN A;  2E5Y A;  4JYB A;  1BE3 J;  2BEQ D;  3WUV A;  2LKM A;  3SFD C;  2WIT A;  4I6M C;  1FZA A;  1SS1 A;  3AEG C;  3C9I A;  1BCC J;  1LTI C;  2RH0 A;  3B5N B;  3A0H E;  1N2D C;  1M8O B;  2R3S A;  2KXP B;  2MY5 A;  2H8P D;  1BCC E;  1USE A;  2IX7 C;  3G9R A;  1ZNV A;  3L73 E;  1DNY A;  2ZXX A;  4QMA A;  2ZYA A;  5E79 H;  1FDI A;  3DS1 A;  2N98 A;  1MV8 A;  3IN6 A;  2JEE A;  2WPQ A;  3VMX A;  2IYP A;  1F80 D;  2QG4 A;  5I4T G;  4HH2 A;  2IBZ E;  3CC4 P;  2KOS A;  4U0A A;  1NAF A;  5KTB A;  2WPT A;  2JQ4 A;  1AYI A;  4U7J A;  1QL2 A;  1P84 E;  3EWK A;  1L0N K;  3TGU G;  1GD2 E;  3L75 E;  2O3J A;  5APX A;  1MZ9 A;  2FYN B;  1BAJ A;  2AF8 A;  1W2B O;  4W7Z A;  1URQ B;  2FVA A;  3M9Q A;  2P1J A;  3CCV P;  2L22 A;  1L4A D;  4OGQ D;  1LTJ C;  3II6 A;  1RY3 A;  1PP9 J;  3F5H A;  3L70 G;  1L4A C;  1IFM A;  1ACP A;  4OGQ C;  2QA4 P;  1LT9 C;  3Q3D A;  1RE4 A;  3E1I A;  3FX0 A;  1G2C B;  2VSQ A;  1LT1 A;  1JMM A;  3H1I J;  2R5B A;  1NWQ A;  1NU1 G;  2MVV A;  1PV3 A;  2HOD A;  1YHQ P;  1FR2 A;  4TLF A;  1SQP D;  4U0B A;  1Z6M A;  1OVV A;  3H1I E;  1NO4 A;  1VQO P;  1OW7 A;  4JPZ B;  2KS1 B;  2GUS A;  1ZRT E;  2IZ1 A;  3H1H J;  4W7Y A;  4ZKU A;  1YI2 P;  2OGU A;  1U57 A;  1U7J A;  3E2D A;  2JAZ A;  1LP1 B;  3MUD A;  2JBG A;  3NTN A;  1JY2 O;  2N50 A;  4D6T J;  3H1H E;  1BCC G;  2FFD C;  2OYI C;  2KG6 A;  3L73 G;  4XFZ A;  5AW9 B;  1PEM A;  1GXG A;  3L70 D;  3Q5P A;  1J1D C;  2Y0E A;  3G1I A;  3GF3 A;  3CCR P;  1E0H A;  1CW5 A;  3LRY A;  1NTZ E;  2KZI A;  5TIS H;  5BS1 A;  1GL2 A;  1VF5 C;  1NU1 D;  2ROQ A;  2V4H A;  2IBZ G;  4PV1 D;  2GDW A;  4DJG A;  4XRQ A;  4PV1 C;  2YNY A;  1RE3 C;  1T8K A;  3AE7 C;  5APY A;  2L9F A;  3L75 G;  3DS3 A;  2KOP A;  1S3J A;  1BE3 D;  1X9V A;  3C8V A;  4H13 D;  3AED C;  3OJA B;  4GOE A;  4H13 C;  4M0I A;  1BCC D;  3HD7 A;  2J5U A;  4UB6 H;  1VL2 A;  2KLV A;  3L73 D;  4NPE A;  4GR6 A;  1KB9 E;  2W27 A;  3QWO C;  3PH0 A;  3H0D A;  1M1K Q;  2M8R A;  3LMO A;  1LWU A;  1IMQ A;  5H2F H;  3M0D C;  1W2E A;  4U0F A;  2C0X A;  2FQ0 A;  3H1I G;  2QJK C;  2IBZ D;  2D2C D;  1S5L E;  1LGH B;  2E5T A;  1CEI A;  3RL0 B;  4DG9 A;  2D2C C;  4WWI A;  4EOT A;  1NU1 K;  3L75 D;  1YJN P;  2QJP B;  3TSI A;  4C7R A;  2JYG A;  3NFQ A;  1FC2 C;  3H1H G;  1EXI A;  1FZF A;  3Q5R A;  1OWA A;  4DZO A;  4OVN F;  1PGQ A;  2ZYG A;  3HUS A;  4H0L D;  2W6B A;  3TF5 A;  5CCG D;  1MKM A;  2K9J A;  2WSF J;  2L5G B;  4PD4 H;  2JWD A;  4H0L C;  3PRJ A;  5CCG C;  2E42 A;  2GZE A;  1N7S D;  5KAF H;  3HE4 B;  2LKI A;  1NTZ G;  5JPA A;  2K88 A;  1PP9 D;  1N7S C;  1EZV I;  2JYL A;  1H89 A;  1KN7 A;  1NJI Q;  2Q7C A;  3ZDM A;  2Y9Z A;  4LC1 A;  1SP4 A;  2ZXE B;  2K94 A;  1KYO H;  1OIP A;  4HKG A;  3H1I D;  4I1L A;  5APQ A;  2O01 H;  2MR8 A;  3KXD A;  5AW5 B;  1QVF O;  1JOC A;  1IUQ A;  1ZRT D;  3TDK A;  1LTB C;  5GTH H;  1OVR A;  2WWW A;  1LNQ A;  1Q90 D;  1VQ6 P;  2FXO A;  2ONT A;  2Z46 A;  5HVC A;  3AE1 C;  4UB8 H;  3CC2 P;  2FXM A;  4N3Y B;  5CJ0 A;  2WQY C;  3V6I A;  2Z5I A;  1S2E A;  2NPS A;  5KLI B;  3H1H D;  1RF1 B;  4U0C A;  4PD4 I;  3V2R A;  3CCU P;  5E79 E;  3B5I A;  2JB0 A;  2O01 N;  4D6T D;  3EJE A;  2KOR A;  3T97 A;  3U59 A;  1KYO I;  2KOD A;  3B4Q A;  3DS2 A;  1NTM J;  2M3E A;  4O9B A;  1RF0 A;  3GMA A;  4EYY Q;  2O1J A;  2BCC J;  3MD0 A;  1ZOY C;  1SFC A;  2Q6Q A;  2Y9Y A;  1AQT A;  5C39 A;  3W67 A;  1FE6 A;  1JTH B;  2Y0D A;  1RE4 C;  4OH8 B;  3OA7 A;  3DS4 A;  1R8E A;  1H88 A;  2I8D A;  1KQF B;  2ZT9 D;  1KB9 D;  3LW5 H;  4N78 D;  2FY8 A;  3M1M A;  5AW8 B;  4XRO A;  4COP A;  1Z56 A;  1NTK E;  2EG5 A;  2ZT9 C;  3VRL C;  3H25 A;  3I56 P;  4JQ0 D;  1SQQ J;  2Z45 A;  4K3A A;  3KHU A;  2M8P A;  4AUW A;  1PEQ A;  1GPJ A;  2DW3 A;  2M8N A;  1MFT A;  2V7Q J;  2NZ2 A;  2FYZ A;  2LML A;  1OFC X;  3Q5S A;  3I5C A;  1SQQ E;  1LTJ B;  3MUD C;  3CXC O;  2M3B A;  5AVW B;  2J59 M;  3NXS A;  1NTZ K;  1L4A B;  4OGQ B;  4WVZ A;  3LIE A;  3A5T A;  2JU2 A;  1K8A Q;  1LT9 B;  3P32 A;  1Y8A A;  3G26 A;  2KZJ A;  1QX8 A;  1Q81 Q;  3B4S A;  2ZVO B;  1AQ5 A;  1GL2 D;  2K5X A;  4N6J A;  3WU2 H;  1FOS E;  4YPC A;  1GL2 C;  3H1K E;  2WSE H;  5TIS E;  1G1I A;  3L36 A;  3FXD A;  5AW7 B;  1FZG A;  2KGA A;  5F2N A;  3PTZ A;  2HG5 D;  3TGU J;  3P05 A;  1FDM A;  4IFD K;  1SLQ A;  2KP8 A;  1YIJ P;  2FFD B;  1RO2 A;  1Y9B A;  2O1K A;  2OYI B;  3RK3 E;  2GZI A;  3RK2 D;  7CEI A;  1J1D B;  4C46 A;  2K0Y A;  2I1K A;  3B5N A;  3RK2 C;  4BRY B;  1EOQ A;  1GK6 A;  1YYC A;  1KIL A;  4GKG A;  3GLM A;  4LGD E;  3AE9 C;  3IR9 A;  4U0E A;  3SFE C;  1VF5 B;  4UB6 E;  1FU1 A;  3B71 A;  1T6A A;  1JY2 P;  5EFW B;  2AXT H;  4IZ6 A;  2WT7 B;  2P9X A;  1LWU C;  1NU1 J;  2C9L Y;  1OR5 A;  3D6Z A;  4PV1 B;  3VMY A;  2AXC A;  3CCE P;  1VDF A;  1NTK G;  2SPZ A;  5H2F E;  3H4E A;  4PH1 A;  3GW6 A;  2QRX A;  1EZV E;  5AVV B;  1T2K D;  1GMJ A;  3H32 A;  3FWN A;  4H13 B;  1T2K C;  4DT0 A;  1PEO A;  1SQQ G;  2KOG A;  2YMK A;  1NTM D;  4IFM A;  1VQ9 P;  3AEC C;  1A02 J;  3L73 J;  1URQ A;  1FDO A;  4R4L A;  1N7L A;  2H43 A;  1FZC A;  2DNW A;  1YQ4 C;  3JCU H;  4NPF X;  2E1M A;  2KNC A;  4PD4 E;  2FQ2 A;  4PWV B;  2BCC D;  2QJK B;  4I2L C;  3H1K G;  3H47 A;  1SQB E;  1ZR2 A;  2W83 C;  2D2C B;  2XV5 A;  1M57 D;  2JGP A;  2HPC B;  3CX5 D;  2JU1 A;  1KD1 Q;  4RJT A;  2W6J H;  3GF7 A;  1KYO E;  3L75 J;  4LLH A;  2KG8 A;  1KIL E;  4RO0 A;  2CPB A;  2OYO A;  1ZV8 A;  1SQQ D;  1UJZ A;  2EFJ A;  5HV8 A;  2NPS C;  2KW2 A;  1Q7Y Q;  2MVU A;  1VQ5 P;  4R4M A;  4H0L B;  1NGM B;  2HLO A;  3V5B A;  1A02 F;  2GDX A;  2N1T D;  1R5S A;  1QEX A;  3CCQ P;  1N7S B;  2R5D A;  2N1T C;  1VQ7 P;  1EQ7 A;  1NTM K;  1OVU A;  1M90 Q;  2XZ1 C;  5APU A;  5KP7 B;  2OYH A;  2R44 A;  4I7Z C;  1N73 C;  2E76 D;  3KZI H;  1M6E X;  1IJD B;  2XND H;  4Y28 J;  1HGZ A;  1G1J A;  3NY7 B;  2E76 C;  4XE5 B;  5EJD A;  1EDL A;  1BGY E;  1EZV G;  4GT1 A;  4Y99 C;  2L91 A;  1ZN5 A;  2J58 A;  1EDJ A;  1ZR4 A;  4WY4 A;  4NPD A;  2BHV A;  1NTK K;  3RK3 D;  1H0T A;  3SSU A;  3TGU D;  3RK3 C;  5CBN A;  2XU6 A;  4IOI H;  2KB7 P;  1PEU A;  4EDF A;  1JM0 A;  1DIP A;  2LL8 A;  1GU5 A;  4MN4 C;  4GIF A;  1SQQ K;  4WB4 A;  4PH0 A;  2LIU A;  1NTZ J;  2W8Z A;  1E79 H;  1SQB G;  1FBM A;  5F2K A;  2FXP A;  3V2N A;  1VF5 D;  5K5G B;  5KLV E;  1Q86 Q;  5GTI E;  2Q3E A;  3AEE C;  3SWF A;  3EJB A;  2X2B A;  1EZV D;  4F37 A;  2QM8 A;  1KQL A;  1KFN A;  2N5H A;  4IL6 X;  1DEB A;  1LTT C;  2CPS A;  3GHG C;  1KMI Z;  1MZ8 A;  2HFE D;  2MD9 A;  3L37 A;  2K0X A;  2HOD B;  2JP3 A;  1Y47 A;  3S1K A;  3Q2Y A;  1QVG O;  1ZW0 A;  2WSE J;  2ZT9 B;  2N5I A;  1J1E C;  3F89 A;  1A43 A;  4BXL A;  3VMA A;  2CG5 B;  5EW5 E;  2ZAE B;  1CI6 A;  1PL5 A;  1IC2 A;  3FXE A;  3EJD A;  1WT6 A;  4K35 A;  3O8Z A;  1JY3 N;  2GZG A;  2N9Y B;  1BGY G;  1M56 D;  2YO2 A;  3D71 A;  2CNR A;  1KYO D;  3A0B H;  4C7N A;  1LJ2 A;  3VN0 A;  2OTK E;  2FYU E;  4ASV A;  5KP6 B;  1XTC C;  1VHN A;  1KIL C;  3TYY A;  1P84 D;  1GL2 B;  4B86 A;  1HUC A;  1S4X A;  4KT0 J;  2PRR A;  4IFF A;  3W68 A;  1JEK A;  1IFD A;  5AVT B;  3U43 A;  1RF1 A;  1YJW P;  4XFX A;  3I55 P;  3HE5 A;  3G3Z A;  1RNI A;  2AXT E;  4PJ0 H;  2IFN A;  1DD4 A;  1JB0 J;  1EIA A;  2E75 D;  4ZMD A;  4W80 A;  4AYC A;  3HRN A;  2YIU C;  5KLV G;  2E75 C;  3CI9 A;  2B88 A;  2CK3 H;  2WPV B;  1USD A;  1ZLL A;  1IK7 A;  4YTP C;  3RK2 B;  5AW2 B;  2IDB A;  4CA3 A;  3A3Y B;  5AW4 B;  5BS2 A;  1SQB K;  2P10 A;  1RHZ B;  2KSJ A;  3BAT A;  1PPJ E;  5TJH A;  2G3A A;  2K9Y A;  2OQQ A;  1LWU B;  1FZC C;  2KLU A;  5AVZ B;  2LF4 A;  3CXH H;  1SQV J;  1OX3 A;  2Y0C A;  2YKP A;  1NHL A;  3GZM A;  1DD3 A;  2ITA A;  4XA4 A;  3RL0 g;  3CMA P;  2KG9 A;  3WUT A;  1IZN B;  1SQV E;  1D7M A;  1NYH A;  1K05 A;  5AVX B;  2PEJ A;  1HVV A;  2POH A;  3MIW A;  3A7O A;  2WTY A;  3R4Y A;  2BAS A;  3GKL C;  4COC A;  1NTZ D;  1E5W A;  3QH9 A;  2VRS A;  3IAO A;  2JR8 A;  2PEO A;  3V4W A;  3CCJ P;  2K9J B;  2FYU G;  5CZD B;  1OMI A;  1S9K E;  3AEF C;  1PFI A;  1BSH A;  3C1L A;  3CXH I;  1LTJ A;  4CPG A;  3DS5 A;  1L4A A;  4UHP B;  2FAC A;  2LIW A;  2K1A A;  1K04 A;  1S72 P;  1NVO A;  4DOJ A;  1E6J P;  1RQV A;  3VOP A;  3G29 A;  2NO8 A;  1QRJ A;  3O6Q A;  2B87 A;  2OYH C;  1AV1 A;  5KKZ C;  1NTK J;  2BEZ F;  1JUN A;  2E74 C;  2NRG A;  2R3C A;  3KZI E;  3U1A A;  2XKM A;  1VQL P;  1HQB A;  3RBZ A;  2IZ0 A;  2K0D X;  4WY4 D;  1FZB A;  1KZU B;  4L74 A;  2NPS B;  4WY4 C;  5KP8 B;  4M3L A;  2JWA A;  3L71 J;  1T3U A;  2QSI A;  3RGU A;  3L35 A;  3FGA D;  5B66 H;  2N1T B;  1PPJ G;  3L71 E;  1GZL A;  4H44 D;  1KV4 A;  5KLV K;  2C0W A;  3TNU B;  3VYI A;  3T97 B;  3HTK A;  4H44 C;  4I7Z B;  1SQX E;  1N73 B;  4BRY A;  2FAE A;  2LTE A;  1M1J A;  3L72 J;  3V2Q A;  3B8E B;  3CL3 D;  3H1K J;  1IK9 A;  2E76 B;  2WMM A;  1BDD A;  1SQV G;  4Y99 B;  1FJP A;  5CMZ A;  2BQ1 E;  4AQR D;  3L72 E;  2EIA A;  1WMK A;  2LPK A;  4EI2 A;  3AE4 C;  4GDO A;  3H1L J;  1HWT C;  4L75 A;  4HYT B;  1KQS O;  1RH5 B;  2QJY C;  3RK3 B;  5KJ7 A;  2A45 H;  1IFP A;  3H1L E;  4QKO A;  1KB9 H;  4KHX A;  1PPJ D;  2WVR A;  1L0N G;  5DCK A;  3RBX A;  2VLN A;  4ZKP A;  1AUM A;  1L0L J;  3HD7 D;  1HGV A;  1SQP E;  1EDK A;  1GW4 A;  3L4F A;  5AVS B;  1JNM A;  1FOS F;  3HD7 C;  1S5L X;  1X79 B;  1QL1 A;  2FYU K;  2QE7 H;  3L74 J;  1L0L E;  3M0D A;  4A7P A;  4L76 A;  2XDJ A;  1SQV D;  2YKQ A;  4GOD A;  2MR7 A;  1K30 A;  1Q82 Q;  1IO4 A;  3LID A;  4YXD C;  3GHG B;  2HPC A;  3L74 E;  2Q9I A;  2A45 I;  3A0B E;  1JO5 A;  3MGN A;  5AW3 B;  1KB9 I;  1NOH A;  3TK1 A;  3WMM 0;  3D6Y A;  1J1E B;  1MUU A;  2ERH A;  1S9K D;  2K93 A;  1VQK P;  2VLO A;  1AVO A;  3PJS K;  3L71 G;  3MTU E;  3UIA A;  3CCM P;  2HYN A;  2MKV A;  2WSS H;  1RQU A;  1OW8 A;  1SQX G;  3S9O A;  4NEO A;  3CCS P;  3HUS C;  1PZQ A;  2WSF H;  3P8M C;  2IFM A;  1NKZ B;  1DV5 A;  1SQB J;  3M9H A;  1N7S A;  3AE5 C;  4PJ0 E;  5AW0 B;  2ZYD A;  3RG6 C;  3CLQ A;  2KYV A;  1JMB A;  1JY3 P;  1TU3 F;  1VKU A;  3OAK A;  2ZFC A;  1VQ8 P;  2PEQ A;  3V4Q A;  3L72 G;  3GZL A;  1BE3 E;  5KAF E;  2JDI H;  2FAD A;  3WBH A;  2O01 J;  1G2C A;  3AE8 C;  4HB1 A;  1KIL B;  3WUU A;  2M5R A;  2P67 A;  4U3F J;  1NTK D;  1NQ4 A;  2H89 C;  1T3J A;  1FS0 E;  2WPS A;  1A8O A;  2EHS A;  1SQV K;  1T8Z A;  3CPW O;  3CWB J;  2H88 C;  3H1L G;  2PEK A;  2KS1 A;  4U3F E;  1KFM A;  2M5A B;  4EIJ A;  2NPS D;  5GTH E;  2BUO A;  3VTP C;  3L71 D;  1JCD A;  1LTS C;  1K73 Q;  3CXH E;  3CWB E;  4WBA A;  4UB8 E;  5KAI H;  2WSC H;  1SQP G;  2B9B A;  3D70 A;  1SQX D;  3H1J J;  1GTW A;  4BWN A;  1LP1 A;  3DPH A;  2YIU B;  2E75 B;  2W6A A;  2RN0 A;  4HJG H;  1YIT P;  3H32 B;  2Z44 A;  1IFJ A;  1HF9 A;  1M6N A;  1L0L G;  1EDI A;  2AVA A;  5DJT B;  3H1J E;  4JBZ A;  3CE7 A;  2WZ7 A;  5M1B A;  5B5E H;  2PFX A;  1PIX A;  1BGY J;  1HJ0 A;  1GU4 A;  3L72 D;  2K3R A;  2MJZ A;  4L73 A;  1GDT A;  3H1K D;  3L74 G;  3P8C E;  3E1R A;  3JSV C;  3N7N A;  1GK4 A;  4ZNC A;  2Q1K A;  1EXJ A;  2FBW C;  1K9M Q;  2OTL P;  1RF0 C;  2KSE A;  1FZC B;  3A2A A;  1AVY A;  2KNC B;  2AEJ A;  2R32 A;  3G1G A;  2GUV A;  2Q3I A;  3Q20 A;  1L0H A;  2GZF A;  3GG2 A;  1SFC D;  3H1L D;  1ZXG A;  1VQP P;  3CC7 P;  3BCC J;  1SFC C;  3EQ2 A;  2K92 A;  3USS A;  1PGJ A;  1IFI A;  1PP9 E;  2CGQ A;  2KIK A;  3OW2 O;  3CX5 H;  2PGD A;  3PP5 A;  3M9B A;  3LW5 J;  5AW1 B;  3BCC E;  2M0B A;  2FKW B;  1X22 A;  2AEM A;  2YKO A;  1FZE A;  1L0L D;  1SVF A;  5KLV J;  4HKZ H;  4ASW A;  1BE3 G;  1YJ9 P;  1SQX K;  3R2P A;  1YTZ I;  2HR3 A;  3MHV A;  3L74 D;  5CCH A;  2V7Q H;  1VQM P;  2L6E A;  5AVQ B;  4XFY A;  2K2Q A;  5APT A;  5HGN A;  3JC2 2;  3IF4 A;  5B66 E;  3CCL P;  4U3F G;  2XT1 A;  1UIX A;  2OYH B;  4D6T E;  2QNW A;  4BPG A;  3NTE A;  5KKZ B;  3CX5 I;  3M91 A;  1HBW A;  5APS A;  2ZJS E;  1WRG A;  3CWB G;  2E74 B;  1M1J C;  1QGK B;  2W90 A;  4IL6 H;  1HH0 A;  1JY2 N;  2MF4 A;  3G0V A;  2XXM A;  1JY3 O;  2H7H A;  1YTZ T;  4WY4 B;  3CME P;  2EHT A;  2YXR B;  3H1J G;  3WU2 E;  1PGO A;  3HZQ A;  1H0T B;  5KJ7 D;  4PD4 D;  2YXQ B;  1SQP K;  1SQB D;  5KJ7 C;  3HE4 A;  1MFZ A;  5L8R J;  3AE6 C;  2L0Q A;  2FYU J;  4H44 B;  4TT3 H;  5BU5 A;  1L0L K;  1DH3 A;  1JCC A;  3B5N D;  2IYO A;  1KIL D;  4N78 E;  4U3F D;  1PGP A;  3AEB C;  3B5N C;  2L4B A;  2KUB A;  1JJ2 O;  2E43 A;  1VQN P;  2AEF A;  1PP9 G;  1KLP A;  3MGE A;  4YXW H;  3CXH D;  1BXI A;  3CWB D;  3AE3 C;  3EFF K;  2JKV A;  2XZR A;  4QNB A;  2IPP A;  2WPR A;  2KGC A;  1D1D A;  3BCC G;  3AE2 C;  1KOR A;  1VQ4 P;  2QJY B;  3DTJ A;  1X3O A;  2FHS C;  2PAJ A;  3G28 A;  3H1J D;  2I1J A;  3VP9 A;  2B89 A;  2N6Y A;  1U7M A;  4KJM A;  2AFD A;  3P8C D;  3AEA C;  2GA1 A;  3A0H H;  2G8Y A;  2DGY A;  1KC8 Q;  1GW3 A;  1AF8 A;  1BGY D;  3VP8 A;  2Z5H A;  1LTA C;  2N9B A;  1CI6 B;  3HD7 B;  1NAY A;  1HJB A;  5HGL A;  4D6T G;  1H8A A;  2YMY A;  2GZJ A;  3MZW B;  1URQ D;  2FYN C;  4R0M A;  1URQ C;  2ZVN B;  2AFE A;  1EMV A;  1NH4 A;  2GM4 A;  2KWL A;  2A06 E; 
#chains in the Genus database with same CATH homology
 5F2N A;  3LRY A;  1PEU A;  3G71 P;  4WYM A;  3G1G A;  5HGM A;  4COC A;  5BS1 A;  2BQ1 E;  3Q20 A;  2PEM A;  3P05 A;  3CCS P;  1YIJ P;  4PH0 A;  2EIA A;  1RO2 A;  2PEO A;  5F2O A;  1VQP P;  3CCJ P;  3CC7 P;  1KD1 Q;  1BAJ A;  4XRQ A;  3RG6 C;  3G4S P;  2OTJ P;  1W2B O;  3DS4 A;  5JPA A;  5F2K A;  2OAR A;  1KQS O;  1VQ8 P;  2JYL A;  3CCV P;  3OW2 O;  1NJI Q;  2XV6 A;  1YJW P;  3DS5 A;  2PEQ A;  4XFX A;  3I55 P;  1EOQ A;  3DS3 A;  1RNI A;  3G6E P;  1Q86 Q;  1M74 A;  1JJ2 O;  4U0E A;  1S72 P;  3M1M A;  1VQN P;  3WBH A;  4GR2 A;  2EFJ A;  2PEN A;  4U0D A;  4XRO A;  4COP A;  1E6J P;  1N8R Q;  2EG5 A;  3MGE A;  3VRL C;  3G29 A;  1EIA A;  1QVF O;  1Q7Y Q;  3I56 P;  2QA4 P;  1QRJ A;  1IUQ A;  1VQ5 P;  4QNB A;  2Z45 A;  2P9X A;  5DCK A;  4M0I A;  1A8O A;  1D1D A;  1YJ9 P;  3CPW O;  1ZMB A;  2M8P A;  1VQ6 P;  2PY8 A;  2ONT A;  1AUM A;  2Z46 A;  1VQ4 P;  3CCQ P;  1YHQ P;  3CCE P;  1PEQ A;  3CC2 P;  2M8N A;  2PEK A;  3DTJ A;  4GR6 A;  4U0B A;  1VQ7 P;  3H4E A;  4PH1 A;  1VQL P;  1VQM P;  1M90 Q;  3HYB A;  3CXC O;  3G28 A;  2L6E A;  2BUO A;  5BS2 A;  3H0D A;  1VQO P;  1M1K Q;  4U0C A;  1QVG O;  4XFY A;  1K73 Q;  2JO0 A;  3CCU P;  5HGN A;  1A43 A;  1K8A Q;  1M6E X;  3CCL P;  3B5I A;  1YI2 P;  2XT1 A;  2CWO A;  1K30 A;  3DPH A;  1Q82 Q;  1PEO A;  3G26 A;  3NTE A;  4U0F A;  2LF4 A;  1YIT P;  2DGY A;  2Z44 A;  3CD6 P;  2M8L A;  1Q81 Q;  3E2D A;  1KC8 Q;  1M6N A;  5HGO A;  1VQ9 P;  3G21 A;  2KOD A;  3DS1 A;  3DS2 A;  4IPY A;  3G0V A;  2PEI A;  5HGL A;  2XXM A;  1RO0 A;  2BHV A;  3CMA P;  3DS0 A;  1YJN P;  4XFZ A;  1PEM A;  2JYG A;  2PEJ A;  5I4T G;  3CME P;  2QEX P;  3G1I A;  1VQK P;  2E1M A;  3CC4 P;  1K9M Q;  2OTL P;  3CCR P;  3HZQ A;  4U0A A;  3CCM P;  3H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...